F475597

General Info

Members Datasets Scaffolds Average Seq Length
692 410 671 99

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0059877|Ga0439449_0059877_876_1232
Length 118
Sequence MNTAVKSSADKGAASAPVRELAVNKLYNVIRAPRVSEKTARLQEVSNQYVFEVATDATKADIKIAIEKIFAVKVEAVNVVNVKGKQKAFKNRNGRRGDWRKAYVKLAEGQSIDVMARA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
4 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
5 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
6 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
7 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
8 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
9 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
10 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
11 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
12 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
13 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
14 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
15 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
16 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
17 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
18 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
19 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
20 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
21 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
32 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
37 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
38 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
39 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
42 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
61 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
65 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
100 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
101 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
105 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
106 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
107 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
108 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
109 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
110 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
111 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
198 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
199 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
200 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
201 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
202 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
203 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
204 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
205 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
206 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
222 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
225 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
226 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
230 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
231 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
234 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
237 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
238 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
239 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
240 3300041455 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaT Metatranscriptome Rhizoplane
241 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
242 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
243 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
244 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
245 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
246 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
247 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
248 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
249 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
250 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
251 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
252 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
253 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
254 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
255 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
256 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
257 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
258 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
259 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
260 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
261 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
262 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
263 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
264 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
265 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
266 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
267 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
268 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
269 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
270 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
275 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
276 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
279 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
280 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
314 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
315 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
356 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
357 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
358 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
359 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
360 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
361 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
362 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
363 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
364 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
365 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
366 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
367 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
368 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
369 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
370 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
371 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
372 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
373 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
374 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
375 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
376 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
377 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
378 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
379 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
380 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
381 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
382 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
383 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
384 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
385 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
386 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
387 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
388 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
389 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
390 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
391 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
392 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
393 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
394 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
395 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
396 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
401 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
402 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
403 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
404 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 81.79
Metatranscriptomes 15.17
Isolates 3.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.1
Nodule 0.14
Rhizoplane 4.05
Rhizosphere 81.5
Stem 0
Stem Tuber 0
Unclassified 5.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1598425 2162886007 Bacteria 810
2 SwRhRL2b_contig_332562 2162886007 Bacteria 944
3 JGI25150J39212_1000359 3300002774 Bacteria 22362
4 JGI25151J46595_10000895 3300003187 Bacteria 23452
5 JGI25151J46595_10007643 3300003187 Bacteria 5275
6 JGI25151J46595_10013580 3300003187 Bacteria 3661
7 JGI25153J46596_10000050 3300003215 Bacteria 140710
8 JGI25153J46596_10122190 3300003215 Bacteria 585
9 rootH2_10028426 3300003320 Bacteria 1049
10 rootH1_10139366 3300003323 Bacteria 1057
11 Ga0055526_1008987 3300003771 Bacteria 4886
12 Ga0055537_1001096 3300003773 Bacteria 11761
13 Ga0055524_1013602 3300003775 Bacteria 3064
14 Ga0055524_1015666 3300003775 Bacteria 2753
15 Ga0055536_1024910 3300003781 Bacteria 1719
16 Ga0055536_1040186 3300003781 Bacteria 1116
17 Ga0055534_1003331 3300003784 Bacteria 5088
18 Ga0055534_1006907 3300003784 Bacteria 2790
19 Ga0055528_1013611 3300003790 Bacteria 3070
20 Ga0055528_1016393 3300003790 Bacteria 2622
21 Ga0055530_10004966 3300003791 Bacteria 6579
22 Ga0055540_1029568 3300003792 Bacteria 1281
23 Ga0055531_10014020 3300003794 Bacteria 3645
24 Ga0055531_10014865 3300003794 Bacteria 3476
25 Ga0058692_1000785 3300003856 Bacteria 12735
26 Ga0058859_11549133 3300004798 Bacteria 563
27 Ga0058861_11921333 3300004800 Bacteria 1052
28 Ga0058860_11990960 3300004801 Bacteria 715
29 Ga0065714_10109302 3300005288 Bacteria 1502
30 Ga0065714_10289934 3300005288 Bacteria 702
31 Ga0065704_10006278 3300005289 Bacteria 2601
32 Ga0065704_10030623 3300005289 Bacteria 1342
33 Ga0065704_10253178 3300005289 Bacteria 984
34 Ga0065715_10047422 3300005293 Bacteria 894
35 Ga0065715_10471293 3300005293 Bacteria 798
36 Ga0065715_10670981 3300005293 Bacteria 668
37 Ga0070676_10167770 3300005328 Bacteria 1418
38 Ga0070683_100194209 3300005329 Bacteria 1927
39 Ga0070670_100143059 3300005331 Bacteria 2068
40 Ga0070677_10499576 3300005333 Bacteria 659
