F475597
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 410 | 671 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300042007|Ga0439449_0059877|Ga0439449_0059877_876_1232 |
| Length | 118 |
| Sequence | MNTAVKSSADKGAASAPVRELAVNKLYNVIRAPRVSEKTARLQEVSNQYVFEVATDATKADIKIAIEKIFAVKVEAVNVVNVKGKQKAFKNRNGRRGDWRKAYVKLAEGQSIDVMARA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 4 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 5 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 6 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 7 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 8 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 9 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 10 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 11 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 12 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 13 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 14 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 15 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 16 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 17 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 18 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 19 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 20 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 21 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 22 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 26 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 37 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 38 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 39 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 40 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 42 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 87 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 100 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 101 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 105 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 106 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 107 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 108 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 109 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 110 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 111 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 198 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 200 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 201 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 202 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 203 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 204 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 205 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 206 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 210 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 211 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 219 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 220 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 221 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 225 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 226 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 227 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 230 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 231 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 232 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 233 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 234 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 235 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 236 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041455 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT | Metatranscriptome | Rhizoplane |
| 241 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 246 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 248 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 249 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 250 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 251 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 252 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 253 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 254 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 255 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 256 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 257 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 258 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 259 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 260 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 261 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 262 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 263 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 264 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 265 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 266 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 267 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 268 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 269 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 270 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 271 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 299 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 300 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 301 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 302 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 303 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300049163 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 314 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 315 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 357 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 358 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 359 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 360 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 361 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 362 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 363 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 364 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 367 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 369 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 370 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 371 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 372 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 373 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 374 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 375 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 376 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 377 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 378 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 379 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 380 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 381 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 384 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 385 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 386 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 387 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 388 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 389 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 390 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 391 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 392 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 393 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 394 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 395 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 396 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 401 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 402 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 403 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 404 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.79 |
| Metatranscriptomes | 15.17 |
| Isolates | 3.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.1 |
| Nodule | 0.14 |
| Rhizoplane | 4.05 |
| Rhizosphere | 81.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1598425 | 2162886007 | Bacteria | 810 |
| 2 | SwRhRL2b_contig_332562 | 2162886007 | Bacteria | 944 |
| 3 | JGI25150J39212_1000359 | 3300002774 | Bacteria | 22362 |
| 4 | JGI25151J46595_10000895 | 3300003187 | Bacteria | 23452 |
| 5 | JGI25151J46595_10007643 | 3300003187 | Bacteria | 5275 |
| 6 | JGI25151J46595_10013580 | 3300003187 | Bacteria | 3661 |
| 7 | JGI25153J46596_10000050 | 3300003215 | Bacteria | 140710 |
| 8 | JGI25153J46596_10122190 | 3300003215 | Bacteria | 585 |
| 9 | rootH2_10028426 | 3300003320 | Bacteria | 1049 |
| 10 | rootH1_10139366 | 3300003323 | Bacteria | 1057 |
| 11 | Ga0055526_1008987 | 3300003771 | Bacteria | 4886 |
| 12 | Ga0055537_1001096 | 3300003773 | Bacteria | 11761 |
| 13 | Ga0055524_1013602 | 3300003775 | Bacteria | 3064 |
| 14 | Ga0055524_1015666 | 3300003775 | Bacteria | 2753 |
| 15 | Ga0055536_1024910 | 3300003781 | Bacteria | 1719 |
| 16 | Ga0055536_1040186 | 3300003781 | Bacteria | 1116 |
| 17 | Ga0055534_1003331 | 3300003784 | Bacteria | 5088 |
| 18 | Ga0055534_1006907 | 3300003784 | Bacteria | 2790 |
| 19 | Ga0055528_1013611 | 3300003790 | Bacteria | 3070 |
| 20 | Ga0055528_1016393 | 3300003790 | Bacteria | 2622 |
| 21 | Ga0055530_10004966 | 3300003791 | Bacteria | 6579 |
| 22 | Ga0055540_1029568 | 3300003792 | Bacteria | 1281 |
| 23 | Ga0055531_10014020 | 3300003794 | Bacteria | 3645 |
| 24 | Ga0055531_10014865 | 3300003794 | Bacteria | 3476 |
| 25 | Ga0058692_1000785 | 3300003856 | Bacteria | 12735 |
| 26 | Ga0058859_11549133 | 3300004798 | Bacteria | 563 |
| 27 | Ga0058861_11921333 | 3300004800 | Bacteria | 1052 |
| 28 | Ga0058860_11990960 | 3300004801 | Bacteria | 715 |
| 29 | Ga0065714_10109302 | 3300005288 | Bacteria | 1502 |
| 30 | Ga0065714_10289934 | 3300005288 | Bacteria | 702 |
| 31 | Ga0065704_10006278 | 3300005289 | Bacteria | 2601 |
| 32 | Ga0065704_10030623 | 3300005289 | Bacteria | 1342 |
| 33 | Ga0065704_10253178 | 3300005289 | Bacteria | 984 |
| 34 | Ga0065715_10047422 | 3300005293 | Bacteria | 894 |
| 35 | Ga0065715_10471293 | 3300005293 | Bacteria | 798 |
| 36 | Ga0065715_10670981 | 3300005293 | Bacteria | 668 |
| 37 | Ga0070676_10167770 | 3300005328 | Bacteria | 1418 |
| 38 | Ga0070683_100194209 | 3300005329 | Bacteria | 1927 |
| 39 | Ga0070670_100143059 | 3300005331 | Bacteria | 2068 |
| 40 | Ga0070677_10499576 | 3300005333 | Bacteria | 659 |
| 41 | Ga0068869_100115364 | 3300005334 | Bacteria | 2048 |
| 42 | Ga0070666_11107642 | 3300005335 | Bacteria | 589 |
| 43 | Ga0070680_100255720 | 3300005336 | Bacteria | 1481 |
| 44 | Ga0070660_100058257 | 3300005339 | Bacteria | 2994 |
| 45 | Ga0070692_10305522 | 3300005345 | Bacteria | 973 |
| 46 | Ga0070668_100303029 | 3300005347 | Bacteria | 1341 |
| 47 | Ga0070668_100580531 | 3300005347 | Bacteria | 979 |
| 48 | Ga0070675_100105895 | 3300005354 | Bacteria | 2373 |
| 49 | Ga0070675_100213624 | 3300005354 | Bacteria | 1678 |
| 50 | Ga0070675_100666145 | 3300005354 | Bacteria | 946 |
| 51 | Ga0070671_100012931 | 3300005355 | Bacteria | 6725 |
| 52 | Ga0070671_100202548 | 3300005355 | Bacteria | 1683 |
| 53 | Ga0070674_100103259 | 3300005356 | Bacteria | 2081 |
| 54 | Ga0070673_100209228 | 3300005364 | Bacteria | 1684 |
| 55 | Ga0070659_100231145 | 3300005366 | Bacteria | 1528 |
| 56 | Ga0070667_101042766 | 3300005367 | Bacteria | 764 |
| 57 | Ga0070667_101847423 | 3300005367 | Bacteria | 569 |
| 58 | Ga0070709_10133238 | 3300005434 | Bacteria | 1699 |
| 59 | Ga0070713_100983439 | 3300005436 | Bacteria | 814 |
| 60 | Ga0070711_101313524 | 3300005439 | Bacteria | 628 |
| 61 | Ga0070700_101225275 | 3300005441 | Bacteria | 628 |
| 62 | Ga0070700_101566992 | 3300005441 | Bacteria | 562 |
| 63 | Ga0070700_101868106 | 3300005441 | Bacteria | 519 |
| 64 | Ga0070663_100793081 | 3300005455 | Bacteria | 812 |
| 65 | Ga0070663_101141416 | 3300005455 | Bacteria | 683 |
| 66 | Ga0070662_100282610 | 3300005457 | Bacteria | 1343 |
| 67 | Ga0070681_10205910 | 3300005458 | Bacteria | 1884 |
| 68 | Ga0068867_100365570 | 3300005459 | Bacteria | 1208 |