41 Ga0068869_100115364 3300005334 Bacteria 2048
42 Ga0070666_11107642 3300005335 Bacteria 589
43 Ga0070680_100255720 3300005336 Bacteria 1481
44 Ga0070660_100058257 3300005339 Bacteria 2994
45 Ga0070692_10305522 3300005345 Bacteria 973
46 Ga0070668_100303029 3300005347 Bacteria 1341
47 Ga0070668_100580531 3300005347 Bacteria 979
48 Ga0070675_100105895 3300005354 Bacteria 2373
49 Ga0070675_100213624 3300005354 Bacteria 1678
50 Ga0070675_100666145 3300005354 Bacteria 946
51 Ga0070671_100012931 3300005355 Bacteria 6725
52 Ga0070671_100202548 3300005355 Bacteria 1683
53 Ga0070674_100103259 3300005356 Bacteria 2081
54 Ga0070673_100209228 3300005364 Bacteria 1684
55 Ga0070659_100231145 3300005366 Bacteria 1528
56 Ga0070667_101042766 3300005367 Bacteria 764
57 Ga0070667_101847423 3300005367 Bacteria 569
58 Ga0070709_10133238 3300005434 Bacteria 1699
59 Ga0070713_100983439 3300005436 Bacteria 814
60 Ga0070711_101313524 3300005439 Bacteria 628
61 Ga0070700_101225275 3300005441 Bacteria 628
62 Ga0070700_101566992 3300005441 Bacteria 562
63 Ga0070700_101868106 3300005441 Bacteria 519
64 Ga0070663_100793081 3300005455 Bacteria 812
65 Ga0070663_101141416 3300005455 Bacteria 683
66 Ga0070662_100282610 3300005457 Bacteria 1343
67 Ga0070681_10205910 3300005458 Bacteria 1884
68 Ga0068867_100365570 3300005459 Bacteria 1208
69 Ga0068867_101380374 3300005459 Bacteria 653
70 Ga0070679_100385818 3300005530 Bacteria 1347
71 Ga0070679_100466934 3300005530 Bacteria 1206
72 Ga0070679_100661303 3300005530 Bacteria 987
73 Ga0070684_100843519 3300005535 Bacteria 857
74 Ga0068853_102313218 3300005539 Bacteria 521
75 Ga0070672_100087779 3300005543 Bacteria 2503
76 Ga0070672_100212901 3300005543 Bacteria 1619
77 Ga0070665_100152522 3300005548 Bacteria 2313
78 Ga0070665_100308958 3300005548 Bacteria 1584
79 Ga0070664_100483677 3300005564 Bacteria 1139
80 Ga0068857_100976059 3300005577 Bacteria 815
81 Ga0068856_100267129 3300005614 Bacteria 1727
82 Ga0068852_100147811 3300005616 Bacteria 2182
83 Ga0068852_100675721 3300005616 Bacteria 1042
84 Ga0068859_100714138 3300005617 Bacteria 1093
85 Ga0068866_10285085 3300005718 Bacteria 1025
86 Ga0068861_101093583 3300005719 Bacteria 766
87 Ga0068861_101325492 3300005719 Bacteria 701
88 Ga0068870_10201962 3300005840 Bacteria 1206
89 Ga0068870_10298836 3300005840 Bacteria 1016
90 Ga0068870_11106647 3300005840 Bacteria 570
91 Ga0068860_101372426 3300005843 Bacteria 728
92 Ga0068862_100564998 3300005844 Bacteria 1088
93 Ga0081539_10024522 3300005985 Bacteria 3909
94 Ga0081539_10412345 3300005985 Bacteria 561
95 Ga0075363_100330491 3300006048 Bacteria 888
96 Ga0075363_100484729 3300006048 Bacteria 733
97 Ga0075364_10738799 3300006051 Bacteria 671
98 Ga0075362_10516426 3300006177 Bacteria 612
99 Ga0075369_10150290 3300006186 Bacteria 1064
100 Ga0075369_10383019 3300006186 Bacteria 662
101 Ga0075369_10392157 3300006186 Bacteria 654
102 Ga0075366_10356136 3300006195 Bacteria 899
103 Ga0097621_100195694 3300006237 Bacteria 1753
104 Ga0075430_101363114 3300006846 Bacteria 583
105 Ga0097620_100714087 3300006931 Bacteria 1093
106 Ga0105244_10048884 3300009036 Bacteria 2163
107 Ga0105244_10438164 3300009036 Bacteria 601
108 Ga0105240_10265037 3300009093 Bacteria 1980
109 Ga0114129_11321426 3300009147 Bacteria 893
110 Ga0105243_10036695 3300009148 Bacteria 3806
111 Ga0105248_10864655 3300009177 Bacteria 1021
112 Ga0105248_11070887 3300009177 Bacteria 911
113 Ga0105248_12850805 3300009177 Bacteria 551
114 Ga0105237_10517711 3300009545 Bacteria 1199
115 Ga0105238_11245780 3300009551 Bacteria 769
116 Ga0105249_11545416 3300009553 Bacteria 736
117 Ga0105148_105283 3300009978 Bacteria 930
118 Ga0105032_100517 3300009979 Bacteria 3853
119 Ga0105028_105506 3300009993 Bacteria 1315
120 Ga0105239_10078930 3300010375 Bacteria 3622
121 Ga0105246_12229086 3300011119 Bacteria 534
122 Ga0157328_1029174 3300012478 Bacteria 513
123 Ga0157318_1005289 3300012482 Bacteria 815
124 Ga0157343_1000309 3300012488 Bacteria 1875
125 Ga0157322_1011551 3300012490 Bacteria 730
126 Ga0157323_1018551 3300012495 Bacteria 639
127 Ga0157314_1020158 3300012500 Bacteria 673
128 Ga0157342_1054705 3300012507 Bacteria 571
129 Ga0157327_1024845 3300012512 Bacteria 705
130 Ga0157373_10142986 3300013100 Bacteria 1683
131 Ga0157371_10083622 3300013102 Bacteria 2260
132 Ga0157371_10440463 3300013102 Bacteria 957
133 Ga0157370_10464246 3300013104 Bacteria 1163
134 Ga0157370_11219759 3300013104 Bacteria 678
135 Ga0157369_10312189 3300013105 Bacteria 1635
136 Ga0157374_10365321 3300013296 Bacteria 1436
137 Ga0157374_11148881 3300013296 Bacteria 797
138 Ga0157374_12286767 3300013296 Bacteria 568
139 Ga0157378_12618515 3300013297 Bacteria 557
140 Ga0163162_10694593 3300013306 Bacteria 1139
141 Ga0163162_10726495 3300013306 Bacteria 1114
142 Ga0163162_11097464 3300013306 Bacteria 901
143 Ga0157372_11124837 3300013307 Bacteria 908
144 Ga0157375_10045770 3300013308 Bacteria 4260
145 Ga0157375_10377773 3300013308 Bacteria 1584
146 Ga0157375_10609150 3300013308 Bacteria 1251
147 Ga0163163_11264080 3300014325 Bacteria 800
148 Ga0182008_10183346 3300014497 Bacteria 1060
149 Ga0182008_10379025 3300014497 Bacteria 756
150 Ga0157377_10561482 3300014745 Bacteria 808
151 Ga0157376_10315852 3300014969 Bacteria 1484
152 Ga0163161_10172112 3300017792 Bacteria 1656
153 Ga0163161_10348494 3300017792 Bacteria 1177
154 Ga0206349_1852705 3300020075 Bacteria 1928
155 Ga0207425_1000117 3300025245 Bacteria 74911
156 Ga0207425_1005550 3300025245 Bacteria 3581
157 Ga0207425_1048016 3300025245 Bacteria 789
158 Ga0209129_1000011 3300025258 Bacteria 568657
159 Ga0209565_1000001 3300025263 Bacteria 2950419
160 Ga0209565_1055030 3300025263 Bacteria 703
161 Ga0209673_1000001 3300025273 Bacteria 3176258
162 Ga0209673_1002116 3300025273 Bacteria 14881
163 Ga0209130_1007816 3300025284 Bacteria 3243
164 Ga0209675_1000001 3300025291 Bacteria 2950293
165 Ga0209675_1006904 3300025291 Bacteria 4460
166 Ga0209676_1001608 3300025292 Bacteria 20029
167 Ga0209676_1004379 3300025292 Bacteria 7893
168 Ga0209676_1004892 3300025292 Bacteria 7229
169 Ga0209025_1000002 3300025294 Bacteria 1393142
170 Ga0209025_1000006 3300025294 Bacteria 1153444
171 Ga0209025_1099920 3300025294 Bacteria 921
172 Ga0209025_1150246 3300025294 Bacteria 644
173 Ga0209564_1000001 3300025295 Bacteria 3176258
174 Ga0209564_1007141 3300025295 Bacteria 5828
175 Ga0209758_1000003 3300025297 Bacteria 1398533
176 Ga0209758_1035768 3300025297 Bacteria 1952
177 Ga0209050_1001128 3300025298 Bacteria 32216
178 Ga0209050_1025712 3300025298 Bacteria 1992
179 Ga0209256_1000002 3300025299 Bacteria 1906740
180 Ga0209256_1003821 3300025299 Bacteria 10090
181 Ga0207426_1068355 3300025302 Bacteria 999
182 Ga0209051_1028616 3300025303 Bacteria 2197
183 Ga0209257_1002665 3300025304 Bacteria 17133
184 Ga0209257_1005259 3300025304 Bacteria 9234
185 Ga0209257_1006382 3300025304 Bacteria 7632
186 Ga0207697_10049742 3300025315 Bacteria 1730
187 Ga0207655_1039647 3300025728 Bacteria 2042
188 Ga0207682_10231592 3300025893 Bacteria 857
189 Ga0207642_10720688 3300025899 Bacteria 630
190 Ga0207645_10107422 3300025907 Bacteria 1805
191 Ga0207645_10245072 3300025907 Bacteria 1185
192 Ga0207643_10160910 3300025908 Bacteria 1351
193 Ga0207705_10060885 3300025909 Bacteria 2727
194 Ga0207707_10277754 3300025912 Bacteria 1451
195 Ga0207660_10779635 3300025917 Bacteria 780
196 Ga0207660_11681271 3300025917 Bacteria 511
197 Ga0207657_10006384 3300025919 Bacteria 12243
198 Ga0207649_10300149 3300025920 Bacteria 1174
199 Ga0207652_10097888 3300025921 Bacteria 2586
200 Ga0207681_10278322 3300025923 Bacteria 1316
201 Ga0207694_11565903 3300025924 Bacteria 556
202 Ga0207694_11706001 3300025924 Bacteria 530
203 Ga0207650_10175272 3300025925 Bacteria 1706
204 Ga0207650_11050256 3300025925 Bacteria 693
205 Ga0207659_10442633 3300025926 Bacteria 1093
206 Ga0207659_10621832 3300025926 Bacteria 922
207 Ga0207659_10897028 3300025926 Bacteria 762
208 Ga0207644_10011422 3300025931 Bacteria 5875
209 Ga0207644_11169679 3300025931 Bacteria 646
210 Ga0207644_11351237 3300025931 Bacteria 599
211 Ga0207644_11880265 3300025931 Bacteria 500
212 Ga0207690_10954289 3300025932 Bacteria 712
213 Ga0207706_10239882 3300025933 Bacteria 1585
214 Ga0207709_10000421 3300025935 Bacteria 41092
215 Ga0207669_10076663 3300025937 Bacteria 2123
216 Ga0207691_10076483 3300025940 Bacteria 3016
217 Ga0207691_10107616 3300025940 Bacteria 2482
218 Ga0207711_10147290 3300025941 Bacteria 2122
219 Ga0207711_11110061 3300025941 Bacteria 732
220 Ga0207667_11962249 3300025949 Bacteria 546
221 Ga0207651_10648699 3300025960 Bacteria 927
222 Ga0207668_10071707 3300025972 Bacteria 2475
223 Ga0207668_10160776 3300025972 Bacteria 1750
224 Ga0207640_12022250 3300025981 Bacteria 522
225 Ga0207639_11174982 3300026041 Bacteria 720
226 Ga0207678_10202573 3300026067 Bacteria 1697
227 Ga0207678_10590558 3300026067 Bacteria 973
228 Ga0207708_10419749 3300026075 Bacteria 1109
229 Ga0207708_10543507 3300026075 Bacteria 979
230 Ga0207702_11405688 3300026078 Bacteria 692
231 Ga0207648_10084850 3300026089 Bacteria 2762
232 Ga0207674_10301096 3300026116 Bacteria 1552
233 Ga0207675_100966302 3300026118 Bacteria 870
234 Ga0207675_102037818 3300026118 Bacteria 591
235 Ga0207683_10335929 3300026121 Bacteria 1385
236 Ga0207698_10196978 3300026142 Bacteria 1800
237 Ga0207698_10450120 3300026142 Bacteria 1243
238 Ga0209973_1001982 3300027252 Bacteria 1860
239 Ga0209371_1000004 3300027312 Bacteria 1098197
240 Ga0209969_1000918 3300027360 Bacteria 3988
241 Ga0209967_1002362 3300027364 Bacteria 2443
242 Ga0209967_1009133 3300027364 Bacteria 1372
243 Ga0209981_1010702 3300027378 Bacteria 1260
244 Ga0209984_1000306 3300027424 Bacteria 5580
245 Ga0209984_1067854 3300027424 Bacteria 531
246 Ga0210000_1004942 3300027462 Bacteria 1931
247 Ga0209995_1000770 3300027471 Bacteria 4923
248 Ga0209968_1017243 3300027526 Bacteria 1151
249 Ga0209999_1020896 3300027543 Bacteria 1202
250 Ga0209982_1000032 3300027552 Bacteria 12541
251 Ga0209982_1031999 3300027552 Bacteria 828
252 Ga0209970_1035823 3300027614 Bacteria 873
253 Ga0210002_1002375 3300027617 Bacteria 2717
254 Ga0210002_1017845 3300027617 Bacteria 1132
255 Ga0209983_1000295 3300027665 Bacteria 10386
256 Ga0209971_1000410 3300027682 Bacteria 11534
257 Ga0209974_10010367 3300027876 Bacteria 3144
258 Ga0209974_10074748 3300027876 Bacteria 1160
259 Ga0268266_10168036 3300028379 Bacteria 1989
260 Ga0268266_10170446 3300028379 Bacteria 1975
261 Ga0268265_10377972 3300028380 Bacteria 1302
262 Ga0268264_10786813 3300028381 Bacteria 950
263 Ga0311001_1058661 3300029277 Bacteria 788
264 Ga0268256_1000005 3300030500 Bacteria 1082342
265 Ga0316177_1006784 3300030731 Bacteria 1565
266 Ga0316176_1213588 3300030732 Bacteria 1389
267 Ga0314311_1263094 3300030733 Bacteria 1663
268 Ga0316178_1178759 3300030735 Bacteria 1029
269 Ga0316180_1161841 3300030736 Bacteria 1095
270 Ga0316183_1156957 3300030742 Bacteria 972
271 Ga0316181_1110680 3300030744 Bacteria 690
272 Ga0316182_1151288 3300030745 Bacteria 2446
273 Ga0316182_1157126 3300030745 Bacteria 593
274 Ga0316182_1184990 3300030745 Bacteria 909
275 Ga0316182_1187071 3300030745 Bacteria 847
276 Ga0307408_100181171 3300031548 Bacteria 1689
277 Ga0307408_101601202 3300031548 Bacteria 618
278 Ga0307405_10142144 3300031731 Bacteria 1675
279 Ga0307405_11468755 3300031731 Bacteria 598
280 Ga0307405_12142146 3300031731 Bacteria 502
281 Ga0307413_10037133 3300031824 Bacteria 2811
282 Ga0307413_10047867 3300031824 Bacteria 2552
283 Ga0307413_10279926 3300031824 Bacteria 1254
284 Ga0307413_10517385 3300031824 Bacteria 961
285 Ga0307413_10778113 3300031824 Bacteria 802
286 Ga0307413_10991576 3300031824 Bacteria 719
287 Ga0307413_11006848 3300031824 Bacteria 714
288 Ga0307410_10028499 3300031852 Bacteria 3543
289 Ga0307410_10427645 3300031852 Bacteria 1075
290 Ga0307406_10094886 3300031901 Bacteria 2017
291 Ga0307406_10346198 3300031901 Bacteria 1159
292 Ga0307406_10874309 3300031901 Bacteria 763
293 Ga0307407_10034741 3300031903 Bacteria 2763
294 Ga0307412_10042944 3300031911 Bacteria 2941
295 Ga0307412_10311553 3300031911 Bacteria 1248
296 Ga0307412_10346875 3300031911 Bacteria 1190
297 Ga0307412_10401326 3300031911 Bacteria 1116
298 Ga0307412_11190223 3300031911 Bacteria 682
299 Ga0307412_11208676 3300031911 Bacteria 677
300 Ga0307409_100024348 3300031995 Bacteria 4220
301 Ga0307409_100767138 3300031995 Bacteria 969
302 Ga0307409_101512416 3300031995 Bacteria 699
303 Ga0307409_101575233 3300031995 Bacteria 685
304 Ga0307416_100404694 3300032002 Bacteria 1403
305 Ga0307416_101510611 3300032002 Bacteria 777
306 Ga0307416_103563832 3300032002 Bacteria 521
307 Ga0307414_10002120 3300032004 Bacteria 10346
308 Ga0307414_10007179 3300032004 Bacteria 6251
309 Ga0307414_10020644 3300032004 Bacteria 4110
310 Ga0307414_10046872 3300032004 Bacteria 2970
311 Ga0307414_10063463 3300032004 Bacteria 2625
312 Ga0307414_10234802 3300032004 Bacteria 1514
313 Ga0307414_10448284 3300032004 Bacteria 1131
314 Ga0307414_10697965 3300032004 Bacteria 918
315 Ga0307414_10785321 3300032004 Bacteria 867
316 Ga0307414_11060873 3300032004 Bacteria 747
317 Ga0307414_11297263 3300032004 Bacteria 675
318 Ga0307411_10015295 3300032005 Bacteria 4303
319 Ga0307411_10041490 3300032005 Bacteria 2928
320 Ga0307411_10862437 3300032005 Bacteria 802
321 Ga0307411_11078775 3300032005 Bacteria 723
322 Ga0307411_11292060 3300032005 Bacteria 664
323 Ga0307411_11554591 3300032005 Bacteria 609
324 Ga0307415_100292343 3300032126 Bacteria 1345
325 Ga0307415_100759180 3300032126 Bacteria 881
326 Ga0373950_0094669 3300034818 Bacteria 637
327 Ga0373943_0487907 3300035170 Bacteria 719
328 Ga0373931_1024699 3300035691 Bacteria 559
329 Ga0373935_1312547 3300035692 Bacteria 540
330 Ga0373933_0611407 3300035724 Bacteria 716
331 Ga0395899_0093693 3300037312 Bacteria 2174
332 Ga0395900_0036642 3300037418 Bacteria 5057
333 Ga0395900_0241648 3300037418 Bacteria 1811
334 Ga0395898_0180698 3300037466 Bacteria 2016
335 Ga0395905_0110752 3300037471 Bacteria 2578
336 Ga0395905_0293167 3300037471 Bacteria 1514
337 Ga0395905_0753127 3300037471 Bacteria 876
338 Ga0395905_1623580 3300037471 Bacteria 551
339 Ga0395901_0276971 3300038443 Bacteria 1744
340 Ga0395901_1553089 3300038443 Bacteria 616
341 Ga0237819_00026 3300038705 Bacteria 50539
342 Ga0237819_05137 3300038705 Bacteria 2080
343 Ga0237816_00020 3300039145 Bacteria 9419
344 Ga0439436_0005214 3300041404 Bacteria 3978
345 Ga0439436_0009292 3300041404 Bacteria 3013
346 Ga0439436_0020558 3300041404 Bacteria 1966
347 Ga0439436_0044395 3300041404 Bacteria 1266
348 Ga0439436_0195246 3300041404 Bacteria 578
349 Ga0439439_0004561 3300041406 Bacteria 3133
350 Ga0439447_013961 3300041407 Bacteria 2264
351 Ga0439466_0112396 3300041411 Bacteria 844
352 Ga0439465_0005524 3300041413 Bacteria 4031
353 Ga0439465_0009954 3300041413 Bacteria 2993
354 Ga0439465_0045155 3300041413 Bacteria 1432
355 Ga0439465_0054861 3300041413 Bacteria 1311
356 Ga0439465_0169776 3300041413 Bacteria 785
357 Ga0439465_0329805 3300041413 Bacteria 574
358 Ga0451789_0611670 3300041443 Bacteria 914
359 Ga0451791_0348064 3300041451 Bacteria 1287
360 Ga0451793_0649292 3300041452 Unclassified 543
361 Ga0451793_1022662 3300041452 Bacteria 1172
362 Ga0451797_0495586 3300041453 Bacteria 628
363 Ga0451797_0542817 3300041453 Bacteria 891
364 Ga0451801_10668 3300041455 Bacteria 569
365 Ga0451795_1206484 3300041456 Bacteria 985
366 Ga0451798_0378261 3300041458 Bacteria 1024
367 Ga0451800_0237753 3300041459 Bacteria 1137
368 Ga0451802_0845033 3300041460 Bacteria 861
369 Ga0451802_0845984 3300041460 Bacteria 673
370 Ga0451802_0882002 3300041460 Bacteria 1116
371 Ga0451802_1892135 3300041460 Bacteria 797
372 Ga0451805_021755 3300041461 Bacteria 872
373 Ga0451805_060263 3300041461 Bacteria 752
374 Ga0451804_0354493 3300041463 Bacteria 624
375 Ga0451835_0031836 3300041492 Bacteria 623
376 Ga0451837_0144598 3300041494 Bacteria 667
377 Ga0451837_0822369 3300041494 Bacteria 1529
378 Ga0451839_0879567 3300041496 Bacteria 817
379 Ga0451840_04882 3300041497 Bacteria 550
380 Ga0451841_0137401 3300041498 Bacteria 1060
381 Ga0451845_0710242 3300041501 Bacteria 782
382 Ga0451843_0901379 3300041509 Bacteria 851
383 Ga0451853_0501935 3300041512 Bacteria 653
384 Ga0451853_2452886 3300041512 Bacteria 1202
385 Ga0439431_0008628 3300041997 Bacteria 2294
386 Ga0439431_0172541 3300041997 Bacteria 622
387 Ga0439433_0016339 3300041999 Bacteria 1644
388 Ga0439433_0043496 3300041999 Bacteria 1049
389 Ga0439433_0051959 3300041999 Bacteria 968
390 Ga0439433_0071138 3300041999 Bacteria 838
391 Ga0439445_0022958 3300042004 Bacteria 1576
392 Ga0439445_0109731 3300042004 Bacteria 787
393 Ga0439448_0105629 3300042005 Bacteria 959
394 Ga0439432_044052 3300042006 Bacteria 1406
395 Ga0439432_088427 3300042006 Bacteria 934
396 Ga0439432_145403 3300042006 Bacteria 696
397 Ga0439449_0011871 3300042007 Bacteria 3274
398 Ga0439449_0039601 3300042007 Bacteria 1752
399 Ga0439449_0047245 3300042007 Bacteria 1594
400 Ga0439449_0050566 3300042007 Bacteria 1537
401 Ga0439449_0052843 3300042007 Bacteria 1502
402 Ga0439449_0059877 3300042007 Bacteria 1405
403 Ga0439449_0238816 3300042007 Bacteria 682
404 Ga0439452_043990 3300042010 Bacteria 1043
405 Ga0439452_125502 3300042010 Bacteria 545
406 Ga0439455_0094324 3300042012 Bacteria 823
407 Ga0439457_033336 3300042014 Bacteria 1143
408 Ga0439457_165578 3300042014 Bacteria 536
409 Ga0439462_0027568 3300042015 Bacteria 1499
410 Ga0439462_0082925 3300042015 Bacteria 876
411 Ga0450903_045815 3300042138 Bacteria 644
412 Ga0439446_0036071 3300042156 Bacteria 1444
413 Ga0439434_0363768 3300042435 Bacteria 506
414 Ga0466960_0601199 3300044901 Bacteria 653
415 Ga0466958_1166693 3300045836 Bacteria 503
416 Ga0466967_2375292 3300045976 Bacteria 525
417 Ga0495606_0035985 3300046507 Bacteria 3378
418 Ga0495610_0236940 3300046512 Bacteria 729
419 Ga0495610_0251536 3300046512 Bacteria 700
420 Ga0495616_0270579 3300046513 Bacteria 724
421 Ga0495631_0154725 3300046518 Bacteria 984
422 Ga0495663_0004473 3300046525 Bacteria 3926
423 Ga0495663_0051919 3300046525 Bacteria 1272
424 Ga0495663_0063370 3300046525 Bacteria 1165
425 Ga0495663_0135103 3300046525 Bacteria 834
426 Ga0495663_0135107 3300046525 Bacteria 834
427 Ga0495663_0330149 3300046525 Bacteria 553
428 Ga0495598_0126189 3300046537 Bacteria 873
429 Ga0495598_0158612 3300046537 Bacteria 794
430 Ga0495598_0293813 3300046537 Bacteria 613
431 Ga0495621_0001470 3300046539 Bacteria 6111
432 Ga0495621_0084120 3300046539 Bacteria 1190
433 Ga0495621_0225644 3300046539 Bacteria 759
434 Ga0495621_0263312 3300046539 Bacteria 707
435 Ga0495621_0294762 3300046539 Bacteria 671
436 Ga0495633_0318237 3300046558 Bacteria 706
437 Ga0495656_0004814 3300046615 Bacteria 4645
438 Ga0495656_0140966 3300046615 Bacteria 1156
439 Ga0495668_0033171 3300046616 Bacteria 2901
440 Ga0495668_0078857 3300046616 Bacteria 1808
441 Ga0495625_0591950 3300046660 Bacteria 667
442 Ga0495659_0087343 3300046664 Bacteria 1192
443 Ga0495659_0112299 3300046664 Bacteria 1065
444 Ga0495659_0370808 3300046664 Bacteria 614
445 Ga0495588_0423553 3300046674 Bacteria 699
446 Ga0495670_0101413 3300046691 Bacteria 1482
447 Ga0495670_0342267 3300046691 Bacteria 804
448 Ga0495670_0495645 3300046691 Bacteria 663
449 Ga0495671_0368709 3300046692 Bacteria 688
450 Ga0495636_0052343 3300047318 Bacteria 1712
451 Ga0495636_0121083 3300047318 Bacteria 1157
452 Ga0495636_0258130 3300047318 Bacteria 807
453 Ga0495636_0613476 3300047318 Bacteria 532
454 Ga0495677_0145086 3300047445 Bacteria 912
455 Ga0495685_061912 3300047447 Bacteria 1260
456 Ga0495681_0124862 3300047470 Bacteria 1101
457 Ga0496100_0389538 3300048903 Bacteria 1059
458 Ga0496101_0223296 3300048904 Bacteria 1462
459 Ga0496102_1169225 3300048905 Bacteria 689
460 Ga0496108_0100619 3300048911 Bacteria 2465
461 Ga0496108_0557978 3300048911 Bacteria 999
462 Ga0496109_0062064 3300048912 Bacteria 3417
463 Ga0496109_0387077 3300048912 Bacteria 1321
464 Ga0496110_1123034 3300048913 Bacteria 694
465 Ga0496112_0025726 3300048915 Bacteria 5652
466 Ga0496113_0067298 3300048916 Bacteria 2715
467 Ga0496115_0367309 3300048918 Bacteria 1172
468 Ga0496121_0005001 3300048924 Bacteria 17352
469 Ga0496122_0097842 3300048925 Bacteria 1973
470 Ga0496123_0146817 3300048926 Bacteria 1279
471 Ga0496124_0000018 3300048927 Bacteria 442940
472 Ga0501306_005581 3300049127 Bacteria 1448
473 Ga0501306_005642 3300049127 Bacteria 1444
474 Ga0501306_017111 3300049127 Bacteria 980
475 Ga0501306_026148 3300049127 Bacteria 844