| 69 | Ga0068867_101380374 | 3300005459 | Bacteria | 653 |
| 70 | Ga0070679_100385818 | 3300005530 | Bacteria | 1347 |
| 71 | Ga0070679_100466934 | 3300005530 | Bacteria | 1206 |
| 72 | Ga0070679_100661303 | 3300005530 | Bacteria | 987 |
| 73 | Ga0070684_100843519 | 3300005535 | Bacteria | 857 |
| 74 | Ga0068853_102313218 | 3300005539 | Bacteria | 521 |
| 75 | Ga0070672_100087779 | 3300005543 | Bacteria | 2503 |
| 76 | Ga0070672_100212901 | 3300005543 | Bacteria | 1619 |
| 77 | Ga0070665_100152522 | 3300005548 | Bacteria | 2313 |
| 78 | Ga0070665_100308958 | 3300005548 | Bacteria | 1584 |
| 79 | Ga0070664_100483677 | 3300005564 | Bacteria | 1139 |
| 80 | Ga0068857_100976059 | 3300005577 | Bacteria | 815 |
| 81 | Ga0068856_100267129 | 3300005614 | Bacteria | 1727 |
| 82 | Ga0068852_100147811 | 3300005616 | Bacteria | 2182 |
| 83 | Ga0068852_100675721 | 3300005616 | Bacteria | 1042 |
| 84 | Ga0068859_100714138 | 3300005617 | Bacteria | 1093 |
| 85 | Ga0068866_10285085 | 3300005718 | Bacteria | 1025 |
| 86 | Ga0068861_101093583 | 3300005719 | Bacteria | 766 |
| 87 | Ga0068861_101325492 | 3300005719 | Bacteria | 701 |
| 88 | Ga0068870_10201962 | 3300005840 | Bacteria | 1206 |
| 89 | Ga0068870_10298836 | 3300005840 | Bacteria | 1016 |
| 90 | Ga0068870_11106647 | 3300005840 | Bacteria | 570 |
| 91 | Ga0068860_101372426 | 3300005843 | Bacteria | 728 |
| 92 | Ga0068862_100564998 | 3300005844 | Bacteria | 1088 |
| 93 | Ga0081539_10024522 | 3300005985 | Bacteria | 3909 |
| 94 | Ga0081539_10412345 | 3300005985 | Bacteria | 561 |
| 95 | Ga0075363_100330491 | 3300006048 | Bacteria | 888 |
| 96 | Ga0075363_100484729 | 3300006048 | Bacteria | 733 |
| 97 | Ga0075364_10738799 | 3300006051 | Bacteria | 671 |
| 98 | Ga0075362_10516426 | 3300006177 | Bacteria | 612 |
| 99 | Ga0075369_10150290 | 3300006186 | Bacteria | 1064 |
| 100 | Ga0075369_10383019 | 3300006186 | Bacteria | 662 |
| 101 | Ga0075369_10392157 | 3300006186 | Bacteria | 654 |
| 102 | Ga0075366_10356136 | 3300006195 | Bacteria | 899 |
| 103 | Ga0097621_100195694 | 3300006237 | Bacteria | 1753 |
| 104 | Ga0075430_101363114 | 3300006846 | Bacteria | 583 |
| 105 | Ga0097620_100714087 | 3300006931 | Bacteria | 1093 |
| 106 | Ga0105244_10048884 | 3300009036 | Bacteria | 2163 |
| 107 | Ga0105244_10438164 | 3300009036 | Bacteria | 601 |
| 108 | Ga0105240_10265037 | 3300009093 | Bacteria | 1980 |
| 109 | Ga0114129_11321426 | 3300009147 | Bacteria | 893 |
| 110 | Ga0105243_10036695 | 3300009148 | Bacteria | 3806 |
| 111 | Ga0105248_10864655 | 3300009177 | Bacteria | 1021 |
| 112 | Ga0105248_11070887 | 3300009177 | Bacteria | 911 |
| 113 | Ga0105248_12850805 | 3300009177 | Bacteria | 551 |
| 114 | Ga0105237_10517711 | 3300009545 | Bacteria | 1199 |
| 115 | Ga0105238_11245780 | 3300009551 | Bacteria | 769 |
| 116 | Ga0105249_11545416 | 3300009553 | Bacteria | 736 |
| 117 | Ga0105148_105283 | 3300009978 | Bacteria | 930 |
| 118 | Ga0105032_100517 | 3300009979 | Bacteria | 3853 |
| 119 | Ga0105028_105506 | 3300009993 | Bacteria | 1315 |
| 120 | Ga0105239_10078930 | 3300010375 | Bacteria | 3622 |
| 121 | Ga0105246_12229086 | 3300011119 | Bacteria | 534 |
| 122 | Ga0157328_1029174 | 3300012478 | Bacteria | 513 |
| 123 | Ga0157318_1005289 | 3300012482 | Bacteria | 815 |
| 124 | Ga0157343_1000309 | 3300012488 | Bacteria | 1875 |
| 125 | Ga0157322_1011551 | 3300012490 | Bacteria | 730 |
| 126 | Ga0157323_1018551 | 3300012495 | Bacteria | 639 |
| 127 | Ga0157314_1020158 | 3300012500 | Bacteria | 673 |
| 128 | Ga0157342_1054705 | 3300012507 | Bacteria | 571 |
| 129 | Ga0157327_1024845 | 3300012512 | Bacteria | 705 |
| 130 | Ga0157373_10142986 | 3300013100 | Bacteria | 1683 |
| 131 | Ga0157371_10083622 | 3300013102 | Bacteria | 2260 |
| 132 | Ga0157371_10440463 | 3300013102 | Bacteria | 957 |
| 133 | Ga0157370_10464246 | 3300013104 | Bacteria | 1163 |
| 134 | Ga0157370_11219759 | 3300013104 | Bacteria | 678 |
| 135 | Ga0157369_10312189 | 3300013105 | Bacteria | 1635 |
| 136 | Ga0157374_10365321 | 3300013296 | Bacteria | 1436 |
| 137 | Ga0157374_11148881 | 3300013296 | Bacteria | 797 |
| 138 | Ga0157374_12286767 | 3300013296 | Bacteria | 568 |
| 139 | Ga0157378_12618515 | 3300013297 | Bacteria | 557 |
| 140 | Ga0163162_10694593 | 3300013306 | Bacteria | 1139 |
| 141 | Ga0163162_10726495 | 3300013306 | Bacteria | 1114 |
| 142 | Ga0163162_11097464 | 3300013306 | Bacteria | 901 |
| 143 | Ga0157372_11124837 | 3300013307 | Bacteria | 908 |
| 144 | Ga0157375_10045770 | 3300013308 | Bacteria | 4260 |
| 145 | Ga0157375_10377773 | 3300013308 | Bacteria | 1584 |
| 146 | Ga0157375_10609150 | 3300013308 | Bacteria | 1251 |
| 147 | Ga0163163_11264080 | 3300014325 | Bacteria | 800 |
| 148 | Ga0182008_10183346 | 3300014497 | Bacteria | 1060 |
| 149 | Ga0182008_10379025 | 3300014497 | Bacteria | 756 |
| 150 | Ga0157377_10561482 | 3300014745 | Bacteria | 808 |
| 151 | Ga0157376_10315852 | 3300014969 | Bacteria | 1484 |
| 152 | Ga0163161_10172112 | 3300017792 | Bacteria | 1656 |
| 153 | Ga0163161_10348494 | 3300017792 | Bacteria | 1177 |
| 154 | Ga0206349_1852705 | 3300020075 | Bacteria | 1928 |
| 155 | Ga0207425_1000117 | 3300025245 | Bacteria | 74911 |
| 156 | Ga0207425_1005550 | 3300025245 | Bacteria | 3581 |
| 157 | Ga0207425_1048016 | 3300025245 | Bacteria | 789 |
| 158 | Ga0209129_1000011 | 3300025258 | Bacteria | 568657 |
| 159 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 160 | Ga0209565_1055030 | 3300025263 | Bacteria | 703 |
| 161 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 162 | Ga0209673_1002116 | 3300025273 | Bacteria | 14881 |
| 163 | Ga0209130_1007816 | 3300025284 | Bacteria | 3243 |
| 164 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 165 | Ga0209675_1006904 | 3300025291 | Bacteria | 4460 |
| 166 | Ga0209676_1001608 | 3300025292 | Bacteria | 20029 |
| 167 | Ga0209676_1004379 | 3300025292 | Bacteria | 7893 |
| 168 | Ga0209676_1004892 | 3300025292 | Bacteria | 7229 |
| 169 | Ga0209025_1000002 | 3300025294 | Bacteria | 1393142 |
| 170 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 171 | Ga0209025_1099920 | 3300025294 | Bacteria | 921 |
| 172 | Ga0209025_1150246 | 3300025294 | Bacteria | 644 |
| 173 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 174 | Ga0209564_1007141 | 3300025295 | Bacteria | 5828 |
| 175 | Ga0209758_1000003 | 3300025297 | Bacteria | 1398533 |
| 176 | Ga0209758_1035768 | 3300025297 | Bacteria | 1952 |
| 177 | Ga0209050_1001128 | 3300025298 | Bacteria | 32216 |
| 178 | Ga0209050_1025712 | 3300025298 | Bacteria | 1992 |
| 179 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 180 | Ga0209256_1003821 | 3300025299 | Bacteria | 10090 |
| 181 | Ga0207426_1068355 | 3300025302 | Bacteria | 999 |
| 182 | Ga0209051_1028616 | 3300025303 | Bacteria | 2197 |
| 183 | Ga0209257_1002665 | 3300025304 | Bacteria | 17133 |
| 184 | Ga0209257_1005259 | 3300025304 | Bacteria | 9234 |
| 185 | Ga0209257_1006382 | 3300025304 | Bacteria | 7632 |
| 186 | Ga0207697_10049742 | 3300025315 | Bacteria | 1730 |
| 187 | Ga0207655_1039647 | 3300025728 | Bacteria | 2042 |
| 188 | Ga0207682_10231592 | 3300025893 | Bacteria | 857 |
| 189 | Ga0207642_10720688 | 3300025899 | Bacteria | 630 |
| 190 | Ga0207645_10107422 | 3300025907 | Bacteria | 1805 |
| 191 | Ga0207645_10245072 | 3300025907 | Bacteria | 1185 |
| 192 | Ga0207643_10160910 | 3300025908 | Bacteria | 1351 |
| 193 | Ga0207705_10060885 | 3300025909 | Bacteria | 2727 |
| 194 | Ga0207707_10277754 | 3300025912 | Bacteria | 1451 |
| 195 | Ga0207660_10779635 | 3300025917 | Bacteria | 780 |
| 196 | Ga0207660_11681271 | 3300025917 | Bacteria | 511 |
| 197 | Ga0207657_10006384 | 3300025919 | Bacteria | 12243 |
| 198 | Ga0207649_10300149 | 3300025920 | Bacteria | 1174 |
| 199 | Ga0207652_10097888 | 3300025921 | Bacteria | 2586 |
| 200 | Ga0207681_10278322 | 3300025923 | Bacteria | 1316 |
| 201 | Ga0207694_11565903 | 3300025924 | Bacteria | 556 |
| 202 | Ga0207694_11706001 | 3300025924 | Bacteria | 530 |
| 203 | Ga0207650_10175272 | 3300025925 | Bacteria | 1706 |
| 204 | Ga0207650_11050256 | 3300025925 | Bacteria | 693 |
| 205 | Ga0207659_10442633 | 3300025926 | Bacteria | 1093 |
| 206 | Ga0207659_10621832 | 3300025926 | Bacteria | 922 |
| 207 | Ga0207659_10897028 | 3300025926 | Bacteria | 762 |
| 208 | Ga0207644_10011422 | 3300025931 | Bacteria | 5875 |
| 209 | Ga0207644_11169679 | 3300025931 | Bacteria | 646 |
| 210 | Ga0207644_11351237 | 3300025931 | Bacteria | 599 |
| 211 | Ga0207644_11880265 | 3300025931 | Bacteria | 500 |
| 212 | Ga0207690_10954289 | 3300025932 | Bacteria | 712 |
| 213 | Ga0207706_10239882 | 3300025933 | Bacteria | 1585 |
| 214 | Ga0207709_10000421 | 3300025935 | Bacteria | 41092 |
| 215 | Ga0207669_10076663 | 3300025937 | Bacteria | 2123 |
| 216 | Ga0207691_10076483 | 3300025940 | Bacteria | 3016 |
| 217 | Ga0207691_10107616 | 3300025940 | Bacteria | 2482 |
| 218 | Ga0207711_10147290 | 3300025941 | Bacteria | 2122 |
| 219 | Ga0207711_11110061 | 3300025941 | Bacteria | 732 |
| 220 | Ga0207667_11962249 | 3300025949 | Bacteria | 546 |
| 221 | Ga0207651_10648699 | 3300025960 | Bacteria | 927 |
| 222 | Ga0207668_10071707 | 3300025972 | Bacteria | 2475 |
| 223 | Ga0207668_10160776 | 3300025972 | Bacteria | 1750 |
| 224 | Ga0207640_12022250 | 3300025981 | Bacteria | 522 |
| 225 | Ga0207639_11174982 | 3300026041 | Bacteria | 720 |
| 226 | Ga0207678_10202573 | 3300026067 | Bacteria | 1697 |
| 227 | Ga0207678_10590558 | 3300026067 | Bacteria | 973 |
| 228 | Ga0207708_10419749 | 3300026075 | Bacteria | 1109 |
| 229 | Ga0207708_10543507 | 3300026075 | Bacteria | 979 |
| 230 | Ga0207702_11405688 | 3300026078 | Bacteria | 692 |
| 231 | Ga0207648_10084850 | 3300026089 | Bacteria | 2762 |
| 232 | Ga0207674_10301096 | 3300026116 | Bacteria | 1552 |
| 233 | Ga0207675_100966302 | 3300026118 | Bacteria | 870 |
| 234 | Ga0207675_102037818 | 3300026118 | Bacteria | 591 |
| 235 | Ga0207683_10335929 | 3300026121 | Bacteria | 1385 |
| 236 | Ga0207698_10196978 | 3300026142 | Bacteria | 1800 |
| 237 | Ga0207698_10450120 | 3300026142 | Bacteria | 1243 |
| 238 | Ga0209973_1001982 | 3300027252 | Bacteria | 1860 |
| 239 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 240 | Ga0209969_1000918 | 3300027360 | Bacteria | 3988 |
| 241 | Ga0209967_1002362 | 3300027364 | Bacteria | 2443 |
| 242 | Ga0209967_1009133 | 3300027364 | Bacteria | 1372 |
| 243 | Ga0209981_1010702 | 3300027378 | Bacteria | 1260 |
| 244 | Ga0209984_1000306 | 3300027424 | Bacteria | 5580 |
| 245 | Ga0209984_1067854 | 3300027424 | Bacteria | 531 |
| 246 | Ga0210000_1004942 | 3300027462 | Bacteria | 1931 |
| 247 | Ga0209995_1000770 | 3300027471 | Bacteria | 4923 |
| 248 | Ga0209968_1017243 | 3300027526 | Bacteria | 1151 |
| 249 | Ga0209999_1020896 | 3300027543 | Bacteria | 1202 |
| 250 | Ga0209982_1000032 | 3300027552 | Bacteria | 12541 |
| 251 | Ga0209982_1031999 | 3300027552 | Bacteria | 828 |
| 252 | Ga0209970_1035823 | 3300027614 | Bacteria | 873 |
| 253 | Ga0210002_1002375 | 3300027617 | Bacteria | 2717 |
| 254 | Ga0210002_1017845 | 3300027617 | Bacteria | 1132 |
| 255 | Ga0209983_1000295 | 3300027665 | Bacteria | 10386 |
| 256 | Ga0209971_1000410 | 3300027682 | Bacteria | 11534 |
| 257 | Ga0209974_10010367 | 3300027876 | Bacteria | 3144 |
| 258 | Ga0209974_10074748 | 3300027876 | Bacteria | 1160 |
| 259 | Ga0268266_10168036 | 3300028379 | Bacteria | 1989 |
| 260 | Ga0268266_10170446 | 3300028379 | Bacteria | 1975 |
| 261 | Ga0268265_10377972 | 3300028380 | Bacteria | 1302 |
| 262 | Ga0268264_10786813 | 3300028381 | Bacteria | 950 |
| 263 | Ga0311001_1058661 | 3300029277 | Bacteria | 788 |
| 264 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 265 | Ga0316177_1006784 | 3300030731 | Bacteria | 1565 |
| 266 | Ga0316176_1213588 | 3300030732 | Bacteria | 1389 |
| 267 | Ga0314311_1263094 | 3300030733 | Bacteria | 1663 |
| 268 | Ga0316178_1178759 | 3300030735 | Bacteria | 1029 |
| 269 | Ga0316180_1161841 | 3300030736 | Bacteria | 1095 |
| 270 | Ga0316183_1156957 | 3300030742 | Bacteria | 972 |
| 271 | Ga0316181_1110680 | 3300030744 | Bacteria | 690 |
| 272 | Ga0316182_1151288 | 3300030745 | Bacteria | 2446 |
| 273 | Ga0316182_1157126 | 3300030745 | Bacteria | 593 |
| 274 | Ga0316182_1184990 | 3300030745 | Bacteria | 909 |
| 275 | Ga0316182_1187071 | 3300030745 | Bacteria | 847 |