476 Ga0501306_056469 3300049127 Bacteria 640
477 Ga0501306_086653 3300049127 Bacteria 546
478 Ga0501308_000035 3300049128 Bacteria 5438
479 Ga0501308_005875 3300049128 Bacteria 1240
480 Ga0501308_011241 3300049128 Bacteria 1006
481 Ga0501309_012417 3300049129 Bacteria 1122
482 Ga0501309_041481 3300049129 Bacteria 704
483 Ga0501309_047735 3300049129 Bacteria 667
484 Ga0501310_000986 3300049130 Bacteria 2538
485 Ga0501310_007734 3300049130 Bacteria 1153
486 Ga0501310_010671 3300049130 Bacteria 1029
487 Ga0501341_01557 3300049131 Bacteria 1159
488 Ga0501345_03043 3300049134 Bacteria 712
489 Ga0501304_000987 3300049160 Bacteria 1702
490 Ga0501304_004356 3300049160 Bacteria 1073
491 Ga0501305_001649 3300049161 Bacteria 2241
492 Ga0501305_007764 3300049161 Bacteria 1371
493 Ga0501305_024565 3300049161 Bacteria 909
494 Ga0501305_025801 3300049161 Bacteria 893
495 Ga0501305_051082 3300049161 Bacteria 694
496 Ga0501307_000579 3300049162 Bacteria 2601
497 Ga0501307_006548 3300049162 Bacteria 1262
498 Ga0501307_028221 3300049162 Bacteria 766
499 Ga0501307_028729 3300049162 Bacteria 762
500 Ga0501307_030527 3300049162 Bacteria 745
501 Ga0501307_035371 3300049162 Bacteria 709
502 Ga0501342_04097 3300049163 Bacteria 530
503 Ga0501291_106770 3300049514 Bacteria 591
504 Ga0501298_092911 3300049521 Bacteria 678
505 Ga0501311_003051 3300049527 Bacteria 1672
506 Ga0501311_022011 3300049527 Bacteria 873
507 Ga0501312_002244 3300049528 Bacteria 2061
508 Ga0501312_002447 3300049528 Bacteria 2006
509 Ga0501312_077752 3300049528 Bacteria 597
510 Ga0501312_079207 3300049528 Bacteria 592
511 Ga0501313_003322 3300049529 Bacteria 1592
512 Ga0501313_040858 3300049529 Bacteria 623
513 Ga0501314_007283 3300049530 Bacteria 979
514 Ga0501314_014003 3300049530 Bacteria 782
515 Ga0501315_000712 3300049531 Bacteria 2463
516 Ga0501315_004415 3300049531 Bacteria 1470
517 Ga0501315_040976 3300049531 Bacteria 701
518 Ga0501315_086517 3300049531 Bacteria 538
519 Ga0501316_004177 3300049532 Bacteria 1439
520 Ga0501316_025268 3300049532 Bacteria 771
521 Ga0501316_052158 3300049532 Bacteria 591
522 Ga0501317_001762 3300049533 Bacteria 1934
523 Ga0501317_006218 3300049533 Bacteria 1304
524 Ga0501317_010657 3300049533 Bacteria 1103
525 Ga0501317_056682 3300049533 Bacteria 635
526 Ga0501318_000528 3300049534 Bacteria 2495
527 Ga0501318_035161 3300049534 Bacteria 697
528 Ga0501318_049310 3300049534 Bacteria 622
529 Ga0501318_063123 3300049534 Bacteria 572
530 Ga0501319_000070 3300049535 Bacteria 3471
531 Ga0501319_008492 3300049535 Bacteria 792
532 Ga0501320_003674 3300049536 Bacteria 1315
533 Ga0501320_008783 3300049536 Bacteria 1001
534 Ga0501321_005366 3300049537 Bacteria 1264
535 Ga0501321_007845 3300049537 Bacteria 1118
536 Ga0501321_013367 3300049537 Bacteria 942
537 Ga0501321_038133 3300049537 Bacteria 667
538 Ga0501322_004912 3300049538 Bacteria 913
539 Ga0501323_000068 3300049539 Bacteria 5160
540 Ga0501323_000101 3300049539 Bacteria 4591
541 Ga0501323_033218 3300049539 Bacteria 732
542 Ga0501323_050181 3300049539 Bacteria 631
543 Ga0501323_056670 3300049539 Bacteria 605
544 Ga0501324_000043 3300049540 Bacteria 4242
545 Ga0501324_010732 3300049540 Bacteria 838
546 Ga0501324_020298 3300049540 Bacteria 676
547 Ga0501324_025706 3300049540 Bacteria 622
548 Ga0501325_003096 3300049541 Bacteria 1189
549 Ga0501325_008060 3300049541 Bacteria 906
550 Ga0501329_02559 3300049545 Bacteria 878
551 Ga0501330_003224 3300049546 Bacteria 963
552 Ga0501331_10925 3300049547 Bacteria 570
553 Ga0501332_05628 3300049548 Bacteria 772
554 Ga0501333_006796 3300049549 Bacteria 766
555 Ga0501334_08151 3300049550 Bacteria 731
556 Ga0501336_003033 3300049552 Bacteria 1112
557 Ga0501336_031496 3300049552 Bacteria 523
558 Ga0501337_016844 3300049553 Bacteria 573
559 Ga0501338_06754 3300049554 Bacteria 730
560 Ga0501340_005822 3300049556 Bacteria 813
561 Ga0501340_011706 3300049556 Bacteria 657
562 Ga0501340_012965 3300049556 Bacteria 638
563 Ga0501340_019503 3300049556 Bacteria 561
564 Ga0501031_0025141 3300049568 Bacteria 3884
565 Ga0501031_0101188 3300049568 Bacteria 1880
566 Ga0501031_0301992 3300049568 Bacteria 1037
567 Ga0501032_0217693 3300049569 Bacteria 1243
568 Ga0501032_0675160 3300049569 Bacteria 655
569 Ga0501033_0123272 3300049570 Bacteria 1879
570 Ga0501033_0301675 3300049570 Bacteria 1127
571 Ga0501034_0021966 3300049571 Bacteria 6502
572 Ga0501034_0120372 3300049571 Bacteria 2611
573 Ga0501034_0376789 3300049571 Bacteria 1344
574 Ga0501034_0395735 3300049571 Bacteria 1305
575 Ga0501034_0819040 3300049571 Bacteria 823
576 Ga0501034_0880349 3300049571 Bacteria 784
577 Ga0501036_0066357 3300049572 Bacteria 3053
578 Ga0501036_0660103 3300049572 Bacteria 865
579 Ga0501037_0021232 3300049573 Bacteria 4797
580 Ga0501037_0340564 3300049573 Bacteria 1036
581 Ga0501037_0493195 3300049573 Bacteria 831
582 Ga0501038_0002396 3300049574 Bacteria 17463
583 Ga0501038_0026720 3300049574 Bacteria 5139
584 Ga0501039_0013271 3300049575 Bacteria 6300
585 Ga0501039_0366055 3300049575 Bacteria 1132
586 Ga0501043_0030616 3300049579 Bacteria 4230
587 Ga0501043_0326832 3300049579 Bacteria 1168
588 Ga0501043_0571857 3300049579 Bacteria 837
589 Ga0501046_0534208 3300049580 Bacteria 837
590 Ga0501046_0786563 3300049580 Bacteria 667
591 Ga0501047_0059275 3300049581 Bacteria 3696
592 Ga0501047_0221275 3300049581 Bacteria 1749
593 Ga0501048_0538607 3300049582 Bacteria 838
594 Ga0501048_0581196 3300049582 Bacteria 804
595 Ga0501068_0639040 3300049584 Bacteria 694
596 Ga0501070_0016046 3300049586 Bacteria 6294
597 Ga0501070_0198353 3300049586 Bacteria 1648
598 Ga0501071_0037161 3300049587 Bacteria 3476
599 Ga0501073_0068309 3300049589 Bacteria 2477
600 Ga0501198_053502 3300049649 Bacteria 724
601 Ga0501202_018155 3300049652 Bacteria 1379
602 Ga0501202_037238 3300049652 Bacteria 1038
603 Ga0501206_040475 3300049653 Bacteria 717
604 Ga0501209_138327 3300049656 Bacteria 729
605 Ga0501211_031447 3300049658 Bacteria 600
606 Ga0501216_023017 3300049660 Bacteria 1105
607 Ga0501216_093466 3300049660 Bacteria 653
608 Ga0501217_048551 3300049661 Bacteria 1102
609 Ga0501222_041128 3300049662 Bacteria 657
610 Ga0501223_032298 3300049663 Bacteria 1018
611 Ga0501223_046989 3300049663 Bacteria 837
612 Ga0501224_021838 3300049664 Bacteria 954
613 Ga0501227_172799 3300049665 Bacteria 605
614 Ga0501235_189123 3300049669 Bacteria 552
615 Ga0501238_077425 3300049671 Bacteria 521
616 Ga0501239_002487 3300049672 Bacteria 1676
617 Ga0501239_018174 3300049672 Bacteria 843
618 Ga0501240_014783 3300049673 Bacteria 1101
619 Ga0501242_009218 3300049674 Bacteria 1165
620 Ga0501242_033541 3300049674 Bacteria 703
621 Ga0501249_021629 3300049679 Bacteria 1404
622 Ga0501250_043409 3300049680 Bacteria 667
623 Ga0501250_046574 3300049680 Bacteria 653
624 Ga0501251_029671 3300049681 Bacteria 773
625 Ga0501252_000295 3300049682 Bacteria 3545
626 Ga0501252_008250 3300049682 Bacteria 1194
627 Ga0501253_058558 3300049683 Bacteria 824
628 Ga0501253_075856 3300049683 Bacteria 750
629 Ga0501257_049116 3300049686 Bacteria 1049
630 Ga0501259_015715 3300049688 Bacteria 1295
631 Ga0501259_119797 3300049688 Bacteria 624
632 Ga0501221_070592 3300049704 Bacteria 824
633 Ga0501225_0045508 3300049705 Bacteria 1215
634 Ga0501225_0065537 3300049705 Bacteria 1026
635 Ga0501225_0091312 3300049705 Bacteria 882
636 Ga0501079_0672563 3300049741 Bacteria 815
637 Ga0501080_0018310 3300049742 Bacteria 6482
638 Ga0501232_028687 3300049757 Bacteria 761
639 Ga0501241_033359 3300049758 Bacteria 978
640 Ga0501263_004493 3300049760 Bacteria 1541
641 Ga0501263_022755 3300049760 Bacteria 851
642 Ga0501265_051682 3300049762 Bacteria 648
643 Ga0501266_006012 3300049763 Bacteria 1507
644 Ga0501266_012196 3300049763 Bacteria 1106
645 Ga0501268_015441 3300049765 Bacteria 1255
646 Ga0501268_026172 3300049765 Bacteria 1029
647 Ga0501269_009447 3300049766 Bacteria 1183
648 Ga0501270_002142 3300049767 Bacteria 1992
649 Ga0501270_105993 3300049767 Bacteria 593
650 Ga0501272_044853 3300049769 Bacteria 600
651 Ga0501274_014849 3300049771 Bacteria 759
652 Ga0501275_005782 3300049772 Bacteria 1197
653 Ga0501279_047734 3300049775 Bacteria 672
654 Ga0501282_022380 3300049778 Bacteria 698
655 Ga0501283_105997 3300049779 Bacteria 551
656 Ga0501035_0003746 3300049822 Bacteria 14504
657 Ga0501035_0039431 3300049822 Bacteria 4274
658 Ga0501044_0003730 3300049823 Bacteria 17110
659 Ga0501044_0154075 3300049823 Bacteria 2278
660 Ga0501045_0352529 3300049824 Bacteria 1095
661 Ga0501204_065782 3300049850 Bacteria 587
662 nmdc:mga03n38_414165_c1 3300050490 Bacteria 744
663 nmdc:mga03n38_880097_c1 3300050490 Bacteria 525
664 Ga0500577_0396206 3300053142 Bacteria 604
665 Ga0500622_0431422 3300053156 Bacteria 528
666 Ga0587088_127429 3300059508 Bacteria 595
667 Ga0587090_008934 3300059510 Bacteria 1356
668 Ga0587062_036448 3300059639 Bacteria 779
669 Ga0587069_027263 3300059642 Bacteria 900
670 Ga0587079_118289 3300059647 Bacteria 652
671 Ga0587071_055827 3300060344 Bacteria 828

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005459 Ga0068867_100365570 Ga0068867_1003655702 92
2 3300005355 Ga0070671_100012931 Ga0070671_10001293111 94
3 3300025931 Ga0207644_10011422 Ga0207644_100114225 94
4 3300030745 Ga0316182_1187071 Ga0316182_11870712 94
5 3300037418 Ga0395900_0241648 Ga0395900_0241648_849_1145 94
6 3300037471 Ga0395905_0753127 Ga0395905_0753127_114_410 94
7 3300038443 Ga0395901_1553089 Ga0395901_1553089_293_589 94
8 3300044901 Ga0466960_0601199 Ga0466960_0601199_322_618 94
9 3300045976 Ga0466967_2375292 Ga0466967_2375292_136_435 94
10 3300048903 Ga0496100_0389538 Ga0496100_0389538_756_1043 94
11 3300048911 Ga0496108_0100619 Ga0496108_0100619_1889_2185 94
12 3300048912 Ga0496109_0062064 Ga0496109_0062064_1388_1684 94
13 3300048915 Ga0496112_0025726 Ga0496112_0025726_3205_3501 94
14 3300048916 Ga0496113_0067298 Ga0496113_0067298_2152_2448 94
15 3300049680 Ga0501250_046574 Ga0501250_046574_296_586 94
16 3300027617 Ga0210002_1002375 Ga0210002_10023756 95
17 3300042006 Ga0439432_088427 Ga0439432_088427_385_675 95
18 3300050490 nmdc:mga03n38_880097_c1 nmdc:mga03n38_880097_c1_190_480 95
19 iso_pu_bacteria 2547132130 2547502384 95
20 iso_pu_bacteria 2643221579 2643906203 95
21 iso_pu_bacteria 2643221581 2643915223 95
22 iso_pu_bacteria 2747842428 2747950329 95
23 iso_pu_bacteria 2747842501 2748018121 95
24 iso_pu_bacteria 2765235840 2765577784 95
25 iso_pu_bacteria 2816332141 2816515847 95
26 iso_pu_bacteria 2842391507 2842394171 95
27 iso_pu_bacteria 2874220319 2874220389 95
28 iso_pu_bacteria 2919089067 2919091659 95
29 iso_pu_bacteria 2919134579 2919134934 95
30 iso_pu_bacteria 2923516293 2923519227 95
31 iso_pu_bacteria 2928496128 2928498479 95
32 iso_pu_bacteria 2931380184 2931381954 95
33 iso_pu_bacteria 2937610967 2937611280 95
34 iso_pu_bacteria 2939626828 2939631015 95
35 iso_pu_bacteria 2961047084 2961047154 95
36 iso_pu_bacteria 2961064222 2961068524 95
37 iso_pu_bacteria 2987605356 2987605649 95
38 iso_pu_bacteria 8002869464 8002871446 95
39 3300005617 Ga0068859_100714138 Ga0068859_1007141382 96
40 3300005843 Ga0068860_101372426 Ga0068860_1013724262 96
41 3300006931 Ga0097620_100714087 Ga0097620_1007140872 96
42 3300009177 Ga0105248_10864655 Ga0105248_108646552 96
43 3300009978 Ga0105148_105283 Ga0105148_1052832 96
44 3300013306 Ga0163162_11097464 Ga0163162_110974642 96
45 3300025931 Ga0207644_11351237 Ga0207644_113512371 96
46 3300025941 Ga0207711_10147290 Ga0207711_101472905 96
47 3300025960 Ga0207651_10648699 Ga0207651_106486991 96
48 3300028381 Ga0268264_10786813 Ga0268264_107868132 96
49 3300031995 Ga0307409_101512416 Ga0307409_1015124162 96
50 iso_pu_bacteria 2842780639 2842781648 96
51 3300005334 Ga0068869_100115364 Ga0068869_1001153642 97
52 3300005434 Ga0070709_10133238 Ga0070709_101332382 97
53 3300005436 Ga0070713_100983439 Ga0070713_1009834392 97
54 3300005439 Ga0070711_101313524 Ga0070711_1013135242 97
55 3300005441 Ga0070700_101566992 Ga0070700_1015669922 97
56 3300005543 Ga0070672_100212901 Ga0070672_1002129012 97
57 3300005616 Ga0068852_100147811 Ga0068852_1001478115 97
58 3300005840 Ga0068870_10201962 Ga0068870_102019622 97
59 3300006237 Ga0097621_100195694 Ga0097621_1001956943 97
60 3300006846 Ga0075430_101363114 Ga0075430_1013631142 97
61 3300009036 Ga0105244_10438164 Ga0105244_104381642 97
62 3300009093 Ga0105240_10265037 Ga0105240_102650372 97
63 3300009545 Ga0105237_10517711 Ga0105237_105177112 97
64 3300009979 Ga0105032_100517 Ga0105032_1005172 97
65 3300013104 Ga0157370_11219759 Ga0157370_112197592 97
66 3300013296 Ga0157374_12286767 Ga0157374_122867671 97
67 3300013297 Ga0157378_12618515 Ga0157378_126185152 97
68 3300014497 Ga0182008_10379025 Ga0182008_103790252 97
69 3300014969 Ga0157376_10315852 Ga0157376_103158522 97
70 3300025917 Ga0207660_11681271 Ga0207660_116812712 97
71 3300025924 Ga0207694_11706001 Ga0207694_117060012 97
72 3300025925 Ga0207650_11050256 Ga0207650_110502562 97
73 3300025940 Ga0207691_10076483 Ga0207691_100764834 97
74 3300026121 Ga0207683_10335929 Ga0207683_103359292 97
75 3300030744 Ga0316181_1110680 Ga0316181_11106801 97
76 3300031731 Ga0307405_10142144 Ga0307405_101421442 97
77 3300031824 Ga0307413_10047867 Ga0307413_100478672 97
78 3300031852 Ga0307410_10028499 Ga0307410_100284993 97
79 3300031901 Ga0307406_10874309 Ga0307406_108743092 97
80 3300031911 Ga0307412_10346875 Ga0307412_103468752 97
81 3300031995 Ga0307409_100024348 Ga0307409_1000243485 97
82 3300032002 Ga0307416_100404694 Ga0307416_1004046942 97
83 3300032004 Ga0307414_10785321 Ga0307414_107853212 97
84 3300032005 Ga0307411_10015295 Ga0307411_100152959 97
85 3300032126 Ga0307415_100759180 Ga0307415_1007591802 97
86 3300041452 Ga0451793_0649292 Ga0451793_0649292_87_386 97
87 3300041496 Ga0451839_0879567 Ga0451839_0879567_396_695 97
88 3300041512 Ga0451853_0501935 Ga0451853_0501935_124_417 97
89 3300046525 Ga0495663_0330149 Ga0495663_0330149_162_467 97
90 3300046537 Ga0495598_0126189 Ga0495598_0126189_255_551 97
91 3300046539 Ga0495621_0263312 Ga0495621_0263312_366_671 97
92 3300046616 Ga0495668_0078857 Ga0495668_0078857_1040_1345 97
93 3300047318 Ga0495636_0258130 Ga0495636_0258130_163_468 97
94 3300047445 Ga0495677_0145086 Ga0495677_0145086_473_778 97
95 3300049127 Ga0501306_005581 Ga0501306_005581_780_1079 97
96 3300049128 Ga0501308_011241 Ga0501308_011241_537_836 97
97 3300049129 Ga0501309_012417 Ga0501309_012417_558_857 97
98 3300049129 Ga0501309_041481 Ga0501309_041481_145_444 97
99 3300049130 Ga0501310_010671 Ga0501310_010671_296_595 97
100 3300049160 Ga0501304_000987 Ga0501304_000987_1002_1301 97
101 3300049161 Ga0501305_007764 Ga0501305_007764_697_996 97
102 3300049162 Ga0501307_006548 Ga0501307_006548_734_1033 97
103 3300049521 Ga0501298_092911 Ga0501298_092911_135_434 97
104 3300049527 Ga0501311_022011 Ga0501311_022011_99_398 97
105 3300049528 Ga0501312_002447 Ga0501312_002447_714_1013 97
106 3300049529 Ga0501313_040858 Ga0501313_040858_203_502 97
107 3300049531 Ga0501315_000712 Ga0501315_000712_1974_2273 97
108 3300049532 Ga0501316_025268 Ga0501316_025268_280_579 97
109 3300049533 Ga0501317_001762 Ga0501317_001762_942_1241 97
110 3300049533 Ga0501317_056682 Ga0501317_056682_221_526 97
111 3300049534 Ga0501318_049310 Ga0501318_049310_192_491 97
112 3300049536 Ga0501320_003674 Ga0501320_003674_388_687 97
113 3300049537 Ga0501321_007845 Ga0501321_007845_691_990 97
114 3300049539 Ga0501323_000068 Ga0501323_000068_3891_4190 97
115 3300049539 Ga0501323_033218 Ga0501323_033218_178_471 97
116 3300049540 Ga0501324_010732 Ga0501324_010732_208_507 97
117 3300049541 Ga0501325_008060 Ga0501325_008060_212_511 97
118 3300049552 Ga0501336_031496 Ga0501336_031496_120_419 97
119 3300049556 Ga0501340_011706 Ga0501340_011706_220_519 97
120 3300049568 Ga0501031_0301992 Ga0501031_0301992_430_729 97
121 3300049570 Ga0501033_0301675 Ga0501033_0301675_469_768 97
122 3300049571 Ga0501034_0021966 Ga0501034_0021966_2128_2424 97
123 3300049571 Ga0501034_0880349 Ga0501034_0880349_249_548 97
124 3300049573 Ga0501037_0340564 Ga0501037_0340564_287_586 97
125 3300049652 Ga0501202_018155 Ga0501202_018155_502_801 97
126 3300049656 Ga0501209_138327 Ga0501209_138327_317_616 97
127 3300049660 Ga0501216_093466 Ga0501216_093466_233_532 97
128 3300049663 Ga0501223_046989 Ga0501223_046989_84_383 97
129 3300049664 Ga0501224_021838 Ga0501224_021838_453_752 97
130 3300049672 Ga0501239_018174 Ga0501239_018174_224_523 97
131 3300049674 Ga0501242_033541 Ga0501242_033541_378_677 97
132 3300049682 Ga0501252_000295 Ga0501252_000295_3179_3478 97
133 3300049683 Ga0501253_075856 Ga0501253_075856_165_464 97
134 3300049688 Ga0501259_015715 Ga0501259_015715_606_905 97
135 3300049704 Ga0501221_070592 Ga0501221_070592_189_488 97
136 3300049705 Ga0501225_0091312 Ga0501225_0091312_313_612 97
137 3300049760 Ga0501263_022755 Ga0501263_022755_424_723 97
138 3300049762 Ga0501265_051682 Ga0501265_051682_238_537 97
139 3300049763 Ga0501266_006012 Ga0501266_006012_251_550 97
140 3300049765 Ga0501268_026172 Ga0501268_026172_241_540 97
141 3300049767 Ga0501270_002142 Ga0501270_002142_1198_1497 97
142 3300049769 Ga0501272_044853 Ga0501272_044853_151_450 97
143 3300049775 Ga0501279_047734 Ga0501279_047734_311_610 97
144 3300003187 JGI25151J46595_10007643 JGI25151J46595_100076436 98
145 3300003187 JGI25151J46595_10013580 JGI25151J46595_100135802 98
146 3300003215 JGI25153J46596_10122190 JGI25153J46596_101221901 98
147 3300003771 Ga0055526_1008987 Ga0055526_10089874 98
148 3300003773 Ga0055537_1001096 Ga0055537_10010964 98
149 3300003775 Ga0055524_1013602 Ga0055524_10136024 98
150 3300003775 Ga0055524_1015666 Ga0055524_10156662 98
151 3300003781 Ga0055536_1040186 Ga0055536_10401862 98
152 3300003784 Ga0055534_1003331 Ga0055534_10033316 98
153 3300003784 Ga0055534_1006907 Ga0055534_10069072 98
154 3300003790 Ga0055528_1013611 Ga0055528_10136112 98
155 3300003790 Ga0055528_1016393 Ga0055528_10163934 98
156 3300003791 Ga0055530_10004966 Ga0055530_100049666 98
157 3300003792 Ga0055540_1029568 Ga0055540_10295682 98
158 3300004798 Ga0058859_11549133 Ga0058859_115491331 98
159 3300004800 Ga0058861_11921333 Ga0058861_119213332 98
160 3300004801 Ga0058860_11990960 Ga0058860_119909602 98
161 3300005288 Ga0065714_10109302 Ga0065714_101093022 98
162 3300005288 Ga0065714_10289934 Ga0065714_102899342 98
163 3300005293 Ga0065715_10047422 Ga0065715_100474221 98
164 3300005293 Ga0065715_10471293 Ga0065715_104712932 98
165 3300005293 Ga0065715_10670981 Ga0065715_106709812 98
166 3300005328 Ga0070676_10167770 Ga0070676_101677702 98
167 3300005329 Ga0070683_100194209 Ga0070683_1001942091 98
168 3300005331 Ga0070670_100143059 Ga0070670_1001430593 98
169 3300005333 Ga0070677_10499576 Ga0070677_104995761 98
170 3300005335 Ga0070666_11107642 Ga0070666_111076422 98
171 3300005336 Ga0070680_100255720 Ga0070680_1002557202 98
172 3300005339 Ga0070660_100058257 Ga0070660_1000582573 98
173 3300005345 Ga0070692_10305522 Ga0070692_103055222 98
174 3300005347 Ga0070668_100580531 Ga0070668_1005805312 98
175 3300005354 Ga0070675_100105895 Ga0070675_1001058953 98
176 3300005354 Ga0070675_100213624 Ga0070675_1002136243 98
177 3300005355 Ga0070671_100202548 Ga0070671_1002025482 98
178 3300005356 Ga0070674_100103259 Ga0070674_1001032594 98
179 3300005364 Ga0070673_100209228 Ga0070673_1002092283 98
180 3300005366 Ga0070659_100231145 Ga0070659_1002311452 98
181 3300005367 Ga0070667_101042766 Ga0070667_1010427661 98
182 3300005367 Ga0070667_101847423 Ga0070667_1018474232 98
183 3300005441 Ga0070700_101868106 Ga0070700_1018681061 98
184 3300005455 Ga0070663_100793081 Ga0070663_1007930812 98
185 3300005455 Ga0070663_101141416 Ga0070663_1011414162 98
186 3300005457 Ga0070662_100282610 Ga0070662_1002826102 98
187 3300005458 Ga0070681_10205910 Ga0070681_102059103 98
188 3300005459 Ga0068867_101380374 Ga0068867_1013803742 98
189 3300005530 Ga0070679_100385818 Ga0070679_1003858182 98
190 3300005530 Ga0070679_100661303 Ga0070679_1006613032 98
191 3300005535 Ga0070684_100843519 Ga0070684_1008435192 98
192 3300005539 Ga0068853_102313218 Ga0068853_1023132182 98
193 3300005543 Ga0070672_100087779 Ga0070672_1000877792 98
194 3300005564 Ga0070664_100483677 Ga0070664_1004836772 98
195 3300005577 Ga0068857_100976059 Ga0068857_1009760592 98
196 3300005614 Ga0068856_100267129 Ga0068856_1002671292 98
197 3300005616 Ga0068852_100675721 Ga0068852_1006757212 98
198 3300005718 Ga0068866_10285085 Ga0068866_102850852 98
199 3300005719 Ga0068861_101093583 Ga0068861_1010935832 98
200 3300005719 Ga0068861_101325492 Ga0068861_1013254922 98
201 3300005840 Ga0068870_11106647 Ga0068870_111066472 98