| 276 | Ga0307408_100181171 | 3300031548 | Bacteria | 1689 |
| 277 | Ga0307408_101601202 | 3300031548 | Bacteria | 618 |
| 278 | Ga0307405_10142144 | 3300031731 | Bacteria | 1675 |
| 279 | Ga0307405_11468755 | 3300031731 | Bacteria | 598 |
| 280 | Ga0307405_12142146 | 3300031731 | Bacteria | 502 |
| 281 | Ga0307413_10037133 | 3300031824 | Bacteria | 2811 |
| 282 | Ga0307413_10047867 | 3300031824 | Bacteria | 2552 |
| 283 | Ga0307413_10279926 | 3300031824 | Bacteria | 1254 |
| 284 | Ga0307413_10517385 | 3300031824 | Bacteria | 961 |
| 285 | Ga0307413_10778113 | 3300031824 | Bacteria | 802 |
| 286 | Ga0307413_10991576 | 3300031824 | Bacteria | 719 |
| 287 | Ga0307413_11006848 | 3300031824 | Bacteria | 714 |
| 288 | Ga0307410_10028499 | 3300031852 | Bacteria | 3543 |
| 289 | Ga0307410_10427645 | 3300031852 | Bacteria | 1075 |
| 290 | Ga0307406_10094886 | 3300031901 | Bacteria | 2017 |
| 291 | Ga0307406_10346198 | 3300031901 | Bacteria | 1159 |
| 292 | Ga0307406_10874309 | 3300031901 | Bacteria | 763 |
| 293 | Ga0307407_10034741 | 3300031903 | Bacteria | 2763 |
| 294 | Ga0307412_10042944 | 3300031911 | Bacteria | 2941 |
| 295 | Ga0307412_10311553 | 3300031911 | Bacteria | 1248 |
| 296 | Ga0307412_10346875 | 3300031911 | Bacteria | 1190 |
| 297 | Ga0307412_10401326 | 3300031911 | Bacteria | 1116 |
| 298 | Ga0307412_11190223 | 3300031911 | Bacteria | 682 |
| 299 | Ga0307412_11208676 | 3300031911 | Bacteria | 677 |
| 300 | Ga0307409_100024348 | 3300031995 | Bacteria | 4220 |
| 301 | Ga0307409_100767138 | 3300031995 | Bacteria | 969 |
| 302 | Ga0307409_101512416 | 3300031995 | Bacteria | 699 |
| 303 | Ga0307409_101575233 | 3300031995 | Bacteria | 685 |
| 304 | Ga0307416_100404694 | 3300032002 | Bacteria | 1403 |
| 305 | Ga0307416_101510611 | 3300032002 | Bacteria | 777 |
| 306 | Ga0307416_103563832 | 3300032002 | Bacteria | 521 |
| 307 | Ga0307414_10002120 | 3300032004 | Bacteria | 10346 |
| 308 | Ga0307414_10007179 | 3300032004 | Bacteria | 6251 |
| 309 | Ga0307414_10020644 | 3300032004 | Bacteria | 4110 |
| 310 | Ga0307414_10046872 | 3300032004 | Bacteria | 2970 |
| 311 | Ga0307414_10063463 | 3300032004 | Bacteria | 2625 |
| 312 | Ga0307414_10234802 | 3300032004 | Bacteria | 1514 |
| 313 | Ga0307414_10448284 | 3300032004 | Bacteria | 1131 |
| 314 | Ga0307414_10697965 | 3300032004 | Bacteria | 918 |
| 315 | Ga0307414_10785321 | 3300032004 | Bacteria | 867 |
| 316 | Ga0307414_11060873 | 3300032004 | Bacteria | 747 |
| 317 | Ga0307414_11297263 | 3300032004 | Bacteria | 675 |
| 318 | Ga0307411_10015295 | 3300032005 | Bacteria | 4303 |
| 319 | Ga0307411_10041490 | 3300032005 | Bacteria | 2928 |
| 320 | Ga0307411_10862437 | 3300032005 | Bacteria | 802 |
| 321 | Ga0307411_11078775 | 3300032005 | Bacteria | 723 |
| 322 | Ga0307411_11292060 | 3300032005 | Bacteria | 664 |
| 323 | Ga0307411_11554591 | 3300032005 | Bacteria | 609 |
| 324 | Ga0307415_100292343 | 3300032126 | Bacteria | 1345 |
| 325 | Ga0307415_100759180 | 3300032126 | Bacteria | 881 |
| 326 | Ga0373950_0094669 | 3300034818 | Bacteria | 637 |
| 327 | Ga0373943_0487907 | 3300035170 | Bacteria | 719 |
| 328 | Ga0373931_1024699 | 3300035691 | Bacteria | 559 |
| 329 | Ga0373935_1312547 | 3300035692 | Bacteria | 540 |
| 330 | Ga0373933_0611407 | 3300035724 | Bacteria | 716 |
| 331 | Ga0395899_0093693 | 3300037312 | Bacteria | 2174 |
| 332 | Ga0395900_0036642 | 3300037418 | Bacteria | 5057 |
| 333 | Ga0395900_0241648 | 3300037418 | Bacteria | 1811 |
| 334 | Ga0395898_0180698 | 3300037466 | Bacteria | 2016 |
| 335 | Ga0395905_0110752 | 3300037471 | Bacteria | 2578 |
| 336 | Ga0395905_0293167 | 3300037471 | Bacteria | 1514 |
| 337 | Ga0395905_0753127 | 3300037471 | Bacteria | 876 |
| 338 | Ga0395905_1623580 | 3300037471 | Bacteria | 551 |
| 339 | Ga0395901_0276971 | 3300038443 | Bacteria | 1744 |
| 340 | Ga0395901_1553089 | 3300038443 | Bacteria | 616 |
| 341 | Ga0237819_00026 | 3300038705 | Bacteria | 50539 |
| 342 | Ga0237819_05137 | 3300038705 | Bacteria | 2080 |
| 343 | Ga0237816_00020 | 3300039145 | Bacteria | 9419 |
| 344 | Ga0439436_0005214 | 3300041404 | Bacteria | 3978 |
| 345 | Ga0439436_0009292 | 3300041404 | Bacteria | 3013 |
| 346 | Ga0439436_0020558 | 3300041404 | Bacteria | 1966 |
| 347 | Ga0439436_0044395 | 3300041404 | Bacteria | 1266 |
| 348 | Ga0439436_0195246 | 3300041404 | Bacteria | 578 |
| 349 | Ga0439439_0004561 | 3300041406 | Bacteria | 3133 |
| 350 | Ga0439447_013961 | 3300041407 | Bacteria | 2264 |
| 351 | Ga0439466_0112396 | 3300041411 | Bacteria | 844 |
| 352 | Ga0439465_0005524 | 3300041413 | Bacteria | 4031 |
| 353 | Ga0439465_0009954 | 3300041413 | Bacteria | 2993 |
| 354 | Ga0439465_0045155 | 3300041413 | Bacteria | 1432 |
| 355 | Ga0439465_0054861 | 3300041413 | Bacteria | 1311 |
| 356 | Ga0439465_0169776 | 3300041413 | Bacteria | 785 |
| 357 | Ga0439465_0329805 | 3300041413 | Bacteria | 574 |
| 358 | Ga0451789_0611670 | 3300041443 | Bacteria | 914 |
| 359 | Ga0451791_0348064 | 3300041451 | Bacteria | 1287 |
| 360 | Ga0451793_0649292 | 3300041452 | Unclassified | 543 |
| 361 | Ga0451793_1022662 | 3300041452 | Bacteria | 1172 |
| 362 | Ga0451797_0495586 | 3300041453 | Bacteria | 628 |
| 363 | Ga0451797_0542817 | 3300041453 | Bacteria | 891 |
| 364 | Ga0451801_10668 | 3300041455 | Bacteria | 569 |
| 365 | Ga0451795_1206484 | 3300041456 | Bacteria | 985 |
| 366 | Ga0451798_0378261 | 3300041458 | Bacteria | 1024 |
| 367 | Ga0451800_0237753 | 3300041459 | Bacteria | 1137 |
| 368 | Ga0451802_0845033 | 3300041460 | Bacteria | 861 |
| 369 | Ga0451802_0845984 | 3300041460 | Bacteria | 673 |
| 370 | Ga0451802_0882002 | 3300041460 | Bacteria | 1116 |
| 371 | Ga0451802_1892135 | 3300041460 | Bacteria | 797 |
| 372 | Ga0451805_021755 | 3300041461 | Bacteria | 872 |
| 373 | Ga0451805_060263 | 3300041461 | Bacteria | 752 |
| 374 | Ga0451804_0354493 | 3300041463 | Bacteria | 624 |
| 375 | Ga0451835_0031836 | 3300041492 | Bacteria | 623 |
| 376 | Ga0451837_0144598 | 3300041494 | Bacteria | 667 |
| 377 | Ga0451837_0822369 | 3300041494 | Bacteria | 1529 |
| 378 | Ga0451839_0879567 | 3300041496 | Bacteria | 817 |
| 379 | Ga0451840_04882 | 3300041497 | Bacteria | 550 |
| 380 | Ga0451841_0137401 | 3300041498 | Bacteria | 1060 |
| 381 | Ga0451845_0710242 | 3300041501 | Bacteria | 782 |
| 382 | Ga0451843_0901379 | 3300041509 | Bacteria | 851 |
| 383 | Ga0451853_0501935 | 3300041512 | Bacteria | 653 |
| 384 | Ga0451853_2452886 | 3300041512 | Bacteria | 1202 |
| 385 | Ga0439431_0008628 | 3300041997 | Bacteria | 2294 |
| 386 | Ga0439431_0172541 | 3300041997 | Bacteria | 622 |
| 387 | Ga0439433_0016339 | 3300041999 | Bacteria | 1644 |
| 388 | Ga0439433_0043496 | 3300041999 | Bacteria | 1049 |
| 389 | Ga0439433_0051959 | 3300041999 | Bacteria | 968 |
| 390 | Ga0439433_0071138 | 3300041999 | Bacteria | 838 |
| 391 | Ga0439445_0022958 | 3300042004 | Bacteria | 1576 |
| 392 | Ga0439445_0109731 | 3300042004 | Bacteria | 787 |
| 393 | Ga0439448_0105629 | 3300042005 | Bacteria | 959 |
| 394 | Ga0439432_044052 | 3300042006 | Bacteria | 1406 |
| 395 | Ga0439432_088427 | 3300042006 | Bacteria | 934 |
| 396 | Ga0439432_145403 | 3300042006 | Bacteria | 696 |
| 397 | Ga0439449_0011871 | 3300042007 | Bacteria | 3274 |
| 398 | Ga0439449_0039601 | 3300042007 | Bacteria | 1752 |
| 399 | Ga0439449_0047245 | 3300042007 | Bacteria | 1594 |
| 400 | Ga0439449_0050566 | 3300042007 | Bacteria | 1537 |
| 401 | Ga0439449_0052843 | 3300042007 | Bacteria | 1502 |
| 402 | Ga0439449_0059877 | 3300042007 | Bacteria | 1405 |
| 403 | Ga0439449_0238816 | 3300042007 | Bacteria | 682 |
| 404 | Ga0439452_043990 | 3300042010 | Bacteria | 1043 |
| 405 | Ga0439452_125502 | 3300042010 | Bacteria | 545 |
| 406 | Ga0439455_0094324 | 3300042012 | Bacteria | 823 |
| 407 | Ga0439457_033336 | 3300042014 | Bacteria | 1143 |
| 408 | Ga0439457_165578 | 3300042014 | Bacteria | 536 |
| 409 | Ga0439462_0027568 | 3300042015 | Bacteria | 1499 |
| 410 | Ga0439462_0082925 | 3300042015 | Bacteria | 876 |
| 411 | Ga0450903_045815 | 3300042138 | Bacteria | 644 |
| 412 | Ga0439446_0036071 | 3300042156 | Bacteria | 1444 |
| 413 | Ga0439434_0363768 | 3300042435 | Bacteria | 506 |
| 414 | Ga0466960_0601199 | 3300044901 | Bacteria | 653 |
| 415 | Ga0466958_1166693 | 3300045836 | Bacteria | 503 |
| 416 | Ga0466967_2375292 | 3300045976 | Bacteria | 525 |
| 417 | Ga0495606_0035985 | 3300046507 | Bacteria | 3378 |
| 418 | Ga0495610_0236940 | 3300046512 | Bacteria | 729 |
| 419 | Ga0495610_0251536 | 3300046512 | Bacteria | 700 |
| 420 | Ga0495616_0270579 | 3300046513 | Bacteria | 724 |
| 421 | Ga0495631_0154725 | 3300046518 | Bacteria | 984 |
| 422 | Ga0495663_0004473 | 3300046525 | Bacteria | 3926 |
| 423 | Ga0495663_0051919 | 3300046525 | Bacteria | 1272 |
| 424 | Ga0495663_0063370 | 3300046525 | Bacteria | 1165 |
| 425 | Ga0495663_0135103 | 3300046525 | Bacteria | 834 |
| 426 | Ga0495663_0135107 | 3300046525 | Bacteria | 834 |
| 427 | Ga0495663_0330149 | 3300046525 | Bacteria | 553 |
| 428 | Ga0495598_0126189 | 3300046537 | Bacteria | 873 |
| 429 | Ga0495598_0158612 | 3300046537 | Bacteria | 794 |
| 430 | Ga0495598_0293813 | 3300046537 | Bacteria | 613 |
| 431 | Ga0495621_0001470 | 3300046539 | Bacteria | 6111 |
| 432 | Ga0495621_0084120 | 3300046539 | Bacteria | 1190 |
| 433 | Ga0495621_0225644 | 3300046539 | Bacteria | 759 |
| 434 | Ga0495621_0263312 | 3300046539 | Bacteria | 707 |
| 435 | Ga0495621_0294762 | 3300046539 | Bacteria | 671 |
| 436 | Ga0495633_0318237 | 3300046558 | Bacteria | 706 |
| 437 | Ga0495656_0004814 | 3300046615 | Bacteria | 4645 |
| 438 | Ga0495656_0140966 | 3300046615 | Bacteria | 1156 |
| 439 | Ga0495668_0033171 | 3300046616 | Bacteria | 2901 |
| 440 | Ga0495668_0078857 | 3300046616 | Bacteria | 1808 |
| 441 | Ga0495625_0591950 | 3300046660 | Bacteria | 667 |
| 442 | Ga0495659_0087343 | 3300046664 | Bacteria | 1192 |
| 443 | Ga0495659_0112299 | 3300046664 | Bacteria | 1065 |
| 444 | Ga0495659_0370808 | 3300046664 | Bacteria | 614 |
| 445 | Ga0495588_0423553 | 3300046674 | Bacteria | 699 |
| 446 | Ga0495670_0101413 | 3300046691 | Bacteria | 1482 |
| 447 | Ga0495670_0342267 | 3300046691 | Bacteria | 804 |
| 448 | Ga0495670_0495645 | 3300046691 | Bacteria | 663 |
| 449 | Ga0495671_0368709 | 3300046692 | Bacteria | 688 |
| 450 | Ga0495636_0052343 | 3300047318 | Bacteria | 1712 |
| 451 | Ga0495636_0121083 | 3300047318 | Bacteria | 1157 |
| 452 | Ga0495636_0258130 | 3300047318 | Bacteria | 807 |
| 453 | Ga0495636_0613476 | 3300047318 | Bacteria | 532 |
| 454 | Ga0495677_0145086 | 3300047445 | Bacteria | 912 |
| 455 | Ga0495685_061912 | 3300047447 | Bacteria | 1260 |
| 456 | Ga0495681_0124862 | 3300047470 | Bacteria | 1101 |
| 457 | Ga0496100_0389538 | 3300048903 | Bacteria | 1059 |
| 458 | Ga0496101_0223296 | 3300048904 | Bacteria | 1462 |
| 459 | Ga0496102_1169225 | 3300048905 | Bacteria | 689 |
| 460 | Ga0496108_0100619 | 3300048911 | Bacteria | 2465 |
| 461 | Ga0496108_0557978 | 3300048911 | Bacteria | 999 |
| 462 | Ga0496109_0062064 | 3300048912 | Bacteria | 3417 |
| 463 | Ga0496109_0387077 | 3300048912 | Bacteria | 1321 |
| 464 | Ga0496110_1123034 | 3300048913 | Bacteria | 694 |
| 465 | Ga0496112_0025726 | 3300048915 | Bacteria | 5652 |
| 466 | Ga0496113_0067298 | 3300048916 | Bacteria | 2715 |
| 467 | Ga0496115_0367309 | 3300048918 | Bacteria | 1172 |
| 468 | Ga0496121_0005001 | 3300048924 | Bacteria | 17352 |
| 469 | Ga0496122_0097842 | 3300048925 | Bacteria | 1973 |
| 470 | Ga0496123_0146817 | 3300048926 | Bacteria | 1279 |
| 471 | Ga0496124_0000018 | 3300048927 | Bacteria | 442940 |
| 472 | Ga0501306_005581 | 3300049127 | Bacteria | 1448 |
| 473 | Ga0501306_005642 | 3300049127 | Bacteria | 1444 |
| 474 | Ga0501306_017111 | 3300049127 | Bacteria | 980 |
| 475 | Ga0501306_026148 | 3300049127 | Bacteria | 844 |
| 476 | Ga0501306_056469 | 3300049127 | Bacteria | 640 |
| 477 | Ga0501306_086653 | 3300049127 | Bacteria | 546 |
| 478 | Ga0501308_000035 | 3300049128 | Bacteria | 5438 |
| 479 | Ga0501308_005875 | 3300049128 | Bacteria | 1240 |
| 480 | Ga0501308_011241 | 3300049128 | Bacteria | 1006 |
| 481 | Ga0501309_012417 | 3300049129 | Bacteria | 1122 |
| 482 | Ga0501309_041481 | 3300049129 | Bacteria | 704 |
| 483 | Ga0501309_047735 | 3300049129 | Bacteria | 667 |
| 484 | Ga0501310_000986 | 3300049130 | Bacteria | 2538 |
| 485 | Ga0501310_007734 | 3300049130 | Bacteria | 1153 |
| 486 | Ga0501310_010671 | 3300049130 | Bacteria | 1029 |
| 487 | Ga0501341_01557 | 3300049131 | Bacteria | 1159 |
| 488 | Ga0501345_03043 | 3300049134 | Bacteria | 712 |
| 489 | Ga0501304_000987 | 3300049160 | Bacteria | 1702 |
| 490 | Ga0501304_004356 | 3300049160 | Bacteria | 1073 |
| 491 | Ga0501305_001649 | 3300049161 | Bacteria | 2241 |
| 492 | Ga0501305_007764 | 3300049161 | Bacteria | 1371 |
| 493 | Ga0501305_024565 | 3300049161 | Bacteria | 909 |
| 494 | Ga0501305_025801 | 3300049161 | Bacteria | 893 |
| 495 | Ga0501305_051082 | 3300049161 | Bacteria | 694 |
| 496 | Ga0501307_000579 | 3300049162 | Bacteria | 2601 |
| 497 | Ga0501307_006548 | 3300049162 | Bacteria | 1262 |
| 498 | Ga0501307_028221 | 3300049162 | Bacteria | 766 |
| 499 | Ga0501307_028729 | 3300049162 | Bacteria | 762 |
| 500 | Ga0501307_030527 | 3300049162 | Bacteria | 745 |
| 501 | Ga0501307_035371 | 3300049162 | Bacteria | 709 |
| 502 | Ga0501342_04097 | 3300049163 | Bacteria | 530 |
| 503 | Ga0501291_106770 | 3300049514 | Bacteria | 591 |
| 504 | Ga0501298_092911 | 3300049521 | Bacteria | 678 |
| 505 | Ga0501311_003051 | 3300049527 | Bacteria | 1672 |
| 506 | Ga0501311_022011 | 3300049527 | Bacteria | 873 |
| 507 | Ga0501312_002244 | 3300049528 | Bacteria | 2061 |
| 508 | Ga0501312_002447 | 3300049528 | Bacteria | 2006 |
| 509 | Ga0501312_077752 | 3300049528 | Bacteria | 597 |
| 510 | Ga0501312_079207 | 3300049528 | Bacteria | 592 |
| 511 | Ga0501313_003322 | 3300049529 | Bacteria | 1592 |
| 512 | Ga0501313_040858 | 3300049529 | Bacteria | 623 |
| 513 | Ga0501314_007283 | 3300049530 | Bacteria | 979 |
| 514 | Ga0501314_014003 | 3300049530 | Bacteria | 782 |
| 515 | Ga0501315_000712 | 3300049531 | Bacteria | 2463 |
| 516 | Ga0501315_004415 | 3300049531 | Bacteria | 1470 |
| 517 | Ga0501315_040976 | 3300049531 | Bacteria | 701 |
| 518 | Ga0501315_086517 | 3300049531 | Bacteria | 538 |
| 519 | Ga0501316_004177 | 3300049532 | Bacteria | 1439 |
| 520 | Ga0501316_025268 | 3300049532 | Bacteria | 771 |
| 521 | Ga0501316_052158 | 3300049532 | Bacteria | 591 |
| 522 | Ga0501317_001762 | 3300049533 | Bacteria | 1934 |
| 523 | Ga0501317_006218 | 3300049533 | Bacteria | 1304 |
| 524 | Ga0501317_010657 | 3300049533 | Bacteria | 1103 |
| 525 | Ga0501317_056682 | 3300049533 | Bacteria | 635 |
| 526 | Ga0501318_000528 | 3300049534 | Bacteria | 2495 |
| 527 | Ga0501318_035161 | 3300049534 | Bacteria | 697 |
| 528 | Ga0501318_049310 | 3300049534 | Bacteria | 622 |
| 529 | Ga0501318_063123 | 3300049534 | Bacteria | 572 |
| 530 | Ga0501319_000070 | 3300049535 | Bacteria | 3471 |
| 531 | Ga0501319_008492 | 3300049535 | Bacteria | 792 |
| 532 | Ga0501320_003674 | 3300049536 | Bacteria | 1315 |
| 533 | Ga0501320_008783 | 3300049536 | Bacteria | 1001 |
| 534 | Ga0501321_005366 | 3300049537 | Bacteria | 1264 |
| 535 | Ga0501321_007845 | 3300049537 | Bacteria | 1118 |
| 536 | Ga0501321_013367 | 3300049537 | Bacteria | 942 |
| 537 | Ga0501321_038133 | 3300049537 | Bacteria | 667 |
| 538 | Ga0501322_004912 | 3300049538 | Bacteria | 913 |
| 539 | Ga0501323_000068 | 3300049539 | Bacteria | 5160 |
| 540 | Ga0501323_000101 | 3300049539 | Bacteria | 4591 |
| 541 | Ga0501323_033218 | 3300049539 | Bacteria | 732 |
| 542 | Ga0501323_050181 | 3300049539 | Bacteria | 631 |
| 543 | Ga0501323_056670 | 3300049539 | Bacteria | 605 |
| 544 | Ga0501324_000043 | 3300049540 | Bacteria | 4242 |
| 545 | Ga0501324_010732 | 3300049540 | Bacteria | 838 |
| 546 | Ga0501324_020298 | 3300049540 | Bacteria | 676 |
| 547 | Ga0501324_025706 | 3300049540 | Bacteria | 622 |
| 548 | Ga0501325_003096 | 3300049541 | Bacteria | 1189 |
| 549 | Ga0501325_008060 | 3300049541 | Bacteria | 906 |
| 550 | Ga0501329_02559 | 3300049545 | Bacteria | 878 |
| 551 | Ga0501330_003224 | 3300049546 | Bacteria | 963 |
| 552 | Ga0501331_10925 | 3300049547 | Bacteria | 570 |
| 553 | Ga0501332_05628 | 3300049548 | Bacteria | 772 |
| 554 | Ga0501333_006796 | 3300049549 | Bacteria | 766 |
| 555 | Ga0501334_08151 | 3300049550 | Bacteria | 731 |
| 556 | Ga0501336_003033 | 3300049552 | Bacteria | 1112 |
| 557 | Ga0501336_031496 | 3300049552 | Bacteria | 523 |
| 558 | Ga0501337_016844 | 3300049553 | Bacteria | 573 |
| 559 | Ga0501338_06754 | 3300049554 | Bacteria | 730 |
| 560 | Ga0501340_005822 | 3300049556 | Bacteria | 813 |
| 561 | Ga0501340_011706 | 3300049556 | Bacteria | 657 |
| 562 | Ga0501340_012965 | 3300049556 | Bacteria | 638 |
| 563 | Ga0501340_019503 | 3300049556 | Bacteria | 561 |
| 564 | Ga0501031_0025141 | 3300049568 | Bacteria | 3884 |
| 565 | Ga0501031_0101188 | 3300049568 | Bacteria | 1880 |
| 566 | Ga0501031_0301992 | 3300049568 | Bacteria | 1037 |
| 567 | Ga0501032_0217693 | 3300049569 | Bacteria | 1243 |
| 568 | Ga0501032_0675160 | 3300049569 | Bacteria | 655 |
| 569 | Ga0501033_0123272 | 3300049570 | Bacteria | 1879 |
| 570 | Ga0501033_0301675 | 3300049570 | Bacteria | 1127 |
| 571 | Ga0501034_0021966 | 3300049571 | Bacteria | 6502 |
| 572 | Ga0501034_0120372 | 3300049571 | Bacteria | 2611 |
| 573 | Ga0501034_0376789 | 3300049571 | Bacteria | 1344 |
| 574 | Ga0501034_0395735 | 3300049571 | Bacteria | 1305 |
| 575 | Ga0501034_0819040 | 3300049571 | Bacteria | 823 |
| 576 | Ga0501034_0880349 | 3300049571 | Bacteria | 784 |
| 577 | Ga0501036_0066357 | 3300049572 | Bacteria | 3053 |
| 578 | Ga0501036_0660103 | 3300049572 | Bacteria | 865 |
| 579 | Ga0501037_0021232 | 3300049573 | Bacteria | 4797 |
| 580 | Ga0501037_0340564 | 3300049573 | Bacteria | 1036 |
| 581 | Ga0501037_0493195 | 3300049573 | Bacteria | 831 |
| 582 | Ga0501038_0002396 | 3300049574 | Bacteria | 17463 |
| 583 | Ga0501038_0026720 | 3300049574 | Bacteria | 5139 |
| 584 | Ga0501039_0013271 | 3300049575 | Bacteria | 6300 |
| 585 | Ga0501039_0366055 | 3300049575 | Bacteria | 1132 |
| 586 | Ga0501043_0030616 | 3300049579 | Bacteria | 4230 |
| 587 | Ga0501043_0326832 | 3300049579 | Bacteria | 1168 |
| 588 | Ga0501043_0571857 | 3300049579 | Bacteria | 837 |
| 589 | Ga0501046_0534208 | 3300049580 | Bacteria | 837 |
| 590 | Ga0501046_0786563 | 3300049580 | Bacteria | 667 |
| 591 | Ga0501047_0059275 | 3300049581 | Bacteria | 3696 |
| 592 | Ga0501047_0221275 | 3300049581 | Bacteria | 1749 |
| 593 | Ga0501048_0538607 | 3300049582 | Bacteria | 838 |
| 594 | Ga0501048_0581196 | 3300049582 | Bacteria | 804 |
| 595 | Ga0501068_0639040 | 3300049584 | Bacteria | 694 |
| 596 | Ga0501070_0016046 | 3300049586 | Bacteria | 6294 |
| 597 | Ga0501070_0198353 | 3300049586 | Bacteria | 1648 |
| 598 | Ga0501071_0037161 | 3300049587 | Bacteria | 3476 |
| 599 | Ga0501073_0068309 | 3300049589 | Bacteria | 2477 |
| 600 | Ga0501198_053502 | 3300049649 | Bacteria | 724 |
| 601 | Ga0501202_018155 | 3300049652 | Bacteria | 1379 |
| 602 | Ga0501202_037238 | 3300049652 | Bacteria | 1038 |
| 603 | Ga0501206_040475 | 3300049653 | Bacteria | 717 |
| 604 | Ga0501209_138327 | 3300049656 | Bacteria | 729 |
| 605 | Ga0501211_031447 | 3300049658 | Bacteria | 600 |
| 606 | Ga0501216_023017 | 3300049660 | Bacteria | 1105 |
| 607 | Ga0501216_093466 | 3300049660 | Bacteria | 653 |
| 608 | Ga0501217_048551 | 3300049661 | Bacteria | 1102 |
| 609 | Ga0501222_041128 | 3300049662 | Bacteria | 657 |
| 610 | Ga0501223_032298 | 3300049663 | Bacteria | 1018 |
| 611 | Ga0501223_046989 | 3300049663 | Bacteria | 837 |
| 612 | Ga0501224_021838 | 3300049664 | Bacteria | 954 |
| 613 | Ga0501227_172799 | 3300049665 | Bacteria | 605 |
| 614 | Ga0501235_189123 | 3300049669 | Bacteria | 552 |
| 615 | Ga0501238_077425 | 3300049671 | Bacteria | 521 |
| 616 | Ga0501239_002487 | 3300049672 | Bacteria | 1676 |
| 617 | Ga0501239_018174 | 3300049672 | Bacteria | 843 |
| 618 | Ga0501240_014783 | 3300049673 | Bacteria | 1101 |
| 619 | Ga0501242_009218 | 3300049674 | Bacteria | 1165 |
| 620 | Ga0501242_033541 | 3300049674 | Bacteria | 703 |
| 621 | Ga0501249_021629 | 3300049679 | Bacteria | 1404 |
| 622 | Ga0501250_043409 | 3300049680 | Bacteria | 667 |
| 623 | Ga0501250_046574 | 3300049680 | Bacteria | 653 |
| 624 | Ga0501251_029671 | 3300049681 | Bacteria | 773 |
| 625 | Ga0501252_000295 | 3300049682 | Bacteria | 3545 |
| 626 | Ga0501252_008250 | 3300049682 | Bacteria | 1194 |
| 627 | Ga0501253_058558 | 3300049683 | Bacteria | 824 |
| 628 | Ga0501253_075856 | 3300049683 | Bacteria | 750 |
| 629 | Ga0501257_049116 | 3300049686 | Bacteria | 1049 |
| 630 | Ga0501259_015715 | 3300049688 | Bacteria | 1295 |
| 631 | Ga0501259_119797 | 3300049688 | Bacteria | 624 |
| 632 | Ga0501221_070592 | 3300049704 | Bacteria | 824 |
| 633 | Ga0501225_0045508 | 3300049705 | Bacteria | 1215 |
| 634 | Ga0501225_0065537 | 3300049705 | Bacteria | 1026 |
| 635 | Ga0501225_0091312 | 3300049705 | Bacteria | 882 |
| 636 | Ga0501079_0672563 | 3300049741 | Bacteria | 815 |
| 637 | Ga0501080_0018310 | 3300049742 | Bacteria | 6482 |
| 638 | Ga0501232_028687 | 3300049757 | Bacteria | 761 |
| 639 | Ga0501241_033359 | 3300049758 | Bacteria | 978 |
| 640 | Ga0501263_004493 | 3300049760 | Bacteria | 1541 |
| 641 | Ga0501263_022755 | 3300049760 | Bacteria | 851 |
| 642 | Ga0501265_051682 | 3300049762 | Bacteria | 648 |
| 643 | Ga0501266_006012 | 3300049763 | Bacteria | 1507 |
| 644 | Ga0501266_012196 | 3300049763 | Bacteria | 1106 |
| 645 | Ga0501268_015441 | 3300049765 | Bacteria | 1255 |
| 646 | Ga0501268_026172 | 3300049765 | Bacteria | 1029 |
| 647 | Ga0501269_009447 | 3300049766 | Bacteria | 1183 |
| 648 | Ga0501270_002142 | 3300049767 | Bacteria | 1992 |
| 649 | Ga0501270_105993 | 3300049767 | Bacteria | 593 |
| 650 | Ga0501272_044853 | 3300049769 | Bacteria | 600 |
| 651 | Ga0501274_014849 | 3300049771 | Bacteria | 759 |
| 652 | Ga0501275_005782 | 3300049772 | Bacteria | 1197 |
| 653 | Ga0501279_047734 | 3300049775 | Bacteria | 672 |
| 654 | Ga0501282_022380 | 3300049778 | Bacteria | 698 |
| 655 | Ga0501283_105997 | 3300049779 | Bacteria | 551 |
| 656 | Ga0501035_0003746 | 3300049822 | Bacteria | 14504 |
| 657 | Ga0501035_0039431 | 3300049822 | Bacteria | 4274 |
| 658 | Ga0501044_0003730 | 3300049823 | Bacteria | 17110 |
| 659 | Ga0501044_0154075 | 3300049823 | Bacteria | 2278 |
| 660 | Ga0501045_0352529 | 3300049824 | Bacteria | 1095 |
| 661 | Ga0501204_065782 | 3300049850 | Bacteria | 587 |
| 662 | nmdc:mga03n38_414165_c1 | 3300050490 | Bacteria | 744 |
| 663 | nmdc:mga03n38_880097_c1 | 3300050490 | Bacteria | 525 |
| 664 | Ga0500577_0396206 | 3300053142 | Bacteria | 604 |
| 665 | Ga0500622_0431422 | 3300053156 | Bacteria | 528 |
| 666 | Ga0587088_127429 | 3300059508 | Bacteria | 595 |
| 667 | Ga0587090_008934 | 3300059510 | Bacteria | 1356 |
| 668 | Ga0587062_036448 | 3300059639 | Bacteria | 779 |
| 669 | Ga0587069_027263 | 3300059642 | Bacteria | 900 |
| 670 | Ga0587079_118289 | 3300059647 | Bacteria | 652 |
| 671 | Ga0587071_055827 | 3300060344 | Bacteria | 828 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005459 | Ga0068867_100365570 | Ga0068867_1003655702 | 92 |
| 2 | 3300005355 | Ga0070671_100012931 | Ga0070671_10001293111 | 94 |
| 3 | 3300025931 | Ga0207644_10011422 | Ga0207644_100114225 | 94 |
| 4 | 3300030745 | Ga0316182_1187071 | Ga0316182_11870712 | 94 |
| 5 | 3300037418 | Ga0395900_0241648 | Ga0395900_0241648_849_1145 | 94 |
| 6 | 3300037471 | Ga0395905_0753127 | Ga0395905_0753127_114_410 | 94 |
| 7 | 3300038443 | Ga0395901_1553089 | Ga0395901_1553089_293_589 | 94 |
| 8 | 3300044901 | Ga0466960_0601199 | Ga0466960_0601199_322_618 | 94 |
| 9 | 3300045976 | Ga0466967_2375292 | Ga0466967_2375292_136_435 | 94 |
| 10 | 3300048903 | Ga0496100_0389538 | Ga0496100_0389538_756_1043 | 94 |
| 11 | 3300048911 | Ga0496108_0100619 | Ga0496108_0100619_1889_2185 | 94 |
| 12 | 3300048912 | Ga0496109_0062064 | Ga0496109_0062064_1388_1684 | 94 |
| 13 | 3300048915 | Ga0496112_0025726 | Ga0496112_0025726_3205_3501 | 94 |
| 14 | 3300048916 | Ga0496113_0067298 | Ga0496113_0067298_2152_2448 | 94 |
| 15 | 3300049680 | Ga0501250_046574 | Ga0501250_046574_296_586 | 94 |
| 16 | 3300027617 | Ga0210002_1002375 | Ga0210002_10023756 | 95 |
| 17 | 3300042006 | Ga0439432_088427 | Ga0439432_088427_385_675 | 95 |
| 18 | 3300050490 | nmdc:mga03n38_880097_c1 | nmdc:mga03n38_880097_c1_190_480 | 95 |
| 19 | iso_pu_bacteria | 2547132130 | 2547502384 | 95 |
| 20 | iso_pu_bacteria | 2643221579 | 2643906203 | 95 |
| 21 | iso_pu_bacteria | 2643221581 | 2643915223 | 95 |