202 3300005844 Ga0068862_100564998 Ga0068862_1005649982 98
203 3300006048 Ga0075363_100484729 Ga0075363_1004847292 98
204 3300009147 Ga0114129_11321426 Ga0114129_113214262 98
205 3300009177 Ga0105248_11070887 Ga0105248_110708872 98
206 3300009177 Ga0105248_12850805 Ga0105248_128508052 98
207 3300009551 Ga0105238_11245780 Ga0105238_112457801 98
208 3300009993 Ga0105028_105506 Ga0105028_1055062 98
209 3300010375 Ga0105239_10078930 Ga0105239_100789306 98
210 3300011119 Ga0105246_12229086 Ga0105246_122290862 98
211 3300012478 Ga0157328_1029174 Ga0157328_10291741 98
212 3300012482 Ga0157318_1005289 Ga0157318_10052892 98
213 3300012488 Ga0157343_1000309 Ga0157343_10003091 98
214 3300012490 Ga0157322_1011551 Ga0157322_10115512 98
215 3300012495 Ga0157323_1018551 Ga0157323_10185512 98
216 3300012500 Ga0157314_1020158 Ga0157314_10201582 98
217 3300012507 Ga0157342_1054705 Ga0157342_10547052 98
218 3300012512 Ga0157327_1024845 Ga0157327_10248452 98
219 3300013100 Ga0157373_10142986 Ga0157373_101429863 98
220 3300013102 Ga0157371_10083622 Ga0157371_100836223 98
221 3300013102 Ga0157371_10440463 Ga0157371_104404632 98
222 3300013104 Ga0157370_10464246 Ga0157370_104642462 98
223 3300013105 Ga0157369_10312189 Ga0157369_103121893 98
224 3300013296 Ga0157374_10365321 Ga0157374_103653211 98
225 3300013296 Ga0157374_11148881 Ga0157374_111488812 98
226 3300013306 Ga0163162_10694593 Ga0163162_106945932 98
227 3300013306 Ga0163162_10726495 Ga0163162_107264952 98
228 3300013307 Ga0157372_11124837 Ga0157372_111248371 98
229 3300013308 Ga0157375_10045770 Ga0157375_100457705 98
230 3300013308 Ga0157375_10377773 Ga0157375_103777733 98
231 3300013308 Ga0157375_10609150 Ga0157375_106091502 98
232 3300014325 Ga0163163_11264080 Ga0163163_112640802 98
233 3300014497 Ga0182008_10183346 Ga0182008_101833462 98
234 3300014745 Ga0157377_10561482 Ga0157377_105614822 98
235 3300017792 Ga0163161_10348494 Ga0163161_103484943 98
236 3300025245 Ga0207425_1005550 Ga0207425_10055505 98
237 3300025245 Ga0207425_1048016 Ga0207425_10480161 98
238 3300025263 Ga0209565_1000001 Ga0209565_10000011147 98
239 3300025263 Ga0209565_1055030 Ga0209565_10550302 98
240 3300025273 Ga0209673_1000001 Ga0209673_10000011147 98
241 3300025273 Ga0209673_1002116 Ga0209673_100211623 98
242 3300025284 Ga0209130_1007816 Ga0209130_10078165 98
243 3300025291 Ga0209675_1000001 Ga0209675_10000011386 98
244 3300025291 Ga0209675_1006904 Ga0209675_10069045 98
245 3300025292 Ga0209676_1001608 Ga0209676_100160829 98
246 3300025292 Ga0209676_1004892 Ga0209676_10048924 98
247 3300025294 Ga0209025_1000006 Ga0209025_100000621 98
248 3300025294 Ga0209025_1099920 Ga0209025_10999202 98
249 3300025294 Ga0209025_1150246 Ga0209025_11502462 98
250 3300025295 Ga0209564_1000001 Ga0209564_10000011548 98
251 3300025295 Ga0209564_1007141 Ga0209564_10071419 98
252 3300025297 Ga0209758_1035768 Ga0209758_10357684 98
253 3300025298 Ga0209050_1001128 Ga0209050_100112838 98
254 3300025299 Ga0209256_1000002 Ga0209256_10000025 98
255 3300025299 Ga0209256_1003821 Ga0209256_10038215 98
256 3300025302 Ga0207426_1068355 Ga0207426_10683551 98
257 3300025303 Ga0209051_1028616 Ga0209051_10286163 98
258 3300025304 Ga0209257_1006382 Ga0209257_100638215 98
259 3300025315 Ga0207697_10049742 Ga0207697_100497423 98
260 3300025893 Ga0207682_10231592 Ga0207682_102315922 98
261 3300025899 Ga0207642_10720688 Ga0207642_107206882 98
262 3300025907 Ga0207645_10107422 Ga0207645_101074222 98
263 3300025908 Ga0207643_10160910 Ga0207643_101609102 98
264 3300025909 Ga0207705_10060885 Ga0207705_100608854 98
265 3300025912 Ga0207707_10277754 Ga0207707_102777543 98
266 3300025917 Ga0207660_10779635 Ga0207660_107796352 98
267 3300025919 Ga0207657_10006384 Ga0207657_100063845 98
268 3300025920 Ga0207649_10300149 Ga0207649_103001492 98
269 3300025921 Ga0207652_10097888 Ga0207652_100978884 98
270 3300025923 Ga0207681_10278322 Ga0207681_102783222 98
271 3300025924 Ga0207694_11565903 Ga0207694_115659032 98
272 3300025925 Ga0207650_10175272 Ga0207650_101752722 98
273 3300025926 Ga0207659_10442633 Ga0207659_104426332 98
274 3300025926 Ga0207659_10621832 Ga0207659_106218322 98
275 3300025931 Ga0207644_11169679 Ga0207644_111696792 98
276 3300025931 Ga0207644_11880265 Ga0207644_118802651 98
277 3300025932 Ga0207690_10954289 Ga0207690_109542892 98
278 3300025933 Ga0207706_10239882 Ga0207706_102398822 98
279 3300025937 Ga0207669_10076663 Ga0207669_100766632 98
280 3300025940 Ga0207691_10107616 Ga0207691_101076165 98
281 3300025941 Ga0207711_11110061 Ga0207711_111100612 98
282 3300025949 Ga0207667_11962249 Ga0207667_119622492 98
283 3300025972 Ga0207668_10160776 Ga0207668_101607762 98
284 3300025981 Ga0207640_12022250 Ga0207640_120222502 98
285 3300026041 Ga0207639_11174982 Ga0207639_111749822 98
286 3300026067 Ga0207678_10202573 Ga0207678_102025732 98
287 3300026067 Ga0207678_10590558 Ga0207678_105905582 98
288 3300026075 Ga0207708_10543507 Ga0207708_105435072 98
289 3300026078 Ga0207702_11405688 Ga0207702_114056882 98
290 3300026089 Ga0207648_10084850 Ga0207648_100848505 98
291 3300026116 Ga0207674_10301096 Ga0207674_103010962 98
292 3300026118 Ga0207675_100966302 Ga0207675_1009663021 98
293 3300026118 Ga0207675_102037818 Ga0207675_1020378182 98
294 3300026142 Ga0207698_10196978 Ga0207698_101969784 98
295 3300026142 Ga0207698_10450120 Ga0207698_104501202 98
296 3300027252 Ga0209973_1001982 Ga0209973_10019822 98
297 3300027360 Ga0209969_1000918 Ga0209969_10009184 98
298 3300027364 Ga0209967_1002362 Ga0209967_10023624 98
299 3300027364 Ga0209967_1009133 Ga0209967_10091333 98
300 3300027378 Ga0209981_1010702 Ga0209981_10107022 98
301 3300027424 Ga0209984_1000306 Ga0209984_10003065 98
302 3300027424 Ga0209984_1067854 Ga0209984_10678541 98
303 3300027462 Ga0210000_1004942 Ga0210000_10049422 98
304 3300027471 Ga0209995_1000770 Ga0209995_10007706 98
305 3300027526 Ga0209968_1017243 Ga0209968_10172432 98
306 3300027543 Ga0209999_1020896 Ga0209999_10208963 98
307 3300027552 Ga0209982_1000032 Ga0209982_10000327 98
308 3300027552 Ga0209982_1031999 Ga0209982_10319992 98
309 3300027614 Ga0209970_1035823 Ga0209970_10358232 98
310 3300027617 Ga0210002_1017845 Ga0210002_10178452 98
311 3300027665 Ga0209983_1000295 Ga0209983_100029519 98
312 3300027682 Ga0209971_1000410 Ga0209971_100041020 98
313 3300027876 Ga0209974_10010367 Ga0209974_100103672 98
314 3300027876 Ga0209974_10074748 Ga0209974_100747481 98
315 3300028380 Ga0268265_10377972 Ga0268265_103779722 98
316 3300029277 Ga0311001_1058661 Ga0311001_10586612 98
317 3300030731 Ga0316177_1006784 Ga0316177_10067843 98
318 3300030732 Ga0316176_1213588 Ga0316176_12135883 98
319 3300030733 Ga0314311_1263094 Ga0314311_12630942 98
320 3300030735 Ga0316178_1178759 Ga0316178_11787592 98
321 3300030736 Ga0316180_1161841 Ga0316180_11618412 98
322 3300030742 Ga0316183_1156957 Ga0316183_11569572 98
323 3300030745 Ga0316182_1151288 Ga0316182_11512882 98
324 3300030745 Ga0316182_1157126 Ga0316182_11571262 98
325 3300030745 Ga0316182_1184990 Ga0316182_11849902 98
326 3300031548 Ga0307408_100181171 Ga0307408_1001811713 98
327 3300031548 Ga0307408_101601202 Ga0307408_1016012022 98
328 3300031731 Ga0307405_11468755 Ga0307405_114687552 98
329 3300031731 Ga0307405_12142146 Ga0307405_121421461 98
330 3300031824 Ga0307413_10037133 Ga0307413_100371334 98
331 3300031824 Ga0307413_10279926 Ga0307413_102799263 98
332 3300031824 Ga0307413_10517385 Ga0307413_105173852 98
333 3300031824 Ga0307413_10778113 Ga0307413_107781132 98
334 3300031824 Ga0307413_10991576 Ga0307413_109915762 98
335 3300031824 Ga0307413_11006848 Ga0307413_110068481 98
336 3300031852 Ga0307410_10427645 Ga0307410_104276452 98
337 3300031901 Ga0307406_10094886 Ga0307406_100948863 98
338 3300031901 Ga0307406_10346198 Ga0307406_103461982 98
339 3300031903 Ga0307407_10034741 Ga0307407_100347414 98
340 3300031911 Ga0307412_10042944 Ga0307412_100429444 98
341 3300031911 Ga0307412_10311553 Ga0307412_103115532 98
342 3300031911 Ga0307412_10401326 Ga0307412_104013262 98
343 3300031911 Ga0307412_11190223 Ga0307412_111902232 98
344 3300031911 Ga0307412_11208676 Ga0307412_112086762 98
345 3300031995 Ga0307409_100767138 Ga0307409_1007671382 98
346 3300032002 Ga0307416_101510611 Ga0307416_1015106112 98
347 3300032002 Ga0307416_103563832 Ga0307416_1035638322 98
348 3300032004 Ga0307414_10002120 Ga0307414_1000212019 98
349 3300032004 Ga0307414_10007179 Ga0307414_100071795 98
350 3300032004 Ga0307414_10063463 Ga0307414_100634633 98
351 3300032004 Ga0307414_10448284 Ga0307414_104482842 98
352 3300032004 Ga0307414_10697965 Ga0307414_106979652 98
353 3300032004 Ga0307414_11060873 Ga0307414_110608731 98
354 3300032004 Ga0307414_11297263 Ga0307414_112972632 98
355 3300032005 Ga0307411_10041490 Ga0307411_100414905 98
356 3300032005 Ga0307411_10862437 Ga0307411_108624372 98
357 3300032005 Ga0307411_11078775 Ga0307411_110787752 98
358 3300032005 Ga0307411_11292060 Ga0307411_112920602 98
359 3300032126 Ga0307415_100292343 Ga0307415_1002923432 98
360 3300034818 Ga0373950_0094669 Ga0373950_0094669_223_534 98
361 3300035170 Ga0373943_0487907 Ga0373943_0487907_188_490 98
362 3300035691 Ga0373931_1024699 Ga0373931_1024699_58_369 98
363 3300035692 Ga0373935_1312547 Ga0373935_1312547_137_448 98
364 3300035724 Ga0373933_0611407 Ga0373933_0611407_39_350 98
365 3300037312 Ga0395899_0093693 Ga0395899_0093693_1868_2164 98
366 3300037418 Ga0395900_0036642 Ga0395900_0036642_3817_4113 98
367 3300037466 Ga0395898_0180698 Ga0395898_0180698_731_1027 98
368 3300037471 Ga0395905_0110752 Ga0395905_0110752_1424_1735 98
369 3300037471 Ga0395905_0293167 Ga0395905_0293167_452_748 98
370 3300037471 Ga0395905_1623580 Ga0395905_1623580_63_374 98
371 3300038443 Ga0395901_0276971 Ga0395901_0276971_271_567 98
372 3300039145 Ga0237816_00020 Ga0237816_00020_7153_7449 98
373 3300041404 Ga0439436_0005214 Ga0439436_0005214_105_401 98
374 3300041404 Ga0439436_0009292 Ga0439436_0009292_491_787 98
375 3300041404 Ga0439436_0044395 Ga0439436_0044395_673_969 98
376 3300041404 Ga0439436_0195246 Ga0439436_0195246_92_388 98
377 3300041406 Ga0439439_0004561 Ga0439439_0004561_500_796 98
378 3300041407 Ga0439447_013961 Ga0439447_013961_786_1082 98
379 3300041411 Ga0439466_0112396 Ga0439466_0112396_132_428 98
380 3300041413 Ga0439465_0009954 Ga0439465_0009954_335_631 98
381 3300041413 Ga0439465_0045155 Ga0439465_0045155_789_1085 98