| 22 | iso_pu_bacteria | 2747842428 | 2747950329 | 95 |
| 23 | iso_pu_bacteria | 2747842501 | 2748018121 | 95 |
| 24 | iso_pu_bacteria | 2765235840 | 2765577784 | 95 |
| 25 | iso_pu_bacteria | 2816332141 | 2816515847 | 95 |
| 26 | iso_pu_bacteria | 2842391507 | 2842394171 | 95 |
| 27 | iso_pu_bacteria | 2874220319 | 2874220389 | 95 |
| 28 | iso_pu_bacteria | 2919089067 | 2919091659 | 95 |
| 29 | iso_pu_bacteria | 2919134579 | 2919134934 | 95 |
| 30 | iso_pu_bacteria | 2923516293 | 2923519227 | 95 |
| 31 | iso_pu_bacteria | 2928496128 | 2928498479 | 95 |
| 32 | iso_pu_bacteria | 2931380184 | 2931381954 | 95 |
| 33 | iso_pu_bacteria | 2937610967 | 2937611280 | 95 |
| 34 | iso_pu_bacteria | 2939626828 | 2939631015 | 95 |
| 35 | iso_pu_bacteria | 2961047084 | 2961047154 | 95 |
| 36 | iso_pu_bacteria | 2961064222 | 2961068524 | 95 |
| 37 | iso_pu_bacteria | 2987605356 | 2987605649 | 95 |
| 38 | iso_pu_bacteria | 8002869464 | 8002871446 | 95 |
| 39 | 3300005617 | Ga0068859_100714138 | Ga0068859_1007141382 | 96 |
| 40 | 3300005843 | Ga0068860_101372426 | Ga0068860_1013724262 | 96 |
| 41 | 3300006931 | Ga0097620_100714087 | Ga0097620_1007140872 | 96 |
| 42 | 3300009177 | Ga0105248_10864655 | Ga0105248_108646552 | 96 |
| 43 | 3300009978 | Ga0105148_105283 | Ga0105148_1052832 | 96 |
| 44 | 3300013306 | Ga0163162_11097464 | Ga0163162_110974642 | 96 |
| 45 | 3300025931 | Ga0207644_11351237 | Ga0207644_113512371 | 96 |
| 46 | 3300025941 | Ga0207711_10147290 | Ga0207711_101472905 | 96 |
| 47 | 3300025960 | Ga0207651_10648699 | Ga0207651_106486991 | 96 |
| 48 | 3300028381 | Ga0268264_10786813 | Ga0268264_107868132 | 96 |
| 49 | 3300031995 | Ga0307409_101512416 | Ga0307409_1015124162 | 96 |
| 50 | iso_pu_bacteria | 2842780639 | 2842781648 | 96 |
| 51 | 3300005334 | Ga0068869_100115364 | Ga0068869_1001153642 | 97 |
| 52 | 3300005434 | Ga0070709_10133238 | Ga0070709_101332382 | 97 |
| 53 | 3300005436 | Ga0070713_100983439 | Ga0070713_1009834392 | 97 |
| 54 | 3300005439 | Ga0070711_101313524 | Ga0070711_1013135242 | 97 |
| 55 | 3300005441 | Ga0070700_101566992 | Ga0070700_1015669922 | 97 |
| 56 | 3300005543 | Ga0070672_100212901 | Ga0070672_1002129012 | 97 |
| 57 | 3300005616 | Ga0068852_100147811 | Ga0068852_1001478115 | 97 |
| 58 | 3300005840 | Ga0068870_10201962 | Ga0068870_102019622 | 97 |
| 59 | 3300006237 | Ga0097621_100195694 | Ga0097621_1001956943 | 97 |
| 60 | 3300006846 | Ga0075430_101363114 | Ga0075430_1013631142 | 97 |
| 61 | 3300009036 | Ga0105244_10438164 | Ga0105244_104381642 | 97 |
| 62 | 3300009093 | Ga0105240_10265037 | Ga0105240_102650372 | 97 |
| 63 | 3300009545 | Ga0105237_10517711 | Ga0105237_105177112 | 97 |
| 64 | 3300009979 | Ga0105032_100517 | Ga0105032_1005172 | 97 |
| 65 | 3300013104 | Ga0157370_11219759 | Ga0157370_112197592 | 97 |
| 66 | 3300013296 | Ga0157374_12286767 | Ga0157374_122867671 | 97 |
| 67 | 3300013297 | Ga0157378_12618515 | Ga0157378_126185152 | 97 |
| 68 | 3300014497 | Ga0182008_10379025 | Ga0182008_103790252 | 97 |
| 69 | 3300014969 | Ga0157376_10315852 | Ga0157376_103158522 | 97 |
| 70 | 3300025917 | Ga0207660_11681271 | Ga0207660_116812712 | 97 |
| 71 | 3300025924 | Ga0207694_11706001 | Ga0207694_117060012 | 97 |
| 72 | 3300025925 | Ga0207650_11050256 | Ga0207650_110502562 | 97 |
| 73 | 3300025940 | Ga0207691_10076483 | Ga0207691_100764834 | 97 |
| 74 | 3300026121 | Ga0207683_10335929 | Ga0207683_103359292 | 97 |
| 75 | 3300030744 | Ga0316181_1110680 | Ga0316181_11106801 | 97 |
| 76 | 3300031731 | Ga0307405_10142144 | Ga0307405_101421442 | 97 |
| 77 | 3300031824 | Ga0307413_10047867 | Ga0307413_100478672 | 97 |
| 78 | 3300031852 | Ga0307410_10028499 | Ga0307410_100284993 | 97 |
| 79 | 3300031901 | Ga0307406_10874309 | Ga0307406_108743092 | 97 |
| 80 | 3300031911 | Ga0307412_10346875 | Ga0307412_103468752 | 97 |
| 81 | 3300031995 | Ga0307409_100024348 | Ga0307409_1000243485 | 97 |
| 82 | 3300032002 | Ga0307416_100404694 | Ga0307416_1004046942 | 97 |
| 83 | 3300032004 | Ga0307414_10785321 | Ga0307414_107853212 | 97 |
| 84 | 3300032005 | Ga0307411_10015295 | Ga0307411_100152959 | 97 |
| 85 | 3300032126 | Ga0307415_100759180 | Ga0307415_1007591802 | 97 |
| 86 | 3300041452 | Ga0451793_0649292 | Ga0451793_0649292_87_386 | 97 |
| 87 | 3300041496 | Ga0451839_0879567 | Ga0451839_0879567_396_695 | 97 |
| 88 | 3300041512 | Ga0451853_0501935 | Ga0451853_0501935_124_417 | 97 |
| 89 | 3300046525 | Ga0495663_0330149 | Ga0495663_0330149_162_467 | 97 |
| 90 | 3300046537 | Ga0495598_0126189 | Ga0495598_0126189_255_551 | 97 |
| 91 | 3300046539 | Ga0495621_0263312 | Ga0495621_0263312_366_671 | 97 |
| 92 | 3300046616 | Ga0495668_0078857 | Ga0495668_0078857_1040_1345 | 97 |
| 93 | 3300047318 | Ga0495636_0258130 | Ga0495636_0258130_163_468 | 97 |
| 94 | 3300047445 | Ga0495677_0145086 | Ga0495677_0145086_473_778 | 97 |
| 95 | 3300049127 | Ga0501306_005581 | Ga0501306_005581_780_1079 | 97 |
| 96 | 3300049128 | Ga0501308_011241 | Ga0501308_011241_537_836 | 97 |
| 97 | 3300049129 | Ga0501309_012417 | Ga0501309_012417_558_857 | 97 |
| 98 | 3300049129 | Ga0501309_041481 | Ga0501309_041481_145_444 | 97 |
| 99 | 3300049130 | Ga0501310_010671 | Ga0501310_010671_296_595 | 97 |
| 100 | 3300049160 | Ga0501304_000987 | Ga0501304_000987_1002_1301 | 97 |
| 101 | 3300049161 | Ga0501305_007764 | Ga0501305_007764_697_996 | 97 |
| 102 | 3300049162 | Ga0501307_006548 | Ga0501307_006548_734_1033 | 97 |
| 103 | 3300049521 | Ga0501298_092911 | Ga0501298_092911_135_434 | 97 |
| 104 | 3300049527 | Ga0501311_022011 | Ga0501311_022011_99_398 | 97 |
| 105 | 3300049528 | Ga0501312_002447 | Ga0501312_002447_714_1013 | 97 |
| 106 | 3300049529 | Ga0501313_040858 | Ga0501313_040858_203_502 | 97 |
| 107 | 3300049531 | Ga0501315_000712 | Ga0501315_000712_1974_2273 | 97 |
| 108 | 3300049532 | Ga0501316_025268 | Ga0501316_025268_280_579 | 97 |
| 109 | 3300049533 | Ga0501317_001762 | Ga0501317_001762_942_1241 | 97 |
| 110 | 3300049533 | Ga0501317_056682 | Ga0501317_056682_221_526 | 97 |
| 111 | 3300049534 | Ga0501318_049310 | Ga0501318_049310_192_491 | 97 |
| 112 | 3300049536 | Ga0501320_003674 | Ga0501320_003674_388_687 | 97 |
| 113 | 3300049537 | Ga0501321_007845 | Ga0501321_007845_691_990 | 97 |
| 114 | 3300049539 | Ga0501323_000068 | Ga0501323_000068_3891_4190 | 97 |
| 115 | 3300049539 | Ga0501323_033218 | Ga0501323_033218_178_471 | 97 |
| 116 | 3300049540 | Ga0501324_010732 | Ga0501324_010732_208_507 | 97 |
| 117 | 3300049541 | Ga0501325_008060 | Ga0501325_008060_212_511 | 97 |
| 118 | 3300049552 | Ga0501336_031496 | Ga0501336_031496_120_419 | 97 |
| 119 | 3300049556 | Ga0501340_011706 | Ga0501340_011706_220_519 | 97 |
| 120 | 3300049568 | Ga0501031_0301992 | Ga0501031_0301992_430_729 | 97 |
| 121 | 3300049570 | Ga0501033_0301675 | Ga0501033_0301675_469_768 | 97 |
| 122 | 3300049571 | Ga0501034_0021966 | Ga0501034_0021966_2128_2424 | 97 |
| 123 | 3300049571 | Ga0501034_0880349 | Ga0501034_0880349_249_548 | 97 |
| 124 | 3300049573 | Ga0501037_0340564 | Ga0501037_0340564_287_586 | 97 |
| 125 | 3300049652 | Ga0501202_018155 | Ga0501202_018155_502_801 | 97 |
| 126 | 3300049656 | Ga0501209_138327 | Ga0501209_138327_317_616 | 97 |
| 127 | 3300049660 | Ga0501216_093466 | Ga0501216_093466_233_532 | 97 |
| 128 | 3300049663 | Ga0501223_046989 | Ga0501223_046989_84_383 | 97 |
| 129 | 3300049664 | Ga0501224_021838 | Ga0501224_021838_453_752 | 97 |
| 130 | 3300049672 | Ga0501239_018174 | Ga0501239_018174_224_523 | 97 |
| 131 | 3300049674 | Ga0501242_033541 | Ga0501242_033541_378_677 | 97 |
| 132 | 3300049682 | Ga0501252_000295 | Ga0501252_000295_3179_3478 | 97 |
| 133 | 3300049683 | Ga0501253_075856 | Ga0501253_075856_165_464 | 97 |
| 134 | 3300049688 | Ga0501259_015715 | Ga0501259_015715_606_905 | 97 |
| 135 | 3300049704 | Ga0501221_070592 | Ga0501221_070592_189_488 | 97 |
| 136 | 3300049705 | Ga0501225_0091312 | Ga0501225_0091312_313_612 | 97 |
| 137 | 3300049760 | Ga0501263_022755 | Ga0501263_022755_424_723 | 97 |
| 138 | 3300049762 | Ga0501265_051682 | Ga0501265_051682_238_537 | 97 |
| 139 | 3300049763 | Ga0501266_006012 | Ga0501266_006012_251_550 | 97 |
| 140 | 3300049765 | Ga0501268_026172 | Ga0501268_026172_241_540 | 97 |
| 141 | 3300049767 | Ga0501270_002142 | Ga0501270_002142_1198_1497 | 97 |
| 142 | 3300049769 | Ga0501272_044853 | Ga0501272_044853_151_450 | 97 |
| 143 | 3300049775 | Ga0501279_047734 | Ga0501279_047734_311_610 | 97 |
| 144 | 3300003187 | JGI25151J46595_10007643 | JGI25151J46595_100076436 | 98 |
| 145 | 3300003187 | JGI25151J46595_10013580 | JGI25151J46595_100135802 | 98 |
| 146 | 3300003215 | JGI25153J46596_10122190 | JGI25153J46596_101221901 | 98 |
| 147 | 3300003771 | Ga0055526_1008987 | Ga0055526_10089874 | 98 |
| 148 | 3300003773 | Ga0055537_1001096 | Ga0055537_10010964 | 98 |
| 149 | 3300003775 | Ga0055524_1013602 | Ga0055524_10136024 | 98 |
| 150 | 3300003775 | Ga0055524_1015666 | Ga0055524_10156662 | 98 |
| 151 | 3300003781 | Ga0055536_1040186 | Ga0055536_10401862 | 98 |
| 152 | 3300003784 | Ga0055534_1003331 | Ga0055534_10033316 | 98 |
| 153 | 3300003784 | Ga0055534_1006907 | Ga0055534_10069072 | 98 |
| 154 | 3300003790 | Ga0055528_1013611 | Ga0055528_10136112 | 98 |
| 155 | 3300003790 | Ga0055528_1016393 | Ga0055528_10163934 | 98 |
| 156 | 3300003791 | Ga0055530_10004966 | Ga0055530_100049666 | 98 |
| 157 | 3300003792 | Ga0055540_1029568 | Ga0055540_10295682 | 98 |
| 158 | 3300004798 | Ga0058859_11549133 | Ga0058859_115491331 | 98 |
| 159 | 3300004800 | Ga0058861_11921333 | Ga0058861_119213332 | 98 |
| 160 | 3300004801 | Ga0058860_11990960 | Ga0058860_119909602 | 98 |
| 161 | 3300005288 | Ga0065714_10109302 | Ga0065714_101093022 | 98 |
| 162 | 3300005288 | Ga0065714_10289934 | Ga0065714_102899342 | 98 |
| 163 | 3300005293 | Ga0065715_10047422 | Ga0065715_100474221 | 98 |
| 164 | 3300005293 | Ga0065715_10471293 | Ga0065715_104712932 | 98 |
| 165 | 3300005293 | Ga0065715_10670981 | Ga0065715_106709812 | 98 |
| 166 | 3300005328 | Ga0070676_10167770 | Ga0070676_101677702 | 98 |
| 167 | 3300005329 | Ga0070683_100194209 | Ga0070683_1001942091 | 98 |
| 168 | 3300005331 | Ga0070670_100143059 | Ga0070670_1001430593 | 98 |
| 169 | 3300005333 | Ga0070677_10499576 | Ga0070677_104995761 | 98 |
| 170 | 3300005335 | Ga0070666_11107642 | Ga0070666_111076422 | 98 |
| 171 | 3300005336 | Ga0070680_100255720 | Ga0070680_1002557202 | 98 |
| 172 | 3300005339 | Ga0070660_100058257 | Ga0070660_1000582573 | 98 |
| 173 | 3300005345 | Ga0070692_10305522 | Ga0070692_103055222 | 98 |
| 174 | 3300005347 | Ga0070668_100580531 | Ga0070668_1005805312 | 98 |
| 175 | 3300005354 | Ga0070675_100105895 | Ga0070675_1001058953 | 98 |
| 176 | 3300005354 | Ga0070675_100213624 | Ga0070675_1002136243 | 98 |
| 177 | 3300005355 | Ga0070671_100202548 | Ga0070671_1002025482 | 98 |
| 178 | 3300005356 | Ga0070674_100103259 | Ga0070674_1001032594 | 98 |
| 179 | 3300005364 | Ga0070673_100209228 | Ga0070673_1002092283 | 98 |
| 180 | 3300005366 | Ga0070659_100231145 | Ga0070659_1002311452 | 98 |
| 181 | 3300005367 | Ga0070667_101042766 | Ga0070667_1010427661 | 98 |
| 182 | 3300005367 | Ga0070667_101847423 | Ga0070667_1018474232 | 98 |
| 183 | 3300005441 | Ga0070700_101868106 | Ga0070700_1018681061 | 98 |
| 184 | 3300005455 | Ga0070663_100793081 | Ga0070663_1007930812 | 98 |
| 185 | 3300005455 | Ga0070663_101141416 | Ga0070663_1011414162 | 98 |
| 186 | 3300005457 | Ga0070662_100282610 | Ga0070662_1002826102 | 98 |
| 187 | 3300005458 | Ga0070681_10205910 | Ga0070681_102059103 | 98 |
| 188 | 3300005459 | Ga0068867_101380374 | Ga0068867_1013803742 | 98 |
| 189 | 3300005530 | Ga0070679_100385818 | Ga0070679_1003858182 | 98 |
| 190 | 3300005530 | Ga0070679_100661303 | Ga0070679_1006613032 | 98 |
| 191 | 3300005535 | Ga0070684_100843519 | Ga0070684_1008435192 | 98 |
| 192 | 3300005539 | Ga0068853_102313218 | Ga0068853_1023132182 | 98 |
| 193 | 3300005543 | Ga0070672_100087779 | Ga0070672_1000877792 | 98 |
| 194 | 3300005564 | Ga0070664_100483677 | Ga0070664_1004836772 | 98 |
| 195 | 3300005577 | Ga0068857_100976059 | Ga0068857_1009760592 | 98 |
| 196 | 3300005614 | Ga0068856_100267129 | Ga0068856_1002671292 | 98 |
| 197 | 3300005616 | Ga0068852_100675721 | Ga0068852_1006757212 | 98 |
| 198 | 3300005718 | Ga0068866_10285085 | Ga0068866_102850852 | 98 |
| 199 | 3300005719 | Ga0068861_101093583 | Ga0068861_1010935832 | 98 |
| 200 | 3300005719 | Ga0068861_101325492 | Ga0068861_1013254922 | 98 |
| 201 | 3300005840 | Ga0068870_11106647 | Ga0068870_111066472 | 98 |
| 202 | 3300005844 | Ga0068862_100564998 | Ga0068862_1005649982 | 98 |
| 203 | 3300006048 | Ga0075363_100484729 | Ga0075363_1004847292 | 98 |
| 204 | 3300009147 | Ga0114129_11321426 | Ga0114129_113214262 | 98 |
| 205 | 3300009177 | Ga0105248_11070887 | Ga0105248_110708872 | 98 |
| 206 | 3300009177 | Ga0105248_12850805 | Ga0105248_128508052 | 98 |
| 207 | 3300009551 | Ga0105238_11245780 | Ga0105238_112457801 | 98 |
| 208 | 3300009993 | Ga0105028_105506 | Ga0105028_1055062 | 98 |
| 209 | 3300010375 | Ga0105239_10078930 | Ga0105239_100789306 | 98 |
| 210 | 3300011119 | Ga0105246_12229086 | Ga0105246_122290862 | 98 |
| 211 | 3300012478 | Ga0157328_1029174 | Ga0157328_10291741 | 98 |
| 212 | 3300012482 | Ga0157318_1005289 | Ga0157318_10052892 | 98 |
| 213 | 3300012488 | Ga0157343_1000309 | Ga0157343_10003091 | 98 |
| 214 | 3300012490 | Ga0157322_1011551 | Ga0157322_10115512 | 98 |
| 215 | 3300012495 | Ga0157323_1018551 | Ga0157323_10185512 | 98 |
| 216 | 3300012500 | Ga0157314_1020158 | Ga0157314_10201582 | 98 |
| 217 | 3300012507 | Ga0157342_1054705 | Ga0157342_10547052 | 98 |
| 218 | 3300012512 | Ga0157327_1024845 | Ga0157327_10248452 | 98 |
| 219 | 3300013100 | Ga0157373_10142986 | Ga0157373_101429863 | 98 |
| 220 | 3300013102 | Ga0157371_10083622 | Ga0157371_100836223 | 98 |
| 221 | 3300013102 | Ga0157371_10440463 | Ga0157371_104404632 | 98 |
| 222 | 3300013104 | Ga0157370_10464246 | Ga0157370_104642462 | 98 |
| 223 | 3300013105 | Ga0157369_10312189 | Ga0157369_103121893 | 98 |
| 224 | 3300013296 | Ga0157374_10365321 | Ga0157374_103653211 | 98 |
| 225 | 3300013296 | Ga0157374_11148881 | Ga0157374_111488812 | 98 |
| 226 | 3300013306 | Ga0163162_10694593 | Ga0163162_106945932 | 98 |
| 227 | 3300013306 | Ga0163162_10726495 | Ga0163162_107264952 | 98 |
| 228 | 3300013307 | Ga0157372_11124837 | Ga0157372_111248371 | 98 |
| 229 | 3300013308 | Ga0157375_10045770 | Ga0157375_100457705 | 98 |
| 230 | 3300013308 | Ga0157375_10377773 | Ga0157375_103777733 | 98 |
| 231 | 3300013308 | Ga0157375_10609150 | Ga0157375_106091502 | 98 |
| 232 | 3300014325 | Ga0163163_11264080 | Ga0163163_112640802 | 98 |
| 233 | 3300014497 | Ga0182008_10183346 | Ga0182008_101833462 | 98 |
| 234 | 3300014745 | Ga0157377_10561482 | Ga0157377_105614822 | 98 |
| 235 | 3300017792 | Ga0163161_10348494 | Ga0163161_103484943 | 98 |
| 236 | 3300025245 | Ga0207425_1005550 | Ga0207425_10055505 | 98 |
| 237 | 3300025245 | Ga0207425_1048016 | Ga0207425_10480161 | 98 |
| 238 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000011147 | 98 |
| 239 | 3300025263 | Ga0209565_1055030 | Ga0209565_10550302 | 98 |
| 240 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000011147 | 98 |
| 241 | 3300025273 | Ga0209673_1002116 | Ga0209673_100211623 | 98 |
| 242 | 3300025284 | Ga0209130_1007816 | Ga0209130_10078165 | 98 |
| 243 | 3300025291 | Ga0209675_1000001 | Ga0209675_10000011386 | 98 |
| 244 | 3300025291 | Ga0209675_1006904 | Ga0209675_10069045 | 98 |
| 245 | 3300025292 | Ga0209676_1001608 | Ga0209676_100160829 | 98 |
| 246 | 3300025292 | Ga0209676_1004892 | Ga0209676_10048924 | 98 |
| 247 | 3300025294 | Ga0209025_1000006 | Ga0209025_100000621 | 98 |
| 248 | 3300025294 | Ga0209025_1099920 | Ga0209025_10999202 | 98 |
| 249 | 3300025294 | Ga0209025_1150246 | Ga0209025_11502462 | 98 |
| 250 | 3300025295 | Ga0209564_1000001 | Ga0209564_10000011548 | 98 |
| 251 | 3300025295 | Ga0209564_1007141 | Ga0209564_10071419 | 98 |
| 252 | 3300025297 | Ga0209758_1035768 | Ga0209758_10357684 | 98 |
| 253 | 3300025298 | Ga0209050_1001128 | Ga0209050_100112838 | 98 |
| 254 | 3300025299 | Ga0209256_1000002 | Ga0209256_10000025 | 98 |
| 255 | 3300025299 | Ga0209256_1003821 | Ga0209256_10038215 | 98 |
| 256 | 3300025302 | Ga0207426_1068355 | Ga0207426_10683551 | 98 |
| 257 | 3300025303 | Ga0209051_1028616 | Ga0209051_10286163 | 98 |
| 258 | 3300025304 | Ga0209257_1006382 | Ga0209257_100638215 | 98 |
| 259 | 3300025315 | Ga0207697_10049742 | Ga0207697_100497423 | 98 |
| 260 | 3300025893 | Ga0207682_10231592 | Ga0207682_102315922 | 98 |
| 261 | 3300025899 | Ga0207642_10720688 | Ga0207642_107206882 | 98 |
| 262 | 3300025907 | Ga0207645_10107422 | Ga0207645_101074222 | 98 |
| 263 | 3300025908 | Ga0207643_10160910 | Ga0207643_101609102 | 98 |
| 264 | 3300025909 | Ga0207705_10060885 | Ga0207705_100608854 | 98 |
| 265 | 3300025912 | Ga0207707_10277754 | Ga0207707_102777543 | 98 |
| 266 | 3300025917 | Ga0207660_10779635 | Ga0207660_107796352 | 98 |
| 267 | 3300025919 | Ga0207657_10006384 | Ga0207657_100063845 | 98 |
| 268 | 3300025920 | Ga0207649_10300149 | Ga0207649_103001492 | 98 |
| 269 | 3300025921 | Ga0207652_10097888 | Ga0207652_100978884 | 98 |
| 270 | 3300025923 | Ga0207681_10278322 | Ga0207681_102783222 | 98 |
| 271 | 3300025924 | Ga0207694_11565903 | Ga0207694_115659032 | 98 |
| 272 | 3300025925 | Ga0207650_10175272 | Ga0207650_101752722 | 98 |
| 273 | 3300025926 | Ga0207659_10442633 | Ga0207659_104426332 | 98 |
| 274 | 3300025926 | Ga0207659_10621832 | Ga0207659_106218322 | 98 |
| 275 | 3300025931 | Ga0207644_11169679 | Ga0207644_111696792 | 98 |
| 276 | 3300025931 | Ga0207644_11880265 | Ga0207644_118802651 | 98 |
| 277 | 3300025932 | Ga0207690_10954289 | Ga0207690_109542892 | 98 |
| 278 | 3300025933 | Ga0207706_10239882 | Ga0207706_102398822 | 98 |
| 279 | 3300025937 | Ga0207669_10076663 | Ga0207669_100766632 | 98 |
| 280 | 3300025940 | Ga0207691_10107616 | Ga0207691_101076165 | 98 |
| 281 | 3300025941 | Ga0207711_11110061 | Ga0207711_111100612 | 98 |
| 282 | 3300025949 | Ga0207667_11962249 | Ga0207667_119622492 | 98 |
| 283 | 3300025972 | Ga0207668_10160776 | Ga0207668_101607762 | 98 |
| 284 | 3300025981 | Ga0207640_12022250 | Ga0207640_120222502 | 98 |
| 285 | 3300026041 | Ga0207639_11174982 | Ga0207639_111749822 | 98 |
| 286 | 3300026067 | Ga0207678_10202573 | Ga0207678_102025732 | 98 |
| 287 | 3300026067 | Ga0207678_10590558 | Ga0207678_105905582 | 98 |
| 288 | 3300026075 | Ga0207708_10543507 | Ga0207708_105435072 | 98 |
| 289 | 3300026078 | Ga0207702_11405688 | Ga0207702_114056882 | 98 |
| 290 | 3300026089 | Ga0207648_10084850 | Ga0207648_100848505 | 98 |
| 291 | 3300026116 | Ga0207674_10301096 | Ga0207674_103010962 | 98 |
| 292 | 3300026118 | Ga0207675_100966302 | Ga0207675_1009663021 | 98 |
| 293 | 3300026118 | Ga0207675_102037818 | Ga0207675_1020378182 | 98 |
| 294 | 3300026142 | Ga0207698_10196978 | Ga0207698_101969784 | 98 |
| 295 | 3300026142 | Ga0207698_10450120 | Ga0207698_104501202 | 98 |
| 296 | 3300027252 | Ga0209973_1001982 | Ga0209973_10019822 | 98 |
| 297 | 3300027360 | Ga0209969_1000918 | Ga0209969_10009184 | 98 |
| 298 | 3300027364 | Ga0209967_1002362 | Ga0209967_10023624 | 98 |
| 299 | 3300027364 | Ga0209967_1009133 | Ga0209967_10091333 | 98 |
| 300 | 3300027378 | Ga0209981_1010702 | Ga0209981_10107022 | 98 |
| 301 | 3300027424 | Ga0209984_1000306 | Ga0209984_10003065 | 98 |
| 302 | 3300027424 | Ga0209984_1067854 | Ga0209984_10678541 | 98 |
| 303 | 3300027462 | Ga0210000_1004942 | Ga0210000_10049422 | 98 |
| 304 | 3300027471 | Ga0209995_1000770 | Ga0209995_10007706 | 98 |
| 305 | 3300027526 | Ga0209968_1017243 | Ga0209968_10172432 | 98 |
| 306 | 3300027543 | Ga0209999_1020896 | Ga0209999_10208963 | 98 |
| 307 | 3300027552 | Ga0209982_1000032 | Ga0209982_10000327 | 98 |
| 308 | 3300027552 | Ga0209982_1031999 | Ga0209982_10319992 | 98 |
| 309 | 3300027614 | Ga0209970_1035823 | Ga0209970_10358232 | 98 |
| 310 | 3300027617 | Ga0210002_1017845 | Ga0210002_10178452 | 98 |
| 311 | 3300027665 | Ga0209983_1000295 | Ga0209983_100029519 | 98 |
| 312 | 3300027682 | Ga0209971_1000410 | Ga0209971_100041020 | 98 |
| 313 | 3300027876 | Ga0209974_10010367 | Ga0209974_100103672 | 98 |
| 314 | 3300027876 | Ga0209974_10074748 | Ga0209974_100747481 | 98 |
| 315 | 3300028380 | Ga0268265_10377972 | Ga0268265_103779722 | 98 |
| 316 | 3300029277 | Ga0311001_1058661 | Ga0311001_10586612 | 98 |
| 317 | 3300030731 | Ga0316177_1006784 | Ga0316177_10067843 | 98 |
| 318 | 3300030732 | Ga0316176_1213588 | Ga0316176_12135883 | 98 |
| 319 | 3300030733 | Ga0314311_1263094 | Ga0314311_12630942 | 98 |
| 320 | 3300030735 | Ga0316178_1178759 | Ga0316178_11787592 | 98 |
| 321 | 3300030736 | Ga0316180_1161841 | Ga0316180_11618412 | 98 |
| 322 | 3300030742 | Ga0316183_1156957 | Ga0316183_11569572 | 98 |
| 323 | 3300030745 | Ga0316182_1151288 | Ga0316182_11512882 | 98 |
| 324 | 3300030745 | Ga0316182_1157126 | Ga0316182_11571262 | 98 |
| 325 | 3300030745 | Ga0316182_1184990 | Ga0316182_11849902 | 98 |
| 326 | 3300031548 | Ga0307408_100181171 | Ga0307408_1001811713 | 98 |
| 327 | 3300031548 | Ga0307408_101601202 | Ga0307408_1016012022 | 98 |
| 328 | 3300031731 | Ga0307405_11468755 | Ga0307405_114687552 | 98 |
| 329 | 3300031731 | Ga0307405_12142146 | Ga0307405_121421461 | 98 |
| 330 | 3300031824 | Ga0307413_10037133 | Ga0307413_100371334 | 98 |
| 331 | 3300031824 | Ga0307413_10279926 | Ga0307413_102799263 | 98 |
| 332 | 3300031824 | Ga0307413_10517385 | Ga0307413_105173852 | 98 |
| 333 | 3300031824 | Ga0307413_10778113 | Ga0307413_107781132 | 98 |
| 334 | 3300031824 | Ga0307413_10991576 | Ga0307413_109915762 | 98 |
| 335 | 3300031824 | Ga0307413_11006848 | Ga0307413_110068481 | 98 |
| 336 | 3300031852 | Ga0307410_10427645 | Ga0307410_104276452 | 98 |
| 337 | 3300031901 | Ga0307406_10094886 | Ga0307406_100948863 | 98 |
| 338 | 3300031901 | Ga0307406_10346198 | Ga0307406_103461982 | 98 |
| 339 | 3300031903 | Ga0307407_10034741 | Ga0307407_100347414 | 98 |
| 340 | 3300031911 | Ga0307412_10042944 | Ga0307412_100429444 | 98 |
| 341 | 3300031911 | Ga0307412_10311553 | Ga0307412_103115532 | 98 |
| 342 | 3300031911 | Ga0307412_10401326 | Ga0307412_104013262 | 98 |
| 343 | 3300031911 | Ga0307412_11190223 | Ga0307412_111902232 | 98 |
| 344 | 3300031911 | Ga0307412_11208676 | Ga0307412_112086762 | 98 |
| 345 | 3300031995 | Ga0307409_100767138 | Ga0307409_1007671382 | 98 |
| 346 | 3300032002 | Ga0307416_101510611 | Ga0307416_1015106112 | 98 |
| 347 | 3300032002 | Ga0307416_103563832 | Ga0307416_1035638322 | 98 |
| 348 | 3300032004 | Ga0307414_10002120 | Ga0307414_1000212019 | 98 |
| 349 | 3300032004 | Ga0307414_10007179 | Ga0307414_100071795 | 98 |
| 350 | 3300032004 | Ga0307414_10063463 | Ga0307414_100634633 | 98 |
| 351 | 3300032004 | Ga0307414_10448284 | Ga0307414_104482842 | 98 |
| 352 | 3300032004 | Ga0307414_10697965 | Ga0307414_106979652 | 98 |
| 353 | 3300032004 | Ga0307414_11060873 | Ga0307414_110608731 | 98 |
| 354 | 3300032004 | Ga0307414_11297263 | Ga0307414_112972632 | 98 |
| 355 | 3300032005 | Ga0307411_10041490 | Ga0307411_100414905 | 98 |
| 356 | 3300032005 | Ga0307411_10862437 | Ga0307411_108624372 | 98 |
| 357 | 3300032005 | Ga0307411_11078775 | Ga0307411_110787752 | 98 |
| 358 | 3300032005 | Ga0307411_11292060 | Ga0307411_112920602 | 98 |
| 359 | 3300032126 | Ga0307415_100292343 | Ga0307415_1002923432 | 98 |
| 360 | 3300034818 | Ga0373950_0094669 | Ga0373950_0094669_223_534 | 98 |
| 361 | 3300035170 | Ga0373943_0487907 | Ga0373943_0487907_188_490 | 98 |
| 362 | 3300035691 | Ga0373931_1024699 | Ga0373931_1024699_58_369 | 98 |
| 363 | 3300035692 | Ga0373935_1312547 | Ga0373935_1312547_137_448 | 98 |
| 364 | 3300035724 | Ga0373933_0611407 | Ga0373933_0611407_39_350 | 98 |
| 365 | 3300037312 | Ga0395899_0093693 | Ga0395899_0093693_1868_2164 | 98 |
| 366 | 3300037418 | Ga0395900_0036642 | Ga0395900_0036642_3817_4113 | 98 |
| 367 | 3300037466 | Ga0395898_0180698 | Ga0395898_0180698_731_1027 | 98 |
| 368 | 3300037471 | Ga0395905_0110752 | Ga0395905_0110752_1424_1735 | 98 |
| 369 | 3300037471 | Ga0395905_0293167 | Ga0395905_0293167_452_748 | 98 |
| 370 | 3300037471 | Ga0395905_1623580 | Ga0395905_1623580_63_374 | 98 |
| 371 | 3300038443 | Ga0395901_0276971 | Ga0395901_0276971_271_567 | 98 |
| 372 | 3300039145 | Ga0237816_00020 | Ga0237816_00020_7153_7449 | 98 |
| 373 | 3300041404 | Ga0439436_0005214 | Ga0439436_0005214_105_401 | 98 |
| 374 | 3300041404 | Ga0439436_0009292 | Ga0439436_0009292_491_787 | 98 |
| 375 | 3300041404 | Ga0439436_0044395 | Ga0439436_0044395_673_969 | 98 |
| 376 | 3300041404 | Ga0439436_0195246 | Ga0439436_0195246_92_388 | 98 |