382 3300041413 Ga0439465_0054861 Ga0439465_0054861_494_790 98
383 3300041413 Ga0439465_0329805 Ga0439465_0329805_184_480 98
384 3300041453 Ga0451797_0495586 Ga0451797_0495586_208_507 98
385 3300041460 Ga0451802_1892135 Ga0451802_1892135_24_320 98
386 3300041461 Ga0451805_021755 Ga0451805_021755_117_416 98
387 3300041494 Ga0451837_0822369 Ga0451837_0822369_424_723 98
388 3300041997 Ga0439431_0172541 Ga0439431_0172541_228_524 98
389 3300041999 Ga0439433_0016339 Ga0439433_0016339_964_1260 98
390 3300041999 Ga0439433_0051959 Ga0439433_0051959_443_772 98
391 3300041999 Ga0439433_0071138 Ga0439433_0071138_324_620 98
392 3300042004 Ga0439445_0022958 Ga0439445_0022958_1080_1376 98
393 3300042004 Ga0439445_0109731 Ga0439445_0109731_443_739 98
394 3300042005 Ga0439448_0105629 Ga0439448_0105629_219_515 98
395 3300042006 Ga0439432_044052 Ga0439432_044052_379_675 98
396 3300042006 Ga0439432_145403 Ga0439432_145403_371_667 98
397 3300042007 Ga0439449_0011871 Ga0439449_0011871_2316_2612 98
398 3300042007 Ga0439449_0047245 Ga0439449_0047245_69_365 98
399 3300042007 Ga0439449_0050566 Ga0439449_0050566_668_964 98
400 3300042007 Ga0439449_0052843 Ga0439449_0052843_264_560 98
401 3300042007 Ga0439449_0059877 Ga0439449_0059877_876_1232 98
402 3300042007 Ga0439449_0238816 Ga0439449_0238816_180_476 98
403 3300042010 Ga0439452_043990 Ga0439452_043990_36_332 98
404 3300042010 Ga0439452_125502 Ga0439452_125502_34_330 98
405 3300042012 Ga0439455_0094324 Ga0439455_0094324_352_648 98
406 3300042014 Ga0439457_033336 Ga0439457_033336_361_657 98
407 3300042014 Ga0439457_165578 Ga0439457_165578_76_372 98
408 3300042015 Ga0439462_0027568 Ga0439462_0027568_424_720 98
409 3300042015 Ga0439462_0082925 Ga0439462_0082925_461_757 98
410 3300042138 Ga0450903_045815 Ga0450903_045815_30_326 98
411 3300045836 Ga0466958_1166693 Ga0466958_1166693_130_426 98
412 3300046512 Ga0495610_0236940 Ga0495610_0236940_257_553 98
413 3300046525 Ga0495663_0051919 Ga0495663_0051919_409_705 98
414 3300046525 Ga0495663_0063370 Ga0495663_0063370_583_879 98
415 3300046525 Ga0495663_0135103 Ga0495663_0135103_483_779 98
416 3300046537 Ga0495598_0158612 Ga0495598_0158612_197_493 98
417 3300046537 Ga0495598_0293813 Ga0495598_0293813_113_424 98
418 3300046539 Ga0495621_0084120 Ga0495621_0084120_334_630 98
419 3300046539 Ga0495621_0225644 Ga0495621_0225644_132_428 98
420 3300046615 Ga0495656_0004814 Ga0495656_0004814_381_677 98
421 3300046616 Ga0495668_0033171 Ga0495668_0033171_2372_2668 98
422 3300046664 Ga0495659_0087343 Ga0495659_0087343_568_864 98
423 3300046664 Ga0495659_0370808 Ga0495659_0370808_28_324 98
424 3300046674 Ga0495588_0423553 Ga0495588_0423553_157_453 98
425 3300046691 Ga0495670_0342267 Ga0495670_0342267_359_655 98
426 3300046691 Ga0495670_0495645 Ga0495670_0495645_297_593 98
427 3300047318 Ga0495636_0052343 Ga0495636_0052343_1341_1637 98
428 3300047318 Ga0495636_0121083 Ga0495636_0121083_441_737 98
429 3300047447 Ga0495685_061912 Ga0495685_061912_758_1054 98
430 3300047470 Ga0495681_0124862 Ga0495681_0124862_118_414 98
431 3300048904 Ga0496101_0223296 Ga0496101_0223296_62_373 98
432 3300048905 Ga0496102_1169225 Ga0496102_1169225_16_312 98
433 3300048911 Ga0496108_0557978 Ga0496108_0557978_473_769 98
434 3300048912 Ga0496109_0387077 Ga0496109_0387077_414_710 98
435 3300048913 Ga0496110_1123034 Ga0496110_1123034_83_379 98
436 3300048918 Ga0496115_0367309 Ga0496115_0367309_73_384 98
437 3300048924 Ga0496121_0005001 Ga0496121_0005001_15023_15319 98
438 3300049127 Ga0501306_005642 Ga0501306_005642_779_1075 98
439 3300049127 Ga0501306_017111 Ga0501306_017111_420_716 98
440 3300049127 Ga0501306_026148 Ga0501306_026148_220_516 98
441 3300049127 Ga0501306_056469 Ga0501306_056469_54_350 98
442 3300049127 Ga0501306_086653 Ga0501306_086653_218_514 98
443 3300049128 Ga0501308_000035 Ga0501308_000035_2268_2564 98
444 3300049128 Ga0501308_005875 Ga0501308_005875_437_733 98
445 3300049129 Ga0501309_047735 Ga0501309_047735_37_393 98
446 3300049130 Ga0501310_000986 Ga0501310_000986_628_924 98
447 3300049130 Ga0501310_007734 Ga0501310_007734_667_963 98
448 3300049131 Ga0501341_01557 Ga0501341_01557_407_703 98
449 3300049134 Ga0501345_03043 Ga0501345_03043_94_390 98
450 3300049160 Ga0501304_004356 Ga0501304_004356_391_687 98
451 3300049161 Ga0501305_001649 Ga0501305_001649_178_474 98
452 3300049161 Ga0501305_024565 Ga0501305_024565_404_700 98
453 3300049161 Ga0501305_025801 Ga0501305_025801_457_753 98
454 3300049161 Ga0501305_051082 Ga0501305_051082_58_414 98
455 3300049162 Ga0501307_000579 Ga0501307_000579_843_1139 98
456 3300049162 Ga0501307_028221 Ga0501307_028221_140_436 98
457 3300049162 Ga0501307_028729 Ga0501307_028729_146_454 98
458 3300049162 Ga0501307_030527 Ga0501307_030527_82_378 98
459 3300049162 Ga0501307_035371 Ga0501307_035371_78_374 98
460 3300049163 Ga0501342_04097 Ga0501342_04097_76_372 98
461 3300049514 Ga0501291_106770 Ga0501291_106770_108_404 98
462 3300049527 Ga0501311_003051 Ga0501311_003051_331_627 98
463 3300049528 Ga0501312_002244 Ga0501312_002244_721_1017 98
464 3300049528 Ga0501312_077752 Ga0501312_077752_103_399 98
465 3300049528 Ga0501312_079207 Ga0501312_079207_202_558 98
466 3300049529 Ga0501313_003322 Ga0501313_003322_604_900 98
467 3300049530 Ga0501314_007283 Ga0501314_007283_332_628 98
468 3300049530 Ga0501314_014003 Ga0501314_014003_454_750 98
469 3300049531 Ga0501315_004415 Ga0501315_004415_316_612 98
470 3300049531 Ga0501315_040976 Ga0501315_040976_165_461 98
471 3300049531 Ga0501315_086517 Ga0501315_086517_146_502 98
472 3300049532 Ga0501316_004177 Ga0501316_004177_951_1247 98
473 3300049532 Ga0501316_052158 Ga0501316_052158_34_390 98
474 3300049533 Ga0501317_006218 Ga0501317_006218_681_977 98
475 3300049533 Ga0501317_010657 Ga0501317_010657_301_597 98
476 3300049534 Ga0501318_000528 Ga0501318_000528_628_924 98
477 3300049534 Ga0501318_035161 Ga0501318_035161_37_393 98
478 3300049534 Ga0501318_063123 Ga0501318_063123_224_520 98
479 3300049535 Ga0501319_000070 Ga0501319_000070_747_1043 98
480 3300049535 Ga0501319_008492 Ga0501319_008492_327_623 98
481 3300049536 Ga0501320_008783 Ga0501320_008783_394_690 98
482 3300049537 Ga0501321_005366 Ga0501321_005366_706_1002 98
483 3300049537 Ga0501321_013367 Ga0501321_013367_426_722 98
484 3300049537 Ga0501321_038133 Ga0501321_038133_218_574 98
485 3300049538 Ga0501322_004912 Ga0501322_004912_287_583 98
486 3300049539 Ga0501323_000101 Ga0501323_000101_3661_3957 98
487 3300049539 Ga0501323_050181 Ga0501323_050181_136_432 98
488 3300049539 Ga0501323_056670 Ga0501323_056670_207_563 98
489 3300049540 Ga0501324_000043 Ga0501324_000043_251_547 98
490 3300049540 Ga0501324_020298 Ga0501324_020298_105_461 98
491 3300049540 Ga0501324_025706 Ga0501324_025706_57_353 98
492 3300049541 Ga0501325_003096 Ga0501325_003096_314_610 98
493 3300049545 Ga0501329_02559 Ga0501329_02559_380_676 98
494 3300049546 Ga0501330_003224 Ga0501330_003224_338_634 98
495 3300049547 Ga0501331_10925 Ga0501331_10925_186_482 98
496 3300049548 Ga0501332_05628 Ga0501332_05628_147_443 98
497 3300049549 Ga0501333_006796 Ga0501333_006796_143_439 98
498 3300049550 Ga0501334_08151 Ga0501334_08151_110_406 98
499 3300049552 Ga0501336_003033 Ga0501336_003033_238_534 98
500 3300049553 Ga0501337_016844 Ga0501337_016844_101_397 98
501 3300049554 Ga0501338_06754 Ga0501338_06754_377_673 98
502 3300049556 Ga0501340_005822 Ga0501340_005822_331_627 98
503 3300049556 Ga0501340_012965 Ga0501340_012965_221_577 98
504 3300049556 Ga0501340_019503 Ga0501340_019503_230_526 98
505 3300049568 Ga0501031_0025141 Ga0501031_0025141_2608_2904 98
506 3300049568 Ga0501031_0101188 Ga0501031_0101188_737_1036 98
507 3300049569 Ga0501032_0217693 Ga0501032_0217693_425_721 98
508 3300049569 Ga0501032_0675160 Ga0501032_0675160_329_628 98
509 3300049570 Ga0501033_0123272 Ga0501033_0123272_875_1171 98
510 3300049571 Ga0501034_0120372 Ga0501034_0120372_699_998 98
511 3300049571 Ga0501034_0376789 Ga0501034_0376789_806_1102 98
512 3300049571 Ga0501034_0395735 Ga0501034_0395735_621_917 98
513 3300049572 Ga0501036_0066357 Ga0501036_0066357_1391_1690 98
514 3300049572 Ga0501036_0660103 Ga0501036_0660103_359_655 98
515 3300049573 Ga0501037_0021232 Ga0501037_0021232_4046_4345 98
516 3300049573 Ga0501037_0493195 Ga0501037_0493195_153_449 98
517 3300049574 Ga0501038_0002396 Ga0501038_0002396_2227_2526 98
518 3300049574 Ga0501038_0026720 Ga0501038_0026720_2017_2313 98
519 3300049575 Ga0501039_0013271 Ga0501039_0013271_3026_3325 98
520 3300049575 Ga0501039_0366055 Ga0501039_0366055_363_659 98
521 3300049579 Ga0501043_0030616 Ga0501043_0030616_1841_2137 98
522 3300049579 Ga0501043_0326832 Ga0501043_0326832_329_625 98
523 3300049579 Ga0501043_0571857 Ga0501043_0571857_231_530 98
524 3300049580 Ga0501046_0534208 Ga0501046_0534208_286_585 98
525 3300049580 Ga0501046_0786563 Ga0501046_0786563_218_514 98
526 3300049581 Ga0501047_0059275 Ga0501047_0059275_362_658 98
527 3300049581 Ga0501047_0221275 Ga0501047_0221275_1104_1403 98
528 3300049582 Ga0501048_0538607 Ga0501048_0538607_285_581 98
529 3300049582 Ga0501048_0581196 Ga0501048_0581196_202_501 98
530 3300049584 Ga0501068_0639040 Ga0501068_0639040_283_582 98
531 3300049586 Ga0501070_0016046 Ga0501070_0016046_428_727 98
532 3300049586 Ga0501070_0198353 Ga0501070_0198353_675_971 98
533 3300049587 Ga0501071_0037161 Ga0501071_0037161_842_1141 98
534 3300049589 Ga0501073_0068309 Ga0501073_0068309_1429_1728 98
535 3300049649 Ga0501198_053502 Ga0501198_053502_278_574 98
536 3300049652 Ga0501202_037238 Ga0501202_037238_349_645 98
537 3300049653 Ga0501206_040475 Ga0501206_040475_112_408 98
538 3300049658 Ga0501211_031447 Ga0501211_031447_169_465 98
539 3300049660 Ga0501216_023017 Ga0501216_023017_353_649 98
540 3300049661 Ga0501217_048551 Ga0501217_048551_479_775 98
541 3300049662 Ga0501222_041128 Ga0501222_041128_301_597 98
542 3300049663 Ga0501223_032298 Ga0501223_032298_200_496 98
543 3300049665 Ga0501227_172799 Ga0501227_172799_81_377 98
544 3300049669 Ga0501235_189123 Ga0501235_189123_179_475 98
545 3300049671 Ga0501238_077425 Ga0501238_077425_131_427 98
546 3300049672 Ga0501239_002487 Ga0501239_002487_394_690 98
547 3300049673 Ga0501240_014783 Ga0501240_014783_296_592 98
548 3300049674 Ga0501242_009218 Ga0501242_009218_179_475 98
549 3300049679 Ga0501249_021629 Ga0501249_021629_221_517 98
550 3300049680 Ga0501250_043409 Ga0501250_043409_289_585 98
551 3300049681 Ga0501251_029671 Ga0501251_029671_315_611 98
552 3300049682 Ga0501252_008250 Ga0501252_008250_681_977 98
553 3300049683 Ga0501253_058558 Ga0501253_058558_170_466 98
554 3300049686 Ga0501257_049116 Ga0501257_049116_344_640 98
555 3300049688 Ga0501259_119797 Ga0501259_119797_58_354 98
556 3300049705 Ga0501225_0045508 Ga0501225_0045508_530_826 98
557 3300049705 Ga0501225_0065537 Ga0501225_0065537_441_737 98
558 3300049741 Ga0501079_0672563 Ga0501079_0672563_235_534 98
559 3300049742 Ga0501080_0018310 Ga0501080_0018310_4639_4938 98
560 3300049757 Ga0501232_028687 Ga0501232_028687_141_437 98
561 3300049758 Ga0501241_033359 Ga0501241_033359_424_720 98
562 3300049760 Ga0501263_004493 Ga0501263_004493_1083_1379 98
563 3300049763 Ga0501266_012196 Ga0501266_012196_417_713 98
564 3300049765 Ga0501268_015441 Ga0501268_015441_424_720 98
565 3300049766 Ga0501269_009447 Ga0501269_009447_430_726 98
566 3300049767 Ga0501270_105993 Ga0501270_105993_107_403 98
567 3300049771 Ga0501274_014849 Ga0501274_014849_308_604 98
568 3300049772 Ga0501275_005782 Ga0501275_005782_358_654 98
569 3300049778 Ga0501282_022380 Ga0501282_022380_304_600 98
570 3300049779 Ga0501283_105997 Ga0501283_105997_113_409 98
571 3300049822 Ga0501035_0003746 Ga0501035_0003746_13795_14094 98
572 3300049822 Ga0501035_0039431 Ga0501035_0039431_855_1151 98
573 3300049823 Ga0501044_0003730 Ga0501044_0003730_722_1021 98
574 3300049823 Ga0501044_0154075 Ga0501044_0154075_661_957 98
575 3300049824 Ga0501045_0352529 Ga0501045_0352529_291_587 98
576 3300049850 Ga0501204_065782 Ga0501204_065782_196_492 98
577 3300059508 Ga0587088_127429 Ga0587088_127429_32_328 98
578 3300059510 Ga0587090_008934 Ga0587090_008934_743_1039 98
579 3300059639 Ga0587062_036448 Ga0587062_036448_353_649 98
580 3300059642 Ga0587069_027263 Ga0587069_027263_175_471 98
581 3300059647 Ga0587079_118289 Ga0587079_118289_314_610 98
582 3300060344 Ga0587071_055827 Ga0587071_055827_276_572 98
583 2162886007 SwRhRL2b_contig_1598425 SwRhRL2b_0616.00010060 99
584 2162886007 SwRhRL2b_contig_332562 SwRhRL2b_0499.00001270 99
585 3300002774 JGI25150J39212_1000359 JGI25150J39212_10003594 99
586 3300003187 JGI25151J46595_10000895 JGI25151J46595_1000089532 99
587 3300003215 JGI25153J46596_10000050 JGI25153J46596_10000050153 99
588 3300003320 rootH2_10028426 rootH2_100284262 99
589 3300003323 rootH1_10139366 rootH1_101393662 99
590 3300003781 Ga0055536_1024910 Ga0055536_10249103 99
591 3300003794 Ga0055531_10014020 Ga0055531_100140205 99
592 3300003794 Ga0055531_10014865 Ga0055531_100148655 99
593 3300003856 Ga0058692_1000785 Ga0058692_10007854 99
594 3300005289 Ga0065704_10006278 Ga0065704_100062781 99
595 3300005289 Ga0065704_10030623 Ga0065704_100306232 99
596 3300005289 Ga0065704_10253178 Ga0065704_102531782 99
597 3300005347 Ga0070668_100303029 Ga0070668_1003030292 99
598 3300005354 Ga0070675_100666145 Ga0070675_1006661452 99
599 3300005441 Ga0070700_101225275 Ga0070700_1012252751 99
600 3300005530 Ga0070679_100466934 Ga0070679_1004669342 99
601 3300005548 Ga0070665_100152522 Ga0070665_1001525222 99
602 3300005548 Ga0070665_100308958 Ga0070665_1003089583 99
603 3300005840 Ga0068870_10298836 Ga0068870_102988362 99
604 3300005985 Ga0081539_10024522 Ga0081539_100245225 99
605 3300005985 Ga0081539_10412345 Ga0081539_104123452 99
606 3300006048 Ga0075363_100330491 Ga0075363_1003304912 99
607 3300006051 Ga0075364_10738799 Ga0075364_107387992 99
608 3300006177 Ga0075362_10516426 Ga0075362_105164262 99
609 3300006186 Ga0075369_10150290 Ga0075369_101502902 99
610 3300006186 Ga0075369_10383019 Ga0075369_103830192 99
611 3300006186 Ga0075369_10392157 Ga0075369_103921572 99
612 3300006195 Ga0075366_10356136 Ga0075366_103561362 99
613 3300009036 Ga0105244_10048884 Ga0105244_100488842 99
614 3300009148 Ga0105243_10036695 Ga0105243_100366954 99
615 3300009553 Ga0105249_11545416 Ga0105249_115454162 99
616 3300017792 Ga0163161_10172112 Ga0163161_101721123 99
617 3300020075 Ga0206349_1852705 Ga0206349_18527052 99
618 3300025245 Ga0207425_1000117 Ga0207425_100011740 99
619 3300025258 Ga0209129_1000011 Ga0209129_1000011341 99
620 3300025292 Ga0209676_1004379 Ga0209676_100437916 99
621 3300025294 Ga0209025_1000002 Ga0209025_1000002457 99
622 3300025297 Ga0209758_1000003 Ga0209758_1000003464 99
623 3300025298 Ga0209050_1025712 Ga0209050_10257123 99
624 3300025304 Ga0209257_1002665 Ga0209257_100266526 99
625 3300025304 Ga0209257_1005259 Ga0209257_10052595 99
626 3300025728 Ga0207655_1039647 Ga0207655_10396472 99
627 3300025907 Ga0207645_10245072 Ga0207645_102450721 99
628 3300025926 Ga0207659_10897028 Ga0207659_108970281 99
629 3300025935 Ga0207709_10000421 Ga0207709_1000042124 99
630 3300025972 Ga0207668_10071707 Ga0207668_100717072 99
631 3300026075 Ga0207708_10419749 Ga0207708_104197492 99
632 3300027312 Ga0209371_1000004 Ga0209371_10000041042 99
633 3300028379 Ga0268266_10168036 Ga0268266_101680364 99
634 3300028379 Ga0268266_10170446 Ga0268266_101704463 99
635 3300030500 Ga0268256_1000005 Ga0268256_10000055 99
636 3300031995 Ga0307409_101575233 Ga0307409_1015752331 99
637 3300032004 Ga0307414_10020644 Ga0307414_100206445 99
638 3300032004 Ga0307414_10046872 Ga0307414_100468722 99
639 3300032004 Ga0307414_10234802 Ga0307414_102348022 99
640 3300032005 Ga0307411_11554591 Ga0307411_115545912 99
641 3300038705 Ga0237819_00026 Ga0237819_00026_47856_48155 99
642 3300038705 Ga0237819_05137 Ga0237819_05137_1389_1688 99
643 3300041404 Ga0439436_0020558 Ga0439436_0020558_1017_1331 99
644 3300041413 Ga0439465_0005524 Ga0439465_0005524_2334_2648 99
645 3300041413 Ga0439465_0169776 Ga0439465_0169776_139_438 99
646 3300041443 Ga0451789_0611670 Ga0451789_0611670_67_381 99
647 3300041451 Ga0451791_0348064 Ga0451791_0348064_598_912 99
648 3300041452 Ga0451793_1022662 Ga0451793_1022662_623_937 99
649 3300041453 Ga0451797_0542817 Ga0451797_0542817_425_739 99
650 3300041455 Ga0451801_10668 Ga0451801_10668_23_337 99
651 3300041456 Ga0451795_1206484 Ga0451795_1206484_231_545 99
652 3300041458 Ga0451798_0378261 Ga0451798_0378261_581_895 99
653 3300041459 Ga0451800_0237753 Ga0451800_0237753_342_656 99
654 3300041460 Ga0451802_0845033 Ga0451802_0845033_189_503 99
655 3300041460 Ga0451802_0845984 Ga0451802_0845984_171_485 99
656 3300041460 Ga0451802_0882002 Ga0451802_0882002_46_360 99
657 3300041461 Ga0451805_060263 Ga0451805_060263_181_495 99
658 3300041463 Ga0451804_0354493 Ga0451804_0354493_179_493 99
659 3300041492 Ga0451835_0031836 Ga0451835_0031836_269_583 99
660 3300041494 Ga0451837_0144598 Ga0451837_0144598_169_483 99
661 3300041497 Ga0451840_04882 Ga0451840_04882_213_527 99
662 3300041498 Ga0451841_0137401 Ga0451841_0137401_294_608 99
663 3300041501 Ga0451845_0710242 Ga0451845_0710242_287_598 99
664 3300041509 Ga0451843_0901379 Ga0451843_0901379_298_612 99
665 3300041512 Ga0451853_2452886 Ga0451853_2452886_488_802 99
666 3300041997 Ga0439431_0008628 Ga0439431_0008628_1932_2246 99
667 3300041999 Ga0439433_0043496 Ga0439433_0043496_455_769 99
668 3300042007 Ga0439449_0039601 Ga0439449_0039601_428_742 99
669 3300042156 Ga0439446_0036071 Ga0439446_0036071_883_1197 99
670 3300042435 Ga0439434_0363768 Ga0439434_0363768_14_328 99
671 3300046507 Ga0495606_0035985 Ga0495606_0035985_2599_2898 99
672 3300046512 Ga0495610_0251536 Ga0495610_0251536_352_651 99
673 3300046513 Ga0495616_0270579 Ga0495616_0270579_232_546 99
674 3300046518 Ga0495631_0154725 Ga0495631_0154725_316_615 99
675 3300046525 Ga0495663_0004473 Ga0495663_0004473_1358_1672 99
676 3300046525 Ga0495663_0135107 Ga0495663_0135107_275_589 99
677 3300046539 Ga0495621_0001470 Ga0495621_0001470_3765_4079 99
678 3300046539 Ga0495621_0294762 Ga0495621_0294762_120_434 99
679 3300046558 Ga0495633_0318237 Ga0495633_0318237_198_497 99
680 3300046615 Ga0495656_0140966 Ga0495656_0140966_107_421 99
681 3300046660 Ga0495625_0591950 Ga0495625_0591950_340_654 99
682 3300046664 Ga0495659_0112299 Ga0495659_0112299_351_665 99
683 3300046691 Ga0495670_0101413 Ga0495670_0101413_1057_1371 99
684 3300046692 Ga0495671_0368709 Ga0495671_0368709_170_484 99
685 3300047318 Ga0495636_0613476 Ga0495636_0613476_102_416 99
686 3300048925 Ga0496122_0097842 Ga0496122_0097842_581_895 99
687 3300048926 Ga0496123_0146817 Ga0496123_0146817_177_491 99
688 3300048927 Ga0496124_0000018 Ga0496124_0000018_440515_440817 99
689 3300049571 Ga0501034_0819040 Ga0501034_0819040_59_358 99
690 3300050490 nmdc:mga03n38_414165_c1 nmdc:mga03n38_414165_c1_295_609 99
691 3300053142 Ga0500577_0396206 Ga0500577_0396206_27_341 99
692 3300053156 Ga0500622_0431422 Ga0500622_0431422_16_315 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

28

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6th6-assembly1.cif.gz_BW cryo-em structure of t. kodakarensis 70s ribosome 0.9503 8 92
6enj-assembly1.cif.gz_T polyproline-stalled ribosome in the presence of a+p site trna and elongation-factor p (ef-p) 0.9367 1 93
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9327 1 87
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9313 7 95
6spb-assembly1.cif.gz_T pseudomonas aeruginosa 50s ribosome from a clinical isolate with a mutation in ul6 0.9305 5 94
ID Description Score Start End Superfamily
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9522 7 92 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9332 7 94 3.30.70.330
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9229 7 92 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9222 1 93 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9117 1 93 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A1F8EU89-F1-model_v4 Large ribosomal subunit protein uL23 0.9639 7 97 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-I0III7-F1-model_v4 Large ribosomal subunit protein uL23 0.9633 7 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F8H612-F1-model_v4 Large ribosomal subunit protein uL23 0.9615 10 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2N6D798-F1-model_v4 Large ribosomal subunit protein uL23 0.9614 7 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y5FJR9-F1-model_v4 Large ribosomal subunit protein uL23 0.961 7 97 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
87.25 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map