| 377 | 3300041406 | Ga0439439_0004561 | Ga0439439_0004561_500_796 | 98 |
| 378 | 3300041407 | Ga0439447_013961 | Ga0439447_013961_786_1082 | 98 |
| 379 | 3300041411 | Ga0439466_0112396 | Ga0439466_0112396_132_428 | 98 |
| 380 | 3300041413 | Ga0439465_0009954 | Ga0439465_0009954_335_631 | 98 |
| 381 | 3300041413 | Ga0439465_0045155 | Ga0439465_0045155_789_1085 | 98 |
| 382 | 3300041413 | Ga0439465_0054861 | Ga0439465_0054861_494_790 | 98 |
| 383 | 3300041413 | Ga0439465_0329805 | Ga0439465_0329805_184_480 | 98 |
| 384 | 3300041453 | Ga0451797_0495586 | Ga0451797_0495586_208_507 | 98 |
| 385 | 3300041460 | Ga0451802_1892135 | Ga0451802_1892135_24_320 | 98 |
| 386 | 3300041461 | Ga0451805_021755 | Ga0451805_021755_117_416 | 98 |
| 387 | 3300041494 | Ga0451837_0822369 | Ga0451837_0822369_424_723 | 98 |
| 388 | 3300041997 | Ga0439431_0172541 | Ga0439431_0172541_228_524 | 98 |
| 389 | 3300041999 | Ga0439433_0016339 | Ga0439433_0016339_964_1260 | 98 |
| 390 | 3300041999 | Ga0439433_0051959 | Ga0439433_0051959_443_772 | 98 |
| 391 | 3300041999 | Ga0439433_0071138 | Ga0439433_0071138_324_620 | 98 |
| 392 | 3300042004 | Ga0439445_0022958 | Ga0439445_0022958_1080_1376 | 98 |
| 393 | 3300042004 | Ga0439445_0109731 | Ga0439445_0109731_443_739 | 98 |
| 394 | 3300042005 | Ga0439448_0105629 | Ga0439448_0105629_219_515 | 98 |
| 395 | 3300042006 | Ga0439432_044052 | Ga0439432_044052_379_675 | 98 |
| 396 | 3300042006 | Ga0439432_145403 | Ga0439432_145403_371_667 | 98 |
| 397 | 3300042007 | Ga0439449_0011871 | Ga0439449_0011871_2316_2612 | 98 |
| 398 | 3300042007 | Ga0439449_0047245 | Ga0439449_0047245_69_365 | 98 |
| 399 | 3300042007 | Ga0439449_0050566 | Ga0439449_0050566_668_964 | 98 |
| 400 | 3300042007 | Ga0439449_0052843 | Ga0439449_0052843_264_560 | 98 |
| 401 | 3300042007 | Ga0439449_0059877 | Ga0439449_0059877_876_1232 | 98 |
| 402 | 3300042007 | Ga0439449_0238816 | Ga0439449_0238816_180_476 | 98 |
| 403 | 3300042010 | Ga0439452_043990 | Ga0439452_043990_36_332 | 98 |
| 404 | 3300042010 | Ga0439452_125502 | Ga0439452_125502_34_330 | 98 |
| 405 | 3300042012 | Ga0439455_0094324 | Ga0439455_0094324_352_648 | 98 |
| 406 | 3300042014 | Ga0439457_033336 | Ga0439457_033336_361_657 | 98 |
| 407 | 3300042014 | Ga0439457_165578 | Ga0439457_165578_76_372 | 98 |
| 408 | 3300042015 | Ga0439462_0027568 | Ga0439462_0027568_424_720 | 98 |
| 409 | 3300042015 | Ga0439462_0082925 | Ga0439462_0082925_461_757 | 98 |
| 410 | 3300042138 | Ga0450903_045815 | Ga0450903_045815_30_326 | 98 |
| 411 | 3300045836 | Ga0466958_1166693 | Ga0466958_1166693_130_426 | 98 |
| 412 | 3300046512 | Ga0495610_0236940 | Ga0495610_0236940_257_553 | 98 |
| 413 | 3300046525 | Ga0495663_0051919 | Ga0495663_0051919_409_705 | 98 |
| 414 | 3300046525 | Ga0495663_0063370 | Ga0495663_0063370_583_879 | 98 |
| 415 | 3300046525 | Ga0495663_0135103 | Ga0495663_0135103_483_779 | 98 |
| 416 | 3300046537 | Ga0495598_0158612 | Ga0495598_0158612_197_493 | 98 |
| 417 | 3300046537 | Ga0495598_0293813 | Ga0495598_0293813_113_424 | 98 |
| 418 | 3300046539 | Ga0495621_0084120 | Ga0495621_0084120_334_630 | 98 |
| 419 | 3300046539 | Ga0495621_0225644 | Ga0495621_0225644_132_428 | 98 |
| 420 | 3300046615 | Ga0495656_0004814 | Ga0495656_0004814_381_677 | 98 |
| 421 | 3300046616 | Ga0495668_0033171 | Ga0495668_0033171_2372_2668 | 98 |
| 422 | 3300046664 | Ga0495659_0087343 | Ga0495659_0087343_568_864 | 98 |
| 423 | 3300046664 | Ga0495659_0370808 | Ga0495659_0370808_28_324 | 98 |
| 424 | 3300046674 | Ga0495588_0423553 | Ga0495588_0423553_157_453 | 98 |
| 425 | 3300046691 | Ga0495670_0342267 | Ga0495670_0342267_359_655 | 98 |
| 426 | 3300046691 | Ga0495670_0495645 | Ga0495670_0495645_297_593 | 98 |
| 427 | 3300047318 | Ga0495636_0052343 | Ga0495636_0052343_1341_1637 | 98 |
| 428 | 3300047318 | Ga0495636_0121083 | Ga0495636_0121083_441_737 | 98 |
| 429 | 3300047447 | Ga0495685_061912 | Ga0495685_061912_758_1054 | 98 |
| 430 | 3300047470 | Ga0495681_0124862 | Ga0495681_0124862_118_414 | 98 |
| 431 | 3300048904 | Ga0496101_0223296 | Ga0496101_0223296_62_373 | 98 |
| 432 | 3300048905 | Ga0496102_1169225 | Ga0496102_1169225_16_312 | 98 |
| 433 | 3300048911 | Ga0496108_0557978 | Ga0496108_0557978_473_769 | 98 |
| 434 | 3300048912 | Ga0496109_0387077 | Ga0496109_0387077_414_710 | 98 |
| 435 | 3300048913 | Ga0496110_1123034 | Ga0496110_1123034_83_379 | 98 |
| 436 | 3300048918 | Ga0496115_0367309 | Ga0496115_0367309_73_384 | 98 |
| 437 | 3300048924 | Ga0496121_0005001 | Ga0496121_0005001_15023_15319 | 98 |
| 438 | 3300049127 | Ga0501306_005642 | Ga0501306_005642_779_1075 | 98 |
| 439 | 3300049127 | Ga0501306_017111 | Ga0501306_017111_420_716 | 98 |
| 440 | 3300049127 | Ga0501306_026148 | Ga0501306_026148_220_516 | 98 |
| 441 | 3300049127 | Ga0501306_056469 | Ga0501306_056469_54_350 | 98 |
| 442 | 3300049127 | Ga0501306_086653 | Ga0501306_086653_218_514 | 98 |
| 443 | 3300049128 | Ga0501308_000035 | Ga0501308_000035_2268_2564 | 98 |
| 444 | 3300049128 | Ga0501308_005875 | Ga0501308_005875_437_733 | 98 |
| 445 | 3300049129 | Ga0501309_047735 | Ga0501309_047735_37_393 | 98 |
| 446 | 3300049130 | Ga0501310_000986 | Ga0501310_000986_628_924 | 98 |
| 447 | 3300049130 | Ga0501310_007734 | Ga0501310_007734_667_963 | 98 |
| 448 | 3300049131 | Ga0501341_01557 | Ga0501341_01557_407_703 | 98 |
| 449 | 3300049134 | Ga0501345_03043 | Ga0501345_03043_94_390 | 98 |
| 450 | 3300049160 | Ga0501304_004356 | Ga0501304_004356_391_687 | 98 |
| 451 | 3300049161 | Ga0501305_001649 | Ga0501305_001649_178_474 | 98 |
| 452 | 3300049161 | Ga0501305_024565 | Ga0501305_024565_404_700 | 98 |
| 453 | 3300049161 | Ga0501305_025801 | Ga0501305_025801_457_753 | 98 |
| 454 | 3300049161 | Ga0501305_051082 | Ga0501305_051082_58_414 | 98 |
| 455 | 3300049162 | Ga0501307_000579 | Ga0501307_000579_843_1139 | 98 |
| 456 | 3300049162 | Ga0501307_028221 | Ga0501307_028221_140_436 | 98 |
| 457 | 3300049162 | Ga0501307_028729 | Ga0501307_028729_146_454 | 98 |
| 458 | 3300049162 | Ga0501307_030527 | Ga0501307_030527_82_378 | 98 |
| 459 | 3300049162 | Ga0501307_035371 | Ga0501307_035371_78_374 | 98 |
| 460 | 3300049163 | Ga0501342_04097 | Ga0501342_04097_76_372 | 98 |
| 461 | 3300049514 | Ga0501291_106770 | Ga0501291_106770_108_404 | 98 |
| 462 | 3300049527 | Ga0501311_003051 | Ga0501311_003051_331_627 | 98 |
| 463 | 3300049528 | Ga0501312_002244 | Ga0501312_002244_721_1017 | 98 |
| 464 | 3300049528 | Ga0501312_077752 | Ga0501312_077752_103_399 | 98 |
| 465 | 3300049528 | Ga0501312_079207 | Ga0501312_079207_202_558 | 98 |
| 466 | 3300049529 | Ga0501313_003322 | Ga0501313_003322_604_900 | 98 |
| 467 | 3300049530 | Ga0501314_007283 | Ga0501314_007283_332_628 | 98 |
| 468 | 3300049530 | Ga0501314_014003 | Ga0501314_014003_454_750 | 98 |
| 469 | 3300049531 | Ga0501315_004415 | Ga0501315_004415_316_612 | 98 |
| 470 | 3300049531 | Ga0501315_040976 | Ga0501315_040976_165_461 | 98 |
| 471 | 3300049531 | Ga0501315_086517 | Ga0501315_086517_146_502 | 98 |
| 472 | 3300049532 | Ga0501316_004177 | Ga0501316_004177_951_1247 | 98 |
| 473 | 3300049532 | Ga0501316_052158 | Ga0501316_052158_34_390 | 98 |
| 474 | 3300049533 | Ga0501317_006218 | Ga0501317_006218_681_977 | 98 |
| 475 | 3300049533 | Ga0501317_010657 | Ga0501317_010657_301_597 | 98 |
| 476 | 3300049534 | Ga0501318_000528 | Ga0501318_000528_628_924 | 98 |
| 477 | 3300049534 | Ga0501318_035161 | Ga0501318_035161_37_393 | 98 |
| 478 | 3300049534 | Ga0501318_063123 | Ga0501318_063123_224_520 | 98 |
| 479 | 3300049535 | Ga0501319_000070 | Ga0501319_000070_747_1043 | 98 |
| 480 | 3300049535 | Ga0501319_008492 | Ga0501319_008492_327_623 | 98 |
| 481 | 3300049536 | Ga0501320_008783 | Ga0501320_008783_394_690 | 98 |
| 482 | 3300049537 | Ga0501321_005366 | Ga0501321_005366_706_1002 | 98 |
| 483 | 3300049537 | Ga0501321_013367 | Ga0501321_013367_426_722 | 98 |
| 484 | 3300049537 | Ga0501321_038133 | Ga0501321_038133_218_574 | 98 |
| 485 | 3300049538 | Ga0501322_004912 | Ga0501322_004912_287_583 | 98 |
| 486 | 3300049539 | Ga0501323_000101 | Ga0501323_000101_3661_3957 | 98 |
| 487 | 3300049539 | Ga0501323_050181 | Ga0501323_050181_136_432 | 98 |
| 488 | 3300049539 | Ga0501323_056670 | Ga0501323_056670_207_563 | 98 |
| 489 | 3300049540 | Ga0501324_000043 | Ga0501324_000043_251_547 | 98 |
| 490 | 3300049540 | Ga0501324_020298 | Ga0501324_020298_105_461 | 98 |
| 491 | 3300049540 | Ga0501324_025706 | Ga0501324_025706_57_353 | 98 |
| 492 | 3300049541 | Ga0501325_003096 | Ga0501325_003096_314_610 | 98 |
| 493 | 3300049545 | Ga0501329_02559 | Ga0501329_02559_380_676 | 98 |
| 494 | 3300049546 | Ga0501330_003224 | Ga0501330_003224_338_634 | 98 |
| 495 | 3300049547 | Ga0501331_10925 | Ga0501331_10925_186_482 | 98 |
| 496 | 3300049548 | Ga0501332_05628 | Ga0501332_05628_147_443 | 98 |
| 497 | 3300049549 | Ga0501333_006796 | Ga0501333_006796_143_439 | 98 |
| 498 | 3300049550 | Ga0501334_08151 | Ga0501334_08151_110_406 | 98 |
| 499 | 3300049552 | Ga0501336_003033 | Ga0501336_003033_238_534 | 98 |
| 500 | 3300049553 | Ga0501337_016844 | Ga0501337_016844_101_397 | 98 |
| 501 | 3300049554 | Ga0501338_06754 | Ga0501338_06754_377_673 | 98 |
| 502 | 3300049556 | Ga0501340_005822 | Ga0501340_005822_331_627 | 98 |
| 503 | 3300049556 | Ga0501340_012965 | Ga0501340_012965_221_577 | 98 |
| 504 | 3300049556 | Ga0501340_019503 | Ga0501340_019503_230_526 | 98 |
| 505 | 3300049568 | Ga0501031_0025141 | Ga0501031_0025141_2608_2904 | 98 |
| 506 | 3300049568 | Ga0501031_0101188 | Ga0501031_0101188_737_1036 | 98 |
| 507 | 3300049569 | Ga0501032_0217693 | Ga0501032_0217693_425_721 | 98 |
| 508 | 3300049569 | Ga0501032_0675160 | Ga0501032_0675160_329_628 | 98 |
| 509 | 3300049570 | Ga0501033_0123272 | Ga0501033_0123272_875_1171 | 98 |
| 510 | 3300049571 | Ga0501034_0120372 | Ga0501034_0120372_699_998 | 98 |
| 511 | 3300049571 | Ga0501034_0376789 | Ga0501034_0376789_806_1102 | 98 |
| 512 | 3300049571 | Ga0501034_0395735 | Ga0501034_0395735_621_917 | 98 |
| 513 | 3300049572 | Ga0501036_0066357 | Ga0501036_0066357_1391_1690 | 98 |
| 514 | 3300049572 | Ga0501036_0660103 | Ga0501036_0660103_359_655 | 98 |
| 515 | 3300049573 | Ga0501037_0021232 | Ga0501037_0021232_4046_4345 | 98 |
| 516 | 3300049573 | Ga0501037_0493195 | Ga0501037_0493195_153_449 | 98 |
| 517 | 3300049574 | Ga0501038_0002396 | Ga0501038_0002396_2227_2526 | 98 |
| 518 | 3300049574 | Ga0501038_0026720 | Ga0501038_0026720_2017_2313 | 98 |
| 519 | 3300049575 | Ga0501039_0013271 | Ga0501039_0013271_3026_3325 | 98 |
| 520 | 3300049575 | Ga0501039_0366055 | Ga0501039_0366055_363_659 | 98 |
| 521 | 3300049579 | Ga0501043_0030616 | Ga0501043_0030616_1841_2137 | 98 |
| 522 | 3300049579 | Ga0501043_0326832 | Ga0501043_0326832_329_625 | 98 |
| 523 | 3300049579 | Ga0501043_0571857 | Ga0501043_0571857_231_530 | 98 |
| 524 | 3300049580 | Ga0501046_0534208 | Ga0501046_0534208_286_585 | 98 |
| 525 | 3300049580 | Ga0501046_0786563 | Ga0501046_0786563_218_514 | 98 |
| 526 | 3300049581 | Ga0501047_0059275 | Ga0501047_0059275_362_658 | 98 |
| 527 | 3300049581 | Ga0501047_0221275 | Ga0501047_0221275_1104_1403 | 98 |
| 528 | 3300049582 | Ga0501048_0538607 | Ga0501048_0538607_285_581 | 98 |
| 529 | 3300049582 | Ga0501048_0581196 | Ga0501048_0581196_202_501 | 98 |
| 530 | 3300049584 | Ga0501068_0639040 | Ga0501068_0639040_283_582 | 98 |
| 531 | 3300049586 | Ga0501070_0016046 | Ga0501070_0016046_428_727 | 98 |
| 532 | 3300049586 | Ga0501070_0198353 | Ga0501070_0198353_675_971 | 98 |
| 533 | 3300049587 | Ga0501071_0037161 | Ga0501071_0037161_842_1141 | 98 |
| 534 | 3300049589 | Ga0501073_0068309 | Ga0501073_0068309_1429_1728 | 98 |
| 535 | 3300049649 | Ga0501198_053502 | Ga0501198_053502_278_574 | 98 |
| 536 | 3300049652 | Ga0501202_037238 | Ga0501202_037238_349_645 | 98 |
| 537 | 3300049653 | Ga0501206_040475 | Ga0501206_040475_112_408 | 98 |
| 538 | 3300049658 | Ga0501211_031447 | Ga0501211_031447_169_465 | 98 |
| 539 | 3300049660 | Ga0501216_023017 | Ga0501216_023017_353_649 | 98 |
| 540 | 3300049661 | Ga0501217_048551 | Ga0501217_048551_479_775 | 98 |
| 541 | 3300049662 | Ga0501222_041128 | Ga0501222_041128_301_597 | 98 |
| 542 | 3300049663 | Ga0501223_032298 | Ga0501223_032298_200_496 | 98 |
| 543 | 3300049665 | Ga0501227_172799 | Ga0501227_172799_81_377 | 98 |
| 544 | 3300049669 | Ga0501235_189123 | Ga0501235_189123_179_475 | 98 |
| 545 | 3300049671 | Ga0501238_077425 | Ga0501238_077425_131_427 | 98 |
| 546 | 3300049672 | Ga0501239_002487 | Ga0501239_002487_394_690 | 98 |
| 547 | 3300049673 | Ga0501240_014783 | Ga0501240_014783_296_592 | 98 |
| 548 | 3300049674 | Ga0501242_009218 | Ga0501242_009218_179_475 | 98 |
| 549 | 3300049679 | Ga0501249_021629 | Ga0501249_021629_221_517 | 98 |
| 550 | 3300049680 | Ga0501250_043409 | Ga0501250_043409_289_585 | 98 |
| 551 | 3300049681 | Ga0501251_029671 | Ga0501251_029671_315_611 | 98 |
| 552 | 3300049682 | Ga0501252_008250 | Ga0501252_008250_681_977 | 98 |
| 553 | 3300049683 | Ga0501253_058558 | Ga0501253_058558_170_466 | 98 |
| 554 | 3300049686 | Ga0501257_049116 | Ga0501257_049116_344_640 | 98 |
| 555 | 3300049688 | Ga0501259_119797 | Ga0501259_119797_58_354 | 98 |
| 556 | 3300049705 | Ga0501225_0045508 | Ga0501225_0045508_530_826 | 98 |
| 557 | 3300049705 | Ga0501225_0065537 | Ga0501225_0065537_441_737 | 98 |
| 558 | 3300049741 | Ga0501079_0672563 | Ga0501079_0672563_235_534 | 98 |
| 559 | 3300049742 | Ga0501080_0018310 | Ga0501080_0018310_4639_4938 | 98 |
| 560 | 3300049757 | Ga0501232_028687 | Ga0501232_028687_141_437 | 98 |
| 561 | 3300049758 | Ga0501241_033359 | Ga0501241_033359_424_720 | 98 |
| 562 | 3300049760 | Ga0501263_004493 | Ga0501263_004493_1083_1379 | 98 |
| 563 | 3300049763 | Ga0501266_012196 | Ga0501266_012196_417_713 | 98 |
| 564 | 3300049765 | Ga0501268_015441 | Ga0501268_015441_424_720 | 98 |
| 565 | 3300049766 | Ga0501269_009447 | Ga0501269_009447_430_726 | 98 |
| 566 | 3300049767 | Ga0501270_105993 | Ga0501270_105993_107_403 | 98 |
| 567 | 3300049771 | Ga0501274_014849 | Ga0501274_014849_308_604 | 98 |
| 568 | 3300049772 | Ga0501275_005782 | Ga0501275_005782_358_654 | 98 |
| 569 | 3300049778 | Ga0501282_022380 | Ga0501282_022380_304_600 | 98 |
| 570 | 3300049779 | Ga0501283_105997 | Ga0501283_105997_113_409 | 98 |
| 571 | 3300049822 | Ga0501035_0003746 | Ga0501035_0003746_13795_14094 | 98 |
| 572 | 3300049822 | Ga0501035_0039431 | Ga0501035_0039431_855_1151 | 98 |
| 573 | 3300049823 | Ga0501044_0003730 | Ga0501044_0003730_722_1021 | 98 |
| 574 | 3300049823 | Ga0501044_0154075 | Ga0501044_0154075_661_957 | 98 |
| 575 | 3300049824 | Ga0501045_0352529 | Ga0501045_0352529_291_587 | 98 |
| 576 | 3300049850 | Ga0501204_065782 | Ga0501204_065782_196_492 | 98 |
| 577 | 3300059508 | Ga0587088_127429 | Ga0587088_127429_32_328 | 98 |
| 578 | 3300059510 | Ga0587090_008934 | Ga0587090_008934_743_1039 | 98 |
| 579 | 3300059639 | Ga0587062_036448 | Ga0587062_036448_353_649 | 98 |
| 580 | 3300059642 | Ga0587069_027263 | Ga0587069_027263_175_471 | 98 |
| 581 | 3300059647 | Ga0587079_118289 | Ga0587079_118289_314_610 | 98 |
| 582 | 3300060344 | Ga0587071_055827 | Ga0587071_055827_276_572 | 98 |
| 583 | 2162886007 | SwRhRL2b_contig_1598425 | SwRhRL2b_0616.00010060 | 99 |
| 584 | 2162886007 | SwRhRL2b_contig_332562 | SwRhRL2b_0499.00001270 | 99 |
| 585 | 3300002774 | JGI25150J39212_1000359 | JGI25150J39212_10003594 | 99 |
| 586 | 3300003187 | JGI25151J46595_10000895 | JGI25151J46595_1000089532 | 99 |
| 587 | 3300003215 | JGI25153J46596_10000050 | JGI25153J46596_10000050153 | 99 |
| 588 | 3300003320 | rootH2_10028426 | rootH2_100284262 | 99 |
| 589 | 3300003323 | rootH1_10139366 | rootH1_101393662 | 99 |
| 590 | 3300003781 | Ga0055536_1024910 | Ga0055536_10249103 | 99 |
| 591 | 3300003794 | Ga0055531_10014020 | Ga0055531_100140205 | 99 |
| 592 | 3300003794 | Ga0055531_10014865 | Ga0055531_100148655 | 99 |
| 593 | 3300003856 | Ga0058692_1000785 | Ga0058692_10007854 | 99 |
| 594 | 3300005289 | Ga0065704_10006278 | Ga0065704_100062781 | 99 |
| 595 | 3300005289 | Ga0065704_10030623 | Ga0065704_100306232 | 99 |
| 596 | 3300005289 | Ga0065704_10253178 | Ga0065704_102531782 | 99 |
| 597 | 3300005347 | Ga0070668_100303029 | Ga0070668_1003030292 | 99 |
| 598 | 3300005354 | Ga0070675_100666145 | Ga0070675_1006661452 | 99 |
| 599 | 3300005441 | Ga0070700_101225275 | Ga0070700_1012252751 | 99 |
| 600 | 3300005530 | Ga0070679_100466934 | Ga0070679_1004669342 | 99 |
| 601 | 3300005548 | Ga0070665_100152522 | Ga0070665_1001525222 | 99 |
| 602 | 3300005548 | Ga0070665_100308958 | Ga0070665_1003089583 | 99 |
| 603 | 3300005840 | Ga0068870_10298836 | Ga0068870_102988362 | 99 |
| 604 | 3300005985 | Ga0081539_10024522 | Ga0081539_100245225 | 99 |
| 605 | 3300005985 | Ga0081539_10412345 | Ga0081539_104123452 | 99 |
| 606 | 3300006048 | Ga0075363_100330491 | Ga0075363_1003304912 | 99 |
| 607 | 3300006051 | Ga0075364_10738799 | Ga0075364_107387992 | 99 |
| 608 | 3300006177 | Ga0075362_10516426 | Ga0075362_105164262 | 99 |
| 609 | 3300006186 | Ga0075369_10150290 | Ga0075369_101502902 | 99 |
| 610 | 3300006186 | Ga0075369_10383019 | Ga0075369_103830192 | 99 |
| 611 | 3300006186 | Ga0075369_10392157 | Ga0075369_103921572 | 99 |
| 612 | 3300006195 | Ga0075366_10356136 | Ga0075366_103561362 | 99 |
| 613 | 3300009036 | Ga0105244_10048884 | Ga0105244_100488842 | 99 |
| 614 | 3300009148 | Ga0105243_10036695 | Ga0105243_100366954 | 99 |
| 615 | 3300009553 | Ga0105249_11545416 | Ga0105249_115454162 | 99 |
| 616 | 3300017792 | Ga0163161_10172112 | Ga0163161_101721123 | 99 |
| 617 | 3300020075 | Ga0206349_1852705 | Ga0206349_18527052 | 99 |
| 618 | 3300025245 | Ga0207425_1000117 | Ga0207425_100011740 | 99 |
| 619 | 3300025258 | Ga0209129_1000011 | Ga0209129_1000011341 | 99 |
| 620 | 3300025292 | Ga0209676_1004379 | Ga0209676_100437916 | 99 |
| 621 | 3300025294 | Ga0209025_1000002 | Ga0209025_1000002457 | 99 |
| 622 | 3300025297 | Ga0209758_1000003 | Ga0209758_1000003464 | 99 |
| 623 | 3300025298 | Ga0209050_1025712 | Ga0209050_10257123 | 99 |
| 624 | 3300025304 | Ga0209257_1002665 | Ga0209257_100266526 | 99 |
| 625 | 3300025304 | Ga0209257_1005259 | Ga0209257_10052595 | 99 |
| 626 | 3300025728 | Ga0207655_1039647 | Ga0207655_10396472 | 99 |
| 627 | 3300025907 | Ga0207645_10245072 | Ga0207645_102450721 | 99 |
| 628 | 3300025926 | Ga0207659_10897028 | Ga0207659_108970281 | 99 |
| 629 | 3300025935 | Ga0207709_10000421 | Ga0207709_1000042124 | 99 |
| 630 | 3300025972 | Ga0207668_10071707 | Ga0207668_100717072 | 99 |
| 631 | 3300026075 | Ga0207708_10419749 | Ga0207708_104197492 | 99 |
| 632 | 3300027312 | Ga0209371_1000004 | Ga0209371_10000041042 | 99 |
| 633 | 3300028379 | Ga0268266_10168036 | Ga0268266_101680364 | 99 |
| 634 | 3300028379 | Ga0268266_10170446 | Ga0268266_101704463 | 99 |
| 635 | 3300030500 | Ga0268256_1000005 | Ga0268256_10000055 | 99 |
| 636 | 3300031995 | Ga0307409_101575233 | Ga0307409_1015752331 | 99 |
| 637 | 3300032004 | Ga0307414_10020644 | Ga0307414_100206445 | 99 |
| 638 | 3300032004 | Ga0307414_10046872 | Ga0307414_100468722 | 99 |
| 639 | 3300032004 | Ga0307414_10234802 | Ga0307414_102348022 | 99 |
| 640 | 3300032005 | Ga0307411_11554591 | Ga0307411_115545912 | 99 |
| 641 | 3300038705 | Ga0237819_00026 | Ga0237819_00026_47856_48155 | 99 |
| 642 | 3300038705 | Ga0237819_05137 | Ga0237819_05137_1389_1688 | 99 |
| 643 | 3300041404 | Ga0439436_0020558 | Ga0439436_0020558_1017_1331 | 99 |
| 644 | 3300041413 | Ga0439465_0005524 | Ga0439465_0005524_2334_2648 | 99 |
| 645 | 3300041413 | Ga0439465_0169776 | Ga0439465_0169776_139_438 | 99 |
| 646 | 3300041443 | Ga0451789_0611670 | Ga0451789_0611670_67_381 | 99 |
| 647 | 3300041451 | Ga0451791_0348064 | Ga0451791_0348064_598_912 | 99 |
| 648 | 3300041452 | Ga0451793_1022662 | Ga0451793_1022662_623_937 | 99 |
| 649 | 3300041453 | Ga0451797_0542817 | Ga0451797_0542817_425_739 | 99 |
| 650 | 3300041455 | Ga0451801_10668 | Ga0451801_10668_23_337 | 99 |
| 651 | 3300041456 | Ga0451795_1206484 | Ga0451795_1206484_231_545 | 99 |
| 652 | 3300041458 | Ga0451798_0378261 | Ga0451798_0378261_581_895 | 99 |
| 653 | 3300041459 | Ga0451800_0237753 | Ga0451800_0237753_342_656 | 99 |
| 654 | 3300041460 | Ga0451802_0845033 | Ga0451802_0845033_189_503 | 99 |
| 655 | 3300041460 | Ga0451802_0845984 | Ga0451802_0845984_171_485 | 99 |
| 656 | 3300041460 | Ga0451802_0882002 | Ga0451802_0882002_46_360 | 99 |
| 657 | 3300041461 | Ga0451805_060263 | Ga0451805_060263_181_495 | 99 |
| 658 | 3300041463 | Ga0451804_0354493 | Ga0451804_0354493_179_493 | 99 |
| 659 | 3300041492 | Ga0451835_0031836 | Ga0451835_0031836_269_583 | 99 |
| 660 | 3300041494 | Ga0451837_0144598 | Ga0451837_0144598_169_483 | 99 |
| 661 | 3300041497 | Ga0451840_04882 | Ga0451840_04882_213_527 | 99 |
| 662 | 3300041498 | Ga0451841_0137401 | Ga0451841_0137401_294_608 | 99 |
| 663 | 3300041501 | Ga0451845_0710242 | Ga0451845_0710242_287_598 | 99 |
| 664 | 3300041509 | Ga0451843_0901379 | Ga0451843_0901379_298_612 | 99 |
| 665 | 3300041512 | Ga0451853_2452886 | Ga0451853_2452886_488_802 | 99 |
| 666 | 3300041997 | Ga0439431_0008628 | Ga0439431_0008628_1932_2246 | 99 |
| 667 | 3300041999 | Ga0439433_0043496 | Ga0439433_0043496_455_769 | 99 |
| 668 | 3300042007 | Ga0439449_0039601 | Ga0439449_0039601_428_742 | 99 |
| 669 | 3300042156 | Ga0439446_0036071 | Ga0439446_0036071_883_1197 | 99 |
| 670 | 3300042435 | Ga0439434_0363768 | Ga0439434_0363768_14_328 | 99 |
| 671 | 3300046507 | Ga0495606_0035985 | Ga0495606_0035985_2599_2898 | 99 |
| 672 | 3300046512 | Ga0495610_0251536 | Ga0495610_0251536_352_651 | 99 |
| 673 | 3300046513 | Ga0495616_0270579 | Ga0495616_0270579_232_546 | 99 |
| 674 | 3300046518 | Ga0495631_0154725 | Ga0495631_0154725_316_615 | 99 |
| 675 | 3300046525 | Ga0495663_0004473 | Ga0495663_0004473_1358_1672 | 99 |
| 676 | 3300046525 | Ga0495663_0135107 | Ga0495663_0135107_275_589 | 99 |
| 677 | 3300046539 | Ga0495621_0001470 | Ga0495621_0001470_3765_4079 | 99 |
| 678 | 3300046539 | Ga0495621_0294762 | Ga0495621_0294762_120_434 | 99 |
| 679 | 3300046558 | Ga0495633_0318237 | Ga0495633_0318237_198_497 | 99 |
| 680 | 3300046615 | Ga0495656_0140966 | Ga0495656_0140966_107_421 | 99 |
| 681 | 3300046660 | Ga0495625_0591950 | Ga0495625_0591950_340_654 | 99 |
| 682 | 3300046664 | Ga0495659_0112299 | Ga0495659_0112299_351_665 | 99 |
| 683 | 3300046691 | Ga0495670_0101413 | Ga0495670_0101413_1057_1371 | 99 |
| 684 | 3300046692 | Ga0495671_0368709 | Ga0495671_0368709_170_484 | 99 |
| 685 | 3300047318 | Ga0495636_0613476 | Ga0495636_0613476_102_416 | 99 |
| 686 | 3300048925 | Ga0496122_0097842 | Ga0496122_0097842_581_895 | 99 |
| 687 | 3300048926 | Ga0496123_0146817 | Ga0496123_0146817_177_491 | 99 |
| 688 | 3300048927 | Ga0496124_0000018 | Ga0496124_0000018_440515_440817 | 99 |
| 689 | 3300049571 | Ga0501034_0819040 | Ga0501034_0819040_59_358 | 99 |
| 690 | 3300050490 | nmdc:mga03n38_414165_c1 | nmdc:mga03n38_414165_c1_295_609 | 99 |
| 691 | 3300053142 | Ga0500577_0396206 | Ga0500577_0396206_27_341 | 99 |
| 692 | 3300053156 | Ga0500622_0431422 | Ga0500622_0431422_16_315 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6th6-assembly1.cif.gz_BW | cryo-em structure of t. kodakarensis 70s ribosome | 0.9503 | 8 | 92 |
| 6enj-assembly1.cif.gz_T | polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) | 0.9367 | 1 | 93 |
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9327 | 1 | 87 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9313 | 7 | 95 |
| 6spb-assembly1.cif.gz_T | pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 | 0.9305 | 5 | 94 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P54016_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9522 | 7 | 92 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9332 | 7 | 94 | 3.30.70.330 |
| af_D3ZFK7_36_158_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9229 | 7 | 92 | 3.30.70.330 |
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9222 | 1 | 93 | 3.30.70.330 |
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9117 | 1 | 93 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F8EU89-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9639 | 7 | 97 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-I0III7-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9633 | 7 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1F8H612-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9615 | 10 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2N6D798-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9614 | 7 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7Y5FJR9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.961 | 7 | 97 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar