F475587

General Info

Members Datasets Scaffolds Average Seq Length
692 499 561 174

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10223600|Ga0265338_102236002
Length 172
Sequence MAKTSSQKFIARNRCPRVQIEYDVELYGAEKKVELPFVMGVMADLTGKPAEGQEPPPVGDRKFLEIDVDNFDDRLKACKPRVAFQVPNTLTGEGNLSVEMTFDSMDDFSPAAVARKVDSLNKLLQTRTELANLLTYMDGKDKAEELIGRLLNDPELMKSLGSAPAPTVKPAE

Samples

Sample ID Description Type Environment
1 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
2 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
3 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
4 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
5 2519899620 Rhizobium sp. Pop5 Isolate Nodule
6 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
7 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
8 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
9 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
10 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
11 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
12 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
13 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
14 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified
15 2718217882 Rhizobium sp. N741 Isolate Nodule
16 2718217927 Rhizobium sp. N324 Isolate Nodule
17 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
18 2718218009 Rhizobium sp. N561 Isolate Nodule
19 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
20 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
21 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
22 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
23 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
24 2718218363 Rhizobium sp. N113 Isolate Nodule
25 2718218365 Rhizobium sp. N731 Isolate Nodule
26 2718218366 Rhizobium sp. N621 Isolate Nodule
27 2721755514 Rhizobium sp. N6212 Isolate Nodule
28 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
29 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
30 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
31 2721755810 Rhizobium sp. N871 Isolate Nodule
32 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
33 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
34 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
35 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
36 2728369365 Rhizobium sp. N1341 Isolate Nodule
37 2728369397 Rhizobium sp. N1314 Isolate Nodule
38 2734482264 Dyella sp. AD052 Isolate Unclassified
39 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
40 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
41 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
42 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
43 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
44 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
45 2738543009 Luteibacter sp. OK325 Isolate Unclassified
46 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
47 2791355256 Rhizobium sp. M10 Isolate Nodule
48 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
49 2791355260 Rhizobium sp. L9 Isolate Nodule
50 2791355261 Rhizobium sp. J15 Isolate Nodule
51 2791355262 Rhizobium sp. M1 Isolate Nodule
52 2791355263 Rhizobium chutanense C5 Isolate Nodule
53 2791355264 Rhizobium sp. S9 Isolate Nodule
54 2791355265 Rhizobium sp. H4 Isolate Nodule
55 2791355266 Rhizobium sp. L43 Isolate Nodule
56 2791355267 Rhizobium sp. L18 Isolate Nodule
57 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
58 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
59 2802429633 Rhizobium anhuiense J3 Isolate Nodule
60 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
61 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
62 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
63 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
64 2838048938 Rhizobium pisi 27/80 Isolate Nodule
65 2838061910 Rhizobium phaseoli L15 Isolate Nodule
66 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
67 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
68 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
69 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
70 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
71 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
72 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
73 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
74 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
75 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
76 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
77 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
78 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
79 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
80 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
81 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
82 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
83 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
84 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
85 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
86 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
87 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
88 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
89 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
90 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
91 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
92 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
93 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
94 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
95 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
96 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
97 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
98 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
99 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
100 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
101 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
102 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
103 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
104 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
105 2865014394 Pantoea sp. R-71966 Isolate Unclassified
106 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
107 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
108 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
109 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
110 2936381700 Rhizobium chutanense C16 Isolate Unclassified
111 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
112 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
113 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
114 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
115 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
116 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
117 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
118 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
119 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
120 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
121 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
122 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
123 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
124 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
125 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
126 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
127 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
128 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
129 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
130 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
131 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
132 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
133 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
134 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
135 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
136 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
138 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
139 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
140 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
141 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
142 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
143 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
144 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
145 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
146 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
147 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
148 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
149 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
150 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
151 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
152 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
153 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
154 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
155 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
156 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
157 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
158 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
159 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
160 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
161 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
162 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
163 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
164 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
165 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
166 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
167 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
168 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
169 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
170 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
171 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
172 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
173 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
174 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
175 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
176 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
177 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
178 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
179 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
180 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
181 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
182 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
183 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
184 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
185 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
186 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
187 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
188 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
189 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
190 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
191 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
192 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
193 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
194 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
195 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
196 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
197 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
198 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
199 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
200 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
201 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
202 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
203 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
204 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
205 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
206 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
207 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
208 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
209 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
210 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
211 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
212 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
213 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
214 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
215 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
216 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
217 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
218 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
219 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
220 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
221 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
222 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
223 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
224 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
225 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
226 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
227 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
228 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
229 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
230 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
231 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
232 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
233 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
234 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
235 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
236 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
237 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
238 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
239 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
240 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
241 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
242 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
243 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
244 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
245 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
246 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
247 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
249 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
251 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
252 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
253 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
255 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
256 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
259 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
262 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
264 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
265 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
266 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
316 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
320 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
321 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
323 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
324 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
325 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
326 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
327 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
328 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
329 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
330 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
331 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
332 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
333 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
340 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
341 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
342 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
343 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
344 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
345 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
346 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
347 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
348 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
349 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
350 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
351 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
352 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
353 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
354 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
355 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
356 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
357 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
358 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
359 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
360 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
361 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
362 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
363 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
364 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
365 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
366 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
367 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
368 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
369 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
370 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
371 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
372 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
373 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
374 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
375 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
376 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
377 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
378 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
379 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
380 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
381 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
382 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
383 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
384 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
385 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
386 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
387 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
388 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
389 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
390 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
391 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
392 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
393 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
394 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
395 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
396 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
397 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
398 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
399 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
400 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
401 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
402 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
403 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
404 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
405 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
406 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
407 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
408 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
409 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
410 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
411 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
412 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
413 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
414 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
415 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
416 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
417 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
418 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
419 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
420 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
421 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
422 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
423 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
424 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
425 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
426 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
427 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
428 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
429 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
430 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
431 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
432 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
433 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
434 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
435 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
436 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
437 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
438 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
439 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
440 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
441 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
442 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
443 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
444 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
446 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
447 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
448 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
449 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
450 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
453 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
454 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
455 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
456 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
457 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
458 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
459 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
460 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
461 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
462 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
464 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
465 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
466 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
467 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
468 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
469 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
470 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
471 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
472 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
473 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
474 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
475 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
476 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
477 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
478 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
479 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
480 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
481 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
482 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
483 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
484 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
485 639633007 Azoarcus olearius BH72 Isolate Unclassified
486 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
487 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
488 8005275841 Rhizobium sp. N4311 Isolate Nodule
489 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
490 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
491 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
492 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
493 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
494 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
495 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
496 8018176218 Rhizobium sp. N122 Isolate Nodule
497 8024501048 Rhizobium sp. H4 Isolate Nodule
498 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
499 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.17
Metatranscriptomes 3.76
Isolates 19.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.78
Nodule 14.16
Rhizoplane 3.76
Rhizosphere 64.74
Stem 0
Stem Tuber 0
Unclassified 11.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1020172 3300001977 Bacteria 936
2 JGI24739J22299_10056948 3300001989 Bacteria 1245
3 JGI25162J39368_1008911 3300002737 Bacteria 1391
4 JGI25154J39366_1000539 3300002738 Bacteria 18841
5 JGI25157J39369_1000018 3300002741 Bacteria 177410
6 JGI25159J45721_1008197 3300002987 Bacteria 2898
7 JGI25151J46595_10000340 3300003187 Bacteria 50006
8 JGI25153J46596_10022598 3300003215 Bacteria 2312
9 Ga0006770J48903_1073083 3300003305 Bacteria 550
10 rootH1_10008298 3300003316 Bacteria 7116
11 rootH1_10008298 3300003323 Bacteria 13422
12 rootH1_10017599 3300003316 Bacteria 8038
13 rootL2_10077243 3300003322 Bacteria 9028
14 JGI25160J50197_1000767 3300003354 Bacteria 17314
15 Ga0055539_1000437 3300003752 Bacteria 14566
16 Ga0055539_1001061 3300003752 Bacteria 5842
17 Ga0055533_1000011 3300003756 Bacteria 467893
18 Ga0055525_1000691 3300003759 Bacteria 12485
19 Ga0055535_1009861 3300003761 Bacteria 1611
20 Ga0055536_1001503 3300003781 Bacteria 14011
21 Ga0055540_1005504 3300003792 Bacteria 5299
22 Ga0058863_11714636 3300004799 Bacteria 701
23 Ga0058860_11994122 3300004801 Bacteria 1092
24 Ga0058860_12025189 3300004801 Bacteria 1529
25 Ga0065704_10121329 3300005289 Bacteria 1768
26 Ga0065712_10007612 3300005290 Bacteria 4322
27 Ga0065712_10443677 3300005290 Bacteria 692
28 Ga0065715_10011248 3300005293 Bacteria 2386
29 Ga0065715_10107974 3300005293 Bacteria 2741
30 Ga0065707_10174252 3300005295 Bacteria 1462
31 Ga0070658_10690559 3300005327 Bacteria 886
32 Ga0070683_100000387 3300005329 Bacteria 30469
33 Ga0070683_100089142 3300005329 Bacteria 2895
34 Ga0070690_100001642 3300005330 Bacteria 11759
35 Ga0070670_100032038 3300005331 Bacteria 4526
36 Ga0070670_100491359 3300005331 Bacteria 1091
37 Ga0070670_100806480 3300005331 Bacteria 848
38 Ga0068869_100029452 3300005334 Bacteria 3847
39 Ga0070666_10142274 3300005335 Bacteria 1671
40 Ga0070682_100808671 3300005337 Bacteria 762
41 Ga0068868_100094804 3300005338 Bacteria 2408
42 Ga0068868_100350634 3300005338 Bacteria 1264
43 Ga0070660_100833273 3300005339 Bacteria 776
44 Ga0070689_100001730 3300005340 Bacteria 13955
45 Ga0070689_100391515 3300005340 Bacteria 1173
46 Ga0070689_100809673 3300005340 Bacteria 824
47 Ga0070661_100142807 3300005344 Bacteria 1805
48 Ga0070668_100006994 3300005347 Bacteria 8361
49 Ga0070669_100000810 3300005353 Bacteria 22749
50 Ga0070669_100563751 3300005353 Bacteria 951
51 Ga0070675_100018854 3300005354 Bacteria 5494
52 Ga0070675_100519511 3300005354 Bacteria 1074
53 Ga0070675_100544653 3300005354 Bacteria 1049
54 Ga0070671_100032811 3300005355 Bacteria 4292
55 Ga0070671_100837463 3300005355 Bacteria 802
56 Ga0070671_101040503 3300005355 Bacteria 718
57 Ga0070688_100297510 3300005365 Bacteria 1165
58 Ga0070659_100445203 3300005366 Bacteria 1098
59 Ga0070659_101053508 3300005366 Bacteria 715
60 Ga0070667_100087043 3300005367 Bacteria 2681
61 Ga0070711_101221980 3300005439 Bacteria 650
62 Ga0070708_100829694 3300005445 Unclassified 869
63 Ga0070663_100022964 3300005455 Bacteria 4176
64 Ga0070678_100312544 3300005456 Bacteria 1339
65 Ga0070662_100126089 3300005457 Bacteria 1968
66 Ga0068867_100478716 3300005459 Bacteria 1066
67 Ga0070707_100191004 3300005468 Bacteria 1997
68 Ga0070698_100515477 3300005471 Bacteria 1134
69 Ga0070699_100037802 3300005518 Unclassified 4179
70 Ga0070679_100417650 3300005530 Bacteria 1287
71 Ga0070684_100000221 3300005535 Bacteria 39898
72 Ga0070697_100006665 3300005536 Bacteria 8957
73 Ga0068853_100539418 3300005539 Bacteria 1104
74 Ga0070672_100219876 3300005543 Bacteria 1593
75 Ga0070672_100300810 3300005543 Bacteria 1360
76 Ga0070686_100172160 3300005544 Bacteria 1532
77 Ga0070686_100314922 3300005544 Bacteria 1165
78 Ga0070695_100344913 3300005545 Bacteria 1114
79 Ga0070696_100479588 3300005546 Bacteria 986
80 Ga0070665_100114464 3300005548 Bacteria 2700
81 Ga0070665_100190780 3300005548 Bacteria 2050
82 Ga0070665_100411879 3300005548 Bacteria 1360
83 Ga0068855_100002070 3300005563 Bacteria 24846
84 Ga0068855_100096411 3300005563 Bacteria 3408
85 Ga0068855_101105248 3300005563 Bacteria 828
86 Ga0070664_100001047 3300005564 Bacteria 21733
87 Ga0070664_100211037 3300005564 Bacteria 1735
88 Ga0068857_100012736 3300005577 Bacteria 7329
89 Ga0068857_100013094 3300005577 Bacteria 7228
90 Ga0068856_100003249 3300005614 Bacteria 16544
91 Ga0068856_100067645 3300005614 Bacteria 3530
92 Ga0068856_100321156 3300005614 Bacteria 1565
93 Ga0068856_101435215 3300005614 Bacteria 704
94 Ga0070702_100070087 3300005615 Bacteria 2068
95 Ga0070702_100135005 3300005615 Bacteria 1564
96 Ga0068852_101368889 3300005616 Bacteria 730
97 Ga0068859_100902597 3300005617 Bacteria 968
98 Ga0068864_100210475 3300005618 Bacteria 1790
99 Ga0068861_100011157 3300005719 Bacteria 6239
100 Ga0068851_10127117 3300005834 Bacteria 1375
101 Ga0068858_100042506 3300005842 Bacteria 4214
102 Ga0068858_100228354 3300005842 Bacteria 1764
103 Ga0068862_100238646 3300005844 Bacteria 1652
104 Ga0081455_10499960 3300005937 Bacteria 817
105 Ga0081540_1046343 3300005983 Bacteria 2196
106 Ga0075363_100563875 3300006048 Bacteria 680
107 Ga0075364_10001642 3300006051 Bacteria 12275
108 Ga0070716_100364728 3300006173 Bacteria 1027
109 Ga0070712_100268044 3300006175 Bacteria 1371
110 Ga0075366_10132709 3300006195 Bacteria 1503
111 Ga0097621_100119281 3300006237 Bacteria 2236
112 Ga0068871_100580109 3300006358 Bacteria 1018
113 Ga0075428_100020972 3300006844 Bacteria 7238
114 Ga0075428_100124334 3300006844 Bacteria 2808
115 Ga0075428_100299789 3300006844 Bacteria 1728
116 Ga0075428_100942295 3300006844 Bacteria 915
117 Ga0075430_100000716 3300006846 Bacteria 25364
118 Ga0075431_100020300 3300006847 Bacteria 6786
119 Ga0075431_100290211 3300006847 Bacteria 1655
120 Ga0075431_100638363 3300006847 Bacteria 1046
121 Ga0075433_10052359 3300006852 Bacteria 3557
122 Ga0075434_100108516 3300006871 Bacteria 2786
123 Ga0075434_101061046 3300006871 Bacteria 824
124 Ga0075429_100005556 3300006880 Bacteria 10861
125 Ga0075429_100021139 3300006880 Bacteria 5642
126 Ga0075429_100164669 3300006880 Bacteria 1942
127 Ga0075429_100475425 3300006880 Bacteria 1095
128 Ga0068865_100692750 3300006881 Bacteria 870
129 Ga0097620_100902643 3300006931 Bacteria 968
130 Ga0105251_10315113 3300009011 Bacteria 710
131 Ga0105244_10038121 3300009036 Bacteria 2508
132 Ga0105244_10244760 3300009036 Bacteria 837
133 Ga0105250_10055792 3300009092 Bacteria 1585
134 Ga0105240_10138124 3300009093 Bacteria 2916
135 Ga0105240_10344605 3300009093 Bacteria 1692
136 Ga0105240_10417581 3300009093 Bacteria 1508
137 Ga0111539_10007570 3300009094 Bacteria 13881
138 Ga0111539_10332414 3300009094 Bacteria 1769
139 Ga0111539_11075457 3300009094 Bacteria 935
140 Ga0105245_10039092 3300009098 Bacteria 4223
141 Ga0114129_10015179 3300009147 Bacteria 10963
142 Ga0114129_10246155 3300009147 Bacteria 2402
143 Ga0114129_10711678 3300009147 Bacteria 1290
144 Ga0105243_10002392 3300009148 Bacteria 15724
145 Ga0105243_10884629 3300009148 Bacteria 887
146 Ga0105241_10113847 3300009174 Bacteria 2169
147 Ga0105241_10326067 3300009174 Bacteria 1326
148 Ga0105248_10045882 3300009177 Bacteria 4899
149 Ga0105248_10726498 3300009177 Bacteria 1120
150 Ga0105237_10025360 3300009545 Bacteria 6063
151 Ga0105237_11038102 3300009545 Bacteria 826
152 Ga0105238_10007111 3300009551 Bacteria 11199
153 Ga0105249_10002713 3300009553 Bacteria 15297
154 Ga0123341_1006170 3300009765 Bacteria 10805
155 Ga0123342_1018906 3300009766 Bacteria 5372
156 Ga0123342_1027741 3300009766 Bacteria 3132
157 Ga0105239_10284729 3300010375 Bacteria 1861
158 Ga0105239_10538941 3300010375 Bacteria 1329
159 Ga0105239_10756639 3300010375 Bacteria 1112
160 Ga0105239_11338040 3300010375 Bacteria 826
161 Ga0105246_10004710 3300011119 Bacteria 8304
162 Ga0105246_10017444 3300011119 Bacteria 4562
163 Ga0157373_10068497 3300013100 Bacteria 2508
164 Ga0157373_11080308 3300013100 Bacteria 601
165 Ga0157371_10310175 3300013102 Bacteria 1143
166 Ga0157371_10330882 3300013102 Bacteria 1107
167 Ga0157370_10120323 3300013104 Bacteria 2451
168 Ga0157370_10646277 3300013104 Bacteria 967
169 Ga0157369_10015923 3300013105 Bacteria 8467
170 Ga0157369_10053690 3300013105 Bacteria 4354
171 Ga0157369_10582141 3300013105 Bacteria 1156
172 Ga0157374_10036487 3300013296 Bacteria 4503
173 Ga0157374_10114702 3300013296 Bacteria 2594
174 Ga0157378_10029581 3300013297 Bacteria 4837
175 Ga0157378_11296510 3300013297 Unclassified 769
176 Ga0163162_10001320 3300013306 Bacteria 23166
177 Ga0163162_10252643 3300013306 Bacteria 1895
178 Ga0157372_10134794 3300013307 Bacteria 2843
179 Ga0157372_10171417 3300013307 Bacteria 2511
180 Ga0157375_10013045 3300013308 Bacteria 7384
181 Ga0157375_10984314 3300013308 Bacteria 984
182 Ga0157375_11198331 3300013308 Bacteria 891
183 Ga0163163_10073601 3300014325 Bacteria 3408
184 Ga0182008_10011812 3300014497 Bacteria 4631
185 Ga0182008_10067121 3300014497 Bacteria 1765
186 Ga0182008_10074079 3300014497 Bacteria 1675
187 Ga0157377_10778261 3300014745 Bacteria 703
188 Ga0157379_10141281 3300014968 Bacteria 2170
189 Ga0157376_10234776 3300014969 Bacteria 1705
190 Ga0157376_11957041 3300014969 Bacteria 623
191 Ga0182006_1046717 3300015261 Bacteria 1681
192 Ga0182007_10028397 3300015262 Bacteria 1922
193 Ga0163161_10000161 3300017792 Bacteria 61815
194 Ga0163161_10023197 3300017792 Bacteria 4374
195 Ga0163161_10118567 3300017792 Bacteria 1986
196 Ga0206352_10308299 3300020078 Bacteria 741
197 Ga0213872_10013913 3300021361 Unclassified 3761
198 Ga0213872_10035024 3300021361 Bacteria 2296
199 Ga0213874_10177113 3300021377 Bacteria 757
200 Ga0213874_10202220 3300021377 Bacteria 715
201 Ga0213876_10008738 3300021384 Bacteria 5473
202 Ga0213876_10032007 3300021384 Bacteria 2774
203 Ga0213875_10062661 3300021388 Bacteria 1739
204 Ga0213871_10030033 3300021441 Bacteria 1412
205 Ga0247553_100425 3300023672 Bacteria 1511
206 Ga0209760_106254 3300025207 Bacteria 955
207 Ga0209674_100003 3300025226 Bacteria 2196646
208 Ga0209674_100104 3300025226 Bacteria 154080
209 Ga0209672_100009 3300025228 Bacteria 883623
210 Ga0209563_100010 3300025230 Bacteria 1337457
211 Ga0209437_100035 3300025233 Bacteria 481110
212 Ga0209258_100011 3300025242 Bacteria 867542
213 Ga0209258_101616 3300025242 Bacteria 7335
214 Ga0209646_1000188 3300025246 Bacteria 76972
215 Ga0209026_1000033 3300025250 Bacteria 318512
216 Ga0209677_100068 3300025253 Bacteria 146135
217 Ga0209677_100159 3300025253 Bacteria 61322
218 Ga0209677_101949 3300025253 Bacteria 8239
219 Ga0209148_1000013 3300025254 Bacteria 956684
220 Ga0209759_1000024 3300025256 Bacteria 318512
221 Ga0207666_1005952 3300025271 Bacteria 1570
222 Ga0209455_1000012 3300025272 Bacteria 867234
223 Ga0209455_1039536 3300025272 Bacteria 727
224 Ga0209130_1000252 3300025284 Bacteria 67611
225 Ga0209676_1000361 3300025292 Bacteria 85925
226 Ga0209025_1000633 3300025294 Bacteria 62208
227 Ga0209758_1002743 3300025297 Bacteria 17298
228 Ga0207426_1000098 3300025302 Bacteria 264264
229 Ga0209051_1000184 3300025303 Bacteria 112134
230 Ga0209257_1014244 3300025304 Bacteria 3434
231 Ga0207656_10080509 3300025321 Bacteria 1463
232 Ga0207696_1003005 3300025711 Bacteria 7881
233 Ga0207655_1005696 3300025728 Bacteria 8419
234 Ga0207713_1000001 3300025735 Bacteria 2295391
235 Ga0207713_1000191 3300025735 Bacteria 85634
236 Ga0207713_1092495 3300025735 Bacteria 1060
237 Ga0207688_10126059 3300025901 Bacteria 1497
238 Ga0207680_10114877 3300025903 Bacteria 1752
239 Ga0207643_10125518 3300025908 Bacteria 1523
240 Ga0207684_11056103 3300025910 Bacteria 678
241 Ga0207654_10061360 3300025911 Bacteria 2200
242 Ga0207654_10406732 3300025911 Bacteria 947
243 Ga0207695_10000367 3300025913 Bacteria 103313
244 Ga0207695_10009048 3300025913 Bacteria 12379
245 Ga0207695_10096782 3300025913 Bacteria 2953
246 Ga0207695_10320613 3300025913 Bacteria 1439
247 Ga0207671_10033198 3300025914 Bacteria 3840
248 Ga0207693_10257805 3300025915 Bacteria 1368
249 Ga0207693_10274949 3300025915 Unclassified 1320
250 Ga0207663_10924975 3300025916 Bacteria 698
251 Ga0207657_10050442 3300025919 Bacteria 3622
252 Ga0207649_10449572 3300025920 Bacteria 972
253 Ga0207652_10299642 3300025921 Bacteria 1451
254 Ga0207646_10157502 3300025922 Bacteria 2049
255 Ga0207646_10192556 3300025922 Bacteria 1842
256 Ga0207681_10003328 3300025923 Bacteria 10062
257 Ga0207694_10441111 3300025924 Bacteria 1086
258 Ga0207650_10021599 3300025925 Bacteria 4548
259 Ga0207650_10202213 3300025925 Bacteria 1592
260 Ga0207659_10014095 3300025926 Bacteria 5147
261 Ga0207659_10200081 3300025926 Bacteria 1595
262 Ga0207664_10166103 3300025929 Bacteria 1886
263 Ga0207644_10024515 3300025931 Bacteria 4143
264 Ga0207644_10758387 3300025931 Bacteria 811
265 Ga0207690_10519281 3300025932 Bacteria 965
266 Ga0207706_10446359 3300025933 Bacteria 1119
267 Ga0207709_10001520 3300025935 Bacteria 16003
268 Ga0207709_10224695 3300025935 Bacteria 1356
269 Ga0207670_10001268 3300025936 Bacteria 13343
270 Ga0207670_10364038 3300025936 Bacteria 1148
271 Ga0207704_10693974 3300025938 Bacteria 842
272 Ga0207665_10023132 3300025939 Bacteria 4093
273 Ga0207665_10129343 3300025939 Bacteria 1791
274 Ga0207691_10155232 3300025940 Bacteria 2010
275 Ga0207691_10176513 3300025940 Bacteria 1868
276 Ga0207711_10024965 3300025941 Bacteria 5013
277 Ga0207711_10055594 3300025941 Bacteria 3398
278 Ga0207689_10014798 3300025942 Bacteria 6623
279 Ga0207661_10001828 3300025944 Bacteria 14543
280 Ga0207661_10759338 3300025944 Bacteria 893
281 Ga0207679_10000614 3300025945 Bacteria 23779
282 Ga0207667_10053462 3300025949 Bacteria 4250
283 Ga0207712_10021071 3300025961 Bacteria 4275
284 Ga0207668_10133391 3300025972 Bacteria 1899
285 Ga0207658_10135093 3300025986 Bacteria 1987
286 Ga0207658_11528736 3300025986 Bacteria 610
287 Ga0207677_10464250 3300026023 Bacteria 1087
288 Ga0207703_10194438 3300026035 Bacteria 1799
289 Ga0207708_10335657 3300026075 Bacteria 1237
290 Ga0207702_10000553 3300026078 Bacteria 41640
291 Ga0207702_10010507 3300026078 Bacteria 7743
292 Ga0207702_10748049 3300026078 Bacteria 965
293 Ga0207674_10004589 3300026116 Bacteria 16584
294 Ga0207674_10018697 3300026116 Bacteria 7524
295 Ga0207675_100042747 3300026118 Bacteria 4231
296 Ga0207683_10297604 3300026121 Bacteria 1476
297 Ga0207698_10054912 3300026142 Bacteria 3067
298 Ga0209371_1002254 3300027312 Bacteria 11080
299 Ga0209371_1003244 3300027312 Bacteria 8116
300 Ga0207428_10074873 3300027907 Bacteria 2654
301 Ga0268266_10514215 3300028379 Bacteria 1144
302 Ga0268266_10601452 3300028379 Bacteria 1056
303 Ga0268266_10774798 3300028379 Bacteria 926
304 Ga0268265_10097078 3300028380 Bacteria 2370
305 Ga0268264_10529128 3300028381 Bacteria 1153
306 Ga0268264_11157188 3300028381 Bacteria 783
307 Ga0265338_10223600 3300028800 Bacteria 1405
308 Ga0268256_1001589 3300030500 Bacteria 13256
309 Ga0265768_100242 3300030963 Bacteria 2021
310 Ga0265327_10007638 3300031251 Bacteria 8287
311 Ga0265316_10043108 3300031344 Bacteria 3601
312 Ga0265316_10069217 3300031344 Bacteria 2724
313 Ga0265316_10222637 3300031344 Bacteria 1392
314 Ga0316579_10013986 3300031691 Bacteria 3461
315 Ga0316579_10041831 3300031691 Bacteria 2127
316 Ga0316576_10009927 3300031727 Bacteria 6162
317 Ga0316576_10092149 3300031727 Bacteria 2258
318 Ga0316576_10170496 3300031727 Bacteria 1642
319 Ga0316576_10170499 3300031727 Bacteria 1642
320 Ga0316578_10179341 3300031728 Bacteria 1276
321 Ga0316578_10301757 3300031728 Bacteria 957
322 Ga0316577_10041335 3300031733 Bacteria 2579
323 Ga0316577_10051452 3300031733 Bacteria 2298
324 Ga0307412_10016003 3300031911 Bacteria 4457
325 Ga0307414_10098255 3300032004 Bacteria 2196
326 Ga0316583_10033426 3300032133 Bacteria 1827
327 Ga0316583_10173901 3300032133 Bacteria 749
328 Ga0316585_10005378 3300032137 Bacteria 3612
329 Ga0316580_10001491 3300032139 Bacteria 6134
330 Ga0316593_10000488 3300032168 Bacteria 7342
331 Ga0316593_10020556 3300032168 Bacteria 2054
332 Ga0316592_1001006 3300033524 Bacteria 4353
333 Ga0316592_1002951 3300033524 Bacteria 3003
334 Ga0316592_1003160 3300033524 Bacteria 2937
335 Ga0316592_1042423 3300033524 Bacteria 1008
336 Ga0316592_1046781 3300033524 Unclassified 963
337 Ga0316592_1085722 3300033524 Bacteria 718
338 Ga0316586_1002585 3300033527 Bacteria 2276
339 Ga0316586_1029737 3300033527 Bacteria 931
340 Ga0316588_1018969 3300033528 Bacteria 1545
341 Ga0316588_1021639 3300033528 Bacteria 1464
342 Ga0316587_1001414 3300033529 Bacteria 2949
343 Ga0316596_1029621 3300033541 Bacteria 1417
344 Ga0373934_0002760 3300035086 Bacteria 6439
345 Ga0316574_0007153 3300035398 Bacteria 6101
346 Ga0316574_0016600 3300035398 Bacteria 4293
347 Ga0316584_0416826 3300036712 Bacteria 954
348 Ga0395900_0237124 3300037418 Bacteria 1832
349 Ga0395898_0433956 3300037466 Bacteria 1252
350 Ga0316581_0121049 3300037588 Bacteria 807
351 Ga0316581_0165608 3300037588 Bacteria 681
352 Ga0436364_0037831 3300037853 Bacteria 3819
353 Ga0436364_1085191 3300037853 Bacteria 15736
354 Ga0395901_0020370 3300038443 Bacteria 6790
355 Ga0395901_0818530 3300038443 Bacteria 919
356 Ga0400485_05534 3300038735 Bacteria 1644
357 Ga0400483_199082 3300039062 Bacteria 3226
358 Ga0400489_37544 3300039093 Bacteria 5843
359 Ga0400487_10280 3300039110 Bacteria 138613
360 Ga0400487_17580 3300039110 Bacteria 5719
361 Ga0400487_41326 3300039110 Bacteria 1229
362 Ga0436365_0647074 3300039437 Bacteria 3335
363 Ga0436365_1112230 3300039437 Bacteria 19675
364 Ga0436365_1625636 3300039437 Bacteria 6413
365 Ga0436360_0122311 3300039438 Bacteria 6258
366 Ga0436360_0619086 3300039438 Bacteria 1074
367 Ga0436360_0735944 3300039438 Bacteria 5963
368 Ga0436360_0885445 3300039438 Bacteria 1485
369 Ga0436360_1317915 3300039438 Bacteria 1677
370 Ga0436361_0013250 3300039447 Bacteria 11384
371 Ga0436361_0193310 3300039447 Bacteria 2431
372 Ga0436361_0294503 3300039447 Bacteria 2459
373 Ga0436361_0298641 3300039447 Bacteria 4915
374 Ga0436361_0528059 3300039447 Bacteria 2892
375 Ga0436361_0740948 3300039447 Bacteria 4091
376 Ga0436363_0479409 3300039450 Bacteria 7404
377 Ga0436363_1298424 3300039450 Bacteria 747
378 Ga0436363_1688978 3300039450 Bacteria 1769
379 Ga0436362_0579570 3300039453 Bacteria 1200
380 Ga0436362_0829410 3300039453 Bacteria 1298
381 Ga0436362_0999886 3300039453 Bacteria 1176
382 Ga0436362_1117703 3300039453 Bacteria 1405
383 Ga0439436_0003170 3300041404 Bacteria 4986
384 Ga0439438_038442 3300041405 Bacteria 1249
385 Ga0439439_0015255 3300041406 Bacteria 1874
386 Ga0439466_0000057 3300041411 Bacteria 45095
387 Ga0439465_0007042 3300041413 Bacteria 3573
388 Ga0439465_0197813 3300041413 Bacteria 732
389 Ga0451839_0778740 3300041496 Bacteria 599
390 Ga0451841_0317458 3300041498 Bacteria 1381
391 Ga0439431_0008305 3300041997 Bacteria 2332
392 Ga0439432_107314 3300042006 Bacteria 832
393 Ga0439449_0001163 3300042007 Bacteria 10312
394 Ga0439452_020204 3300042010 Bacteria 1750
395 Ga0439457_009092 3300042014 Bacteria 2320
396 Ga0439462_0006135 3300042015 Bacteria 2979
397 Ga0439463_054315 3300042016 Bacteria 1022
398 Ga0450907_000087 3300042146 Bacteria 36820
399 Ga0439464_0011074 3300042439 Bacteria 2384
400 Ga0451577_0000645 3300042876 Bacteria 55477
401 Ga0451577_0005076 3300042876 Bacteria 13585
402 Ga0453684_0000625 3300044712 Bacteria 128854
403 Ga0453684_0005496 3300044712 Bacteria 25046
404 Ga0453684_0151515 3300044712 Bacteria 2755
405 Ga0453684_2081223 3300044712 Bacteria 570
406 Ga0451576_0369423 3300045051 Bacteria 1503
407 Ga0451576_0504970 3300045051 Bacteria 1270
408 Ga0466967_0640524 3300045976 Bacteria 1051
409 Ga0466967_0671875 3300045976 Bacteria 1025
410 Ga0466967_1128638 3300045976 Bacteria 781
411 Ga0495617_000351 3300046452 Bacteria 25399
412 Ga0495627_004507 3300046453 Bacteria 5809
413 Ga0495590_0000330 3300046457 Bacteria 24619
414 Ga0495591_000771 3300046458 Bacteria 23136
415 Ga0495638_0017837 3300046460 Bacteria 4724
416 Ga0495650_0049242 3300046471 Bacteria 1751
417 Ga0495605_0002234 3300046474 Bacteria 12096
418 Ga0495607_0015910 3300046501 Bacteria 4863
419 Ga0495607_0176321 3300046501 Bacteria 1075
420 Ga0495583_0301096 3300046506 Bacteria 637
421 Ga0495606_0001952 3300046507 Bacteria 25463
422 Ga0495606_0081511 3300046507 Bacteria 2011
423 Ga0495606_0213863 3300046507 Bacteria 1090
424 Ga0495610_0043936 3300046512 Bacteria 2222
425 Ga0495610_0071082 3300046512 Bacteria 1623
426 Ga0495632_0001068 3300046519 Bacteria 23479
427 Ga0495648_0011077 3300046524 Bacteria 6827
428 Ga0495648_0056432 3300046524 Bacteria 2363
429 Ga0495642_0145131 3300046528 Bacteria 1025
430 Ga0495667_0344900 3300046559 Bacteria 941
431 Ga0495611_0038153 3300046648 Bacteria 2136
432 Ga0495625_0111134 3300046660 Bacteria 1873
433 Ga0495635_0099457 3300046663 Bacteria 1988
434 Ga0495661_0000628 3300046665 Bacteria 35864
435 Ga0495669_0018905 3300046684 Bacteria 2968
436 Ga0495613_0172168 3300046689 Bacteria 1536
437 Ga0495670_0040760 3300046691 Bacteria 2316
438 Ga0495589_0040157 3300046794 Bacteria 2337
439 Ga0495660_0056313 3300046810 Bacteria 2124
440 Ga0495660_0140598 3300046810 Bacteria 1202
441 Ga0495636_0337480 3300047318 Bacteria 710
442 Ga0495674_0279321 3300047319 Bacteria 1368
443 Ga0495672_0000418 3300047320 Bacteria 51297
444 Ga0495683_0234612 3300047323 Bacteria 812
445 Ga0495675_0454107 3300047444 Bacteria 741
446 Ga0495679_002048 3300047446 Bacteria 10643
447 Ga0495679_047506 3300047446 Bacteria 1302
448 Ga0495685_143103 3300047447 Bacteria 778
449 Ga0495673_0062452 3300047469 Bacteria 1591
450 Ga0495673_0063322 3300047469 Bacteria 1577
451 Ga0495681_0029578 3300047470 Bacteria 2802
452 Ga0495684_0171327 3300047471 Unclassified 1614
453 Ga0495686_0026685 3300047472 Bacteria 3778
454 Ga0495626_0253806 3300048091 Bacteria 705
455 Ga0496100_0065607 3300048903 Bacteria 2406
456 Ga0496100_0271530 3300048903 Bacteria 1261
457 Ga0496101_0165589 3300048904 Bacteria 1697
458 Ga0496101_0364762 3300048904 Bacteria 1136
459 Ga0496102_0005459 3300048905 Bacteria 10782
460 Ga0496102_0029734 3300048905 Bacteria 4889
461 Ga0496103_0601470 3300048906 Bacteria 700
462 Ga0496104_0001980 3300048907 Bacteria 17748
463 Ga0496104_0261089 3300048907 Bacteria 1645
464 Ga0496105_0002026 3300048908 Bacteria 14644
465 Ga0496105_0127690 3300048908 Bacteria 2096
466 Ga0496105_0449582 3300048908 Bacteria 1017
467 Ga0496105_0650575 3300048908 Bacteria 813
468 Ga0496106_0181996 3300048909 Bacteria 1668
469 Ga0496107_0093129 3300048910 Bacteria 2203
470 Ga0496108_0008532 3300048911 Bacteria 8311
471 Ga0496108_0927943 3300048911 Bacteria 746
472 Ga0496109_0004929 3300048912 Bacteria 11141
473 Ga0496110_0000797 3300048913 Bacteria 22029
474 Ga0496111_0001605 3300048914 Bacteria 13078
475 Ga0496112_0002405 3300048915 Bacteria 15065
476 Ga0496113_0065318 3300048916 Bacteria 2754
477 Ga0496113_1016570 3300048916 Bacteria 652
478 Ga0496114_0432381 3300048917 Bacteria 1166
479 Ga0496116_0016892 3300048919 Bacteria 5691
480 Ga0496117_0000004 3300048920 Bacteria 877131
481 Ga0496117_0000602 3300048920 Bacteria 58964
482 Ga0496118_0000072 3300048921 Bacteria 201387
483 Ga0496118_0000232 3300048921 Bacteria 97818
484 Ga0496118_0059872 3300048921 Bacteria 2832
485 Ga0496119_0000064 3300048922 Bacteria 167571
486 Ga0496119_0004654 3300048922 Bacteria 13530
487 Ga0496120_0000067 3300048923 Bacteria 167571
488 Ga0496120_0000733 3300048923 Bacteria 48086
489 Ga0496121_0000047 3300048924 Bacteria 335768
490 Ga0496122_0001991 3300048925 Bacteria 30461
491 Ga0496122_0236883 3300048925 Bacteria 1032
492 Ga0496123_0000620 3300048926 Bacteria 59624
493 Ga0496123_0001262 3300048926 Bacteria 36371
494 Ga0496123_0093427 3300048926 Bacteria 1776
495 Ga0496124_0011554 3300048927 Bacteria 8811
496 Ga0496124_0020783 3300048927 Bacteria 6058
497 Ga0496124_0026780 3300048927 Bacteria 5191
498 Ga0496124_0067980 3300048927 Bacteria 2963
499 Ga0496125_0010211 3300048928 Bacteria 9519
500 Ga0496126_0094497 3300048929 Bacteria 2623
501 Ga0501305_045353 3300049161 Bacteria 725
502 Ga0495678_023508 3300049459 Bacteria 2677
503 Ga0495682_0118519 3300049460 Bacteria 948
504 Ga0501032_0010263 3300049569 Bacteria 6757
505 Ga0501033_0044696 3300049570 Bacteria 3297
506 Ga0501034_0000360 3300049571 Bacteria 77568
507 Ga0501036_0052069 3300049572 Bacteria 3467
508 Ga0501037_0017106 3300049573 Bacteria 5336
509 Ga0501038_0001066 3300049574 Bacteria 24743
510 Ga0501039_0057645 3300049575 Bacteria 3008
511 Ga0501040_0240972 3300049576 Bacteria 1289
512 Ga0501041_0337238 3300049577 Bacteria 952
513 Ga0501043_0141259 3300049579 Bacteria 1886
514 Ga0501043_0277487 3300049579 Bacteria 1285
515 Ga0501047_0051264 3300049581 Bacteria 3987
516 Ga0501070_0256868 3300049586 Bacteria 1429
517 Ga0501070_0892663 3300049586 Bacteria 694
518 Ga0501071_0043370 3300049587 Bacteria 3225
519 Ga0501072_0187412 3300049588 Bacteria 1650
520 Ga0501073_0086140 3300049589 Bacteria 2185
521 Ga0501073_0642243 3300049589 Bacteria 733
522 Ga0501075_0146537 3300049591 Bacteria 1799
523 Ga0501076_0126635 3300049592 Bacteria 2070
524 Ga0501077_0301729 3300049593 Bacteria 1020
525 Ga0501079_0020772 3300049741 Bacteria 5021
526 Ga0501080_0050121 3300049742 Bacteria 3887
527 Ga0501080_0419990 3300049742 Bacteria 1201
528 Ga0501081_0577002 3300049743 Bacteria 841
529 Ga0501035_0141518 3300049822 Bacteria 2091
530 Ga0501044_0751562 3300049823 Bacteria 857
531 Ga0501045_0079226 3300049824 Bacteria 2422
532 nmdc:mga00v17_573_c1 3300050491 Bacteria 20549
533 nmdc:mga00v17_6948_c2 3300050491 Bacteria 3215
534 nmdc:mga05p37_572542_c1 3300050507 Bacteria 1281
535 nmdc:mga05p37_767580_c1 3300050507 Bacteria 1060
536 nmdc:mga05p37_84853_c1 3300050507 Bacteria 3902
537 nmdc:mga09592_102526_c1 3300050508 Bacteria 2451
538 nmdc:mga09592_123224_c1 3300050508 Bacteria 2227
539 nmdc:mga09592_454_c1 3300050508 Bacteria 30435
540 nmdc:mga0qj67_3504_c1 3300050509 Bacteria 11318
541 nmdc:mga06r32_1074283_c1 3300050510 Bacteria 755
542 nmdc:mga06r32_4114_c1 3300050510 Bacteria 13027
543 nmdc:mga06r32_873478_c1 3300050510 Bacteria 857
544 nmdc:mga08y16_132674_c1 3300050511 Bacteria 2589
545 nmdc:mga08y16_6519_c1 3300050511 Bacteria 12241
546 nmdc:mga08y16_659104_c1 3300050511 Bacteria 1050
547 nmdc:mga0n895_419834_c1 3300050512 Bacteria 1352
548 nmdc:mga0n895_555639_c1 3300050512 Bacteria 1153
549 nmdc:mga0rr50_321004_c1 3300050513 Bacteria 1298
550 nmdc:mga0a205_81623_c1 3300050515 Bacteria 3123
551 Ga0495619_0225062 3300053085 Bacteria 1299
552 Ga0500568_0075403 3300053139 Bacteria 1286
553 Ga0500622_0009545 3300053156 Bacteria 5364
554 Ga0501084_0074109 3300054114 Bacteria 2850
555 Ga0587082_109187 3300059504 Bacteria 612
556 Ga0587085_024346 3300059506 Bacteria 948
557 Ga0587079_094509 3300059647 Bacteria 705
558 Ga0587105_014637 3300059651 Bacteria 637
559 Ga0501082_0108180 3300060353 Bacteria 2406
560 Ga0466962_0393800 3300061719 Bacteria 693
561 Ga0530510_0173840 3300061734 Bacteria 1596

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050491 nmdc:mga00v17_6948_c2 nmdc:mga00v17_6948_c2_1289_1819 151
2 3300006048 Ga0075363_100563875 Ga0075363_1005638751 154
3 iso_pu_bacteria 2738541317 2738947197 159
4 iso_pu_bacteria 2913308742 2913312706 159
5 iso_pu_bacteria 2643221577 2643896951 160
6 iso_pu_bacteria 2643221685 2644479158 160
7 iso_pu_bacteria 2608642108 2608669145 161
8 iso_pu_bacteria 2791355123 2792751043 161
9 iso_pu_bacteria 2844528606 2844530645 161
10 iso_pu_bacteria 2865014394 2865018577 161
11 iso_pu_bacteria 2882632389 2882637740 161
12 iso_pu_bacteria 2945951305 2945953317 161
13 iso_pu_bacteria 2978975091 2978975847 161
14 3300005546 Ga0070696_100479588 Ga0070696_1004795882 162
15 3300053156 Ga0500622_0009545 Ga0500622_0009545_4212_4706 162
16 iso_pu_bacteria 2687453341 2688393926 162
17 iso_pu_bacteria 2718218334 2721027451 162
18 iso_pu_bacteria 2734482264 2735836975 162
19 iso_pu_bacteria 2738541296 2738822698 162
20 iso_pu_bacteria 2738541298 2738834905 162
21 iso_pu_bacteria 2738541306 2738876384 162
22 iso_pu_bacteria 2738543002 2739188328 162
23 iso_pu_bacteria 2738543008 2739222981 162
24 iso_pu_bacteria 2738543009 2739226376 162
25 iso_pu_bacteria 2894510363 2894512328 162
26 iso_pu_bacteria 2945934425 2945940000 162
27 iso_pu_bacteria 2990703756 2990707124 162
28 iso_pu_bacteria 641736151 642424080 162
29 3300006844 Ga0075428_100942295 Ga0075428_1009422951 163
30 3300006847 Ga0075431_100638363 Ga0075431_1006383632 163
31 3300006880 Ga0075429_100164669 Ga0075429_1001646692 163
32 3300009147 Ga0114129_10711678 Ga0114129_107116782 163
33 iso_pu_bacteria 2537561836 2538833918 163
34 iso_pu_bacteria 2643221562 2643831748 163
35 iso_pu_bacteria 3000376612 3000377678 163
36 iso_pu_bacteria 639633007 639789062 163
37 3300002737 JGI25162J39368_1008911 JGI25162J39368_10089112 164
38 3300005347 Ga0070668_100006994 Ga0070668_1000069945 164
39 3300005353 Ga0070669_100563751 Ga0070669_1005637512 164
40 3300005548 Ga0070665_100411879 Ga0070665_1004118791 164
41 3300005563 Ga0068855_100096411 Ga0068855_1000964114 164
42 3300005614 Ga0068856_100067645 Ga0068856_1000676452 164
43 3300009011 Ga0105251_10315113 Ga0105251_103151131 164
44 3300009036 Ga0105244_10038121 Ga0105244_100381211 164
45 3300009036 Ga0105244_10244760 Ga0105244_102447602 164
46 3300009174 Ga0105241_10326067 Ga0105241_103260672 164
47 3300011119 Ga0105246_10004710 Ga0105246_100047109 164
48 3300013100 Ga0157373_10068497 Ga0157373_100684971 164
49 3300013100 Ga0157373_11080308 Ga0157373_110803081 164
50 3300013102 Ga0157371_10310175 Ga0157371_103101751 164
51 3300013104 Ga0157370_10120323 Ga0157370_101203232 164
52 3300013105 Ga0157369_10053690 Ga0157369_100536904 164
53 3300013307 Ga0157372_10134794 Ga0157372_101347943 164
54 3300013307 Ga0157372_10171417 Ga0157372_101714171 164
55 3300014497 Ga0182008_10067121 Ga0182008_100671212 164
56 3300015261 Ga0182006_1046717 Ga0182006_10467172 164
57 3300015262 Ga0182007_10028397 Ga0182007_100283972 164
58 3300017792 Ga0163161_10023197 Ga0163161_100231972 164
59 3300020078 Ga0206352_10308299 Ga0206352_103082991 164
60 3300025207 Ga0209760_106254 Ga0209760_1062542 164
61 3300025226 Ga0209674_100104 Ga0209674_10010424 164
62 3300025228 Ga0209672_100009 Ga0209672_100009426 164
63 3300025233 Ga0209437_100035 Ga0209437_100035456 164
64 3300025242 Ga0209258_100011 Ga0209258_100011218 164
65 3300025253 Ga0209677_101949 Ga0209677_1019499 164
66 3300025254 Ga0209148_1000013 Ga0209148_1000013218 164
67 3300025272 Ga0209455_1000012 Ga0209455_1000012218 164
68 3300025711 Ga0207696_1003005 Ga0207696_10030057 164
69 3300025728 Ga0207655_1005696 Ga0207655_10056965 164
70 3300025735 Ga0207713_1000001 Ga0207713_1000001757 164
71 3300025735 Ga0207713_1092495 Ga0207713_10924951 164
72 3300025911 Ga0207654_10406732 Ga0207654_104067322 164
73 3300025913 Ga0207695_10000367 Ga0207695_1000036728 164
74 3300025929 Ga0207664_10166103 Ga0207664_101661033 164
75 3300025972 Ga0207668_10133391 Ga0207668_101333912 164
76 3300026078 Ga0207702_10010507 Ga0207702_100105079 164
77 3300027312 Ga0209371_1002254 Ga0209371_100225411 164
78 3300027312 Ga0209371_1003244 Ga0209371_10032447 164
79 3300028379 Ga0268266_10601452 Ga0268266_106014522 164
80 3300030500 Ga0268256_1001589 Ga0268256_10015894 164
81 3300041405 Ga0439438_038442 Ga0439438_038442_552_1097 164
82 3300041411 Ga0439466_0000057 Ga0439466_0000057_39290_39835 164
83 3300041498 Ga0451841_0317458 Ga0451841_0317458_800_1309 164
84 3300042006 Ga0439432_107314 Ga0439432_107314_71_616 164
85 3300042010 Ga0439452_020204 Ga0439452_020204_127_672 164
86 3300042016 Ga0439463_054315 Ga0439463_054315_62_607 164
87 3300042146 Ga0450907_000087 Ga0450907_000087_16684_17229 164
88 3300042439 Ga0439464_0011074 Ga0439464_0011074_1770_2315 164
89 3300046453 Ga0495627_004507 Ga0495627_004507_3990_4490 164
90 3300046458 Ga0495591_000771 Ga0495591_000771_21224_21724 164
91 3300046501 Ga0495607_0015910 Ga0495607_0015910_2984_3484 164
92 3300046519 Ga0495632_0001068 Ga0495632_0001068_21614_22114 164
93 3300046524 Ga0495648_0011077 Ga0495648_0011077_2522_3067 164
94 3300046665 Ga0495661_0000628 Ga0495661_0000628_1413_1913 164
95 3300046810 Ga0495660_0056313 Ga0495660_0056313_685_1230 164
96 3300047320 Ga0495672_0000418 Ga0495672_0000418_4847_5392 164
97 3300047446 Ga0495679_002048 Ga0495679_002048_1666_2211 164
98 3300047469 Ga0495673_0062452 Ga0495673_0062452_478_978 164
99 3300047470 Ga0495681_0029578 Ga0495681_0029578_1286_1786 164
100 3300048903 Ga0496100_0271530 Ga0496100_0271530_332_877 164
101 3300048905 Ga0496102_0029734 Ga0496102_0029734_1925_2470 164
102 3300048908 Ga0496105_0002026 Ga0496105_0002026_10455_11000 164
103 3300048908 Ga0496105_0650575 Ga0496105_0650575_171_716 164
104 3300048919 Ga0496116_0016892 Ga0496116_0016892_5084_5629 164
105 3300048920 Ga0496117_0000004 Ga0496117_0000004_252471_253016 164
106 3300048920 Ga0496117_0000602 Ga0496117_0000602_17811_18356 164
107 3300048921 Ga0496118_0000072 Ga0496118_0000072_200781_201326 164
108 3300048921 Ga0496118_0000232 Ga0496118_0000232_65612_66157 164
109 3300048922 Ga0496119_0000064 Ga0496119_0000064_119159_119704 164
110 3300048922 Ga0496119_0004654 Ga0496119_0004654_9732_10277 164
111 3300048923 Ga0496120_0000067 Ga0496120_0000067_47869_48414 164
112 3300048923 Ga0496120_0000733 Ga0496120_0000733_5641_6186 164
113 3300048924 Ga0496121_0000047 Ga0496121_0000047_25322_25867 164
114 3300048925 Ga0496122_0001991 Ga0496122_0001991_16601_17146 164
115 3300048925 Ga0496122_0236883 Ga0496122_0236883_171_716 164
116 3300048926 Ga0496123_0000620 Ga0496123_0000620_40545_41090 164
117 3300048926 Ga0496123_0093427 Ga0496123_0093427_685_1230 164
118 3300048927 Ga0496124_0011554 Ga0496124_0011554_1373_1918 164
119 3300048927 Ga0496124_0026780 Ga0496124_0026780_4471_5016 164
120 3300048928 Ga0496125_0010211 Ga0496125_0010211_3351_3896 164
121 3300048929 Ga0496126_0094497 Ga0496126_0094497_140_685 164
122 3300049459 Ga0495678_023508 Ga0495678_023508_1050_1595 164
123 3300049460 Ga0495682_0118519 Ga0495682_0118519_424_924 164
124 3300049586 Ga0501070_0892663 Ga0501070_0892663_29_541 164
125 3300050507 nmdc:mga05p37_572542_c1 nmdc:mga05p37_572542_c1_223_747 164
126 3300050508 nmdc:mga09592_102526_c1 nmdc:mga09592_102526_c1_947_1471 164
127 3300050510 nmdc:mga06r32_873478_c1 nmdc:mga06r32_873478_c1_218_742 164
128 iso_pu_bacteria 2513237093 2513636271 164
129 iso_pu_bacteria 2513237156 2513988173 164
130 iso_pu_bacteria 2515154134 2515744540 164
131 iso_pu_bacteria 2516653085 2517081945 164
132 iso_pu_bacteria 2519899620 2520381760 164
133 iso_pu_bacteria 2529292951 2530649693 164
134 iso_pu_bacteria 2588253730 2588513610 164
135 iso_pu_bacteria 2615840624 2616298376 164
136 iso_pu_bacteria 2718217882 2719178995 164
137 iso_pu_bacteria 2718217927 2719383551 164
138 iso_pu_bacteria 2718217997 2719663352 164
139 iso_pu_bacteria 2718218009 2719729360 164
140 iso_pu_bacteria 2718218199 2720488756 164
141 iso_pu_bacteria 2718218232 2720615784 164
142 iso_pu_bacteria 2718218235 2720633917 164
143 iso_pu_bacteria 2718218269 2720777661 164
144 iso_pu_bacteria 2718218363 2721143607 164
145 iso_pu_bacteria 2718218365 2721155355 164
146 iso_pu_bacteria 2718218366 2721166703 164
147 iso_pu_bacteria 2721755514 2722837681 164
148 iso_pu_bacteria 2721755556 2723031111 164
149 iso_pu_bacteria 2721755684 2723563775 164
150 iso_pu_bacteria 2721755685 2723570639 164
151 iso_pu_bacteria 2721755810 2724041253 164
152 iso_pu_bacteria 2721755819 2724087403 164
153 iso_pu_bacteria 2721755822 2724102186 164
154 iso_pu_bacteria 2721755823 2724107377 164
155 iso_pu_bacteria 2728369352 2730104802 164
156 iso_pu_bacteria 2728369365 2730161456 164
157 iso_pu_bacteria 2728369397 2730296235 164
158 iso_pu_bacteria 2791355256 2793299675 164
159 iso_pu_bacteria 2791355259 2793318930 164
160 iso_pu_bacteria 2791355260 2793325175 164
161 iso_pu_bacteria 2791355261 2793331423 164
162 iso_pu_bacteria 2791355262 2793338372 164
163 iso_pu_bacteria 2791355263 2793343482 164
164 iso_pu_bacteria 2791355264 2793351097 164
165 iso_pu_bacteria 2791355265 2793357319 164
166 iso_pu_bacteria 2791355266 2793364341 164
167 iso_pu_bacteria 2791355267 2793371337 164
168 iso_pu_bacteria 2802429605 2805931670 164
169 iso_pu_bacteria 2802429606 2805937935 164
170 iso_pu_bacteria 2802429633 2806049409 164
171 iso_pu_bacteria 2802429635 2806063802 164
172 iso_pu_bacteria 2802429636 2806071030 164
173 iso_pu_bacteria 2838016132 2838022059 164
174 iso_pu_bacteria 2838022645 2838027337 164
175 iso_pu_bacteria 2838048938 2838054023 164
176 iso_pu_bacteria 2838061910 2838066901 164
177 iso_pu_bacteria 2838668709 2838674605 164
178 iso_pu_bacteria 2838694306 2838700956 164
179 iso_pu_bacteria 2838701080 2838707046 164
180 iso_pu_bacteria 2838729681 2838736033 164
181 iso_pu_bacteria 2838742623 2838748288 164
182 iso_pu_bacteria 2842077413 2842083697 164
183 iso_pu_bacteria 2842118031 2842124774 164
184 iso_pu_bacteria 2842146304 2842151647 164
185 iso_pu_bacteria 2842198810 2842203514 164
186 iso_pu_bacteria 2842205361 2842210978 164
187 iso_pu_bacteria 2842217011 2842223277 164
188 iso_pu_bacteria 2842229732 2842236757 164
189 iso_pu_bacteria 2842243621 2842249473 164
190 iso_pu_bacteria 2842250916 2842256835 164
191 iso_pu_bacteria 2842257432 2842263462 164
192 iso_pu_bacteria 2842264693 2842270554 164
193 iso_pu_bacteria 2842278818 2842284527 164
194 iso_pu_bacteria 2842285085 2842290648 164
195 iso_pu_bacteria 2842291075 2842297886 164
196 iso_pu_bacteria 2842311132 2842317279 164
197 iso_pu_bacteria 2842317721 2842323532 164
198 iso_pu_bacteria 2842341865 2842347993 164
199 iso_pu_bacteria 2842363717 2842369539 164
200 iso_pu_bacteria 2842370503 2842377264 164
201 iso_pu_bacteria 2842377471 2842384350 164
202 iso_pu_bacteria 2842384541 2842391369 164
203 iso_pu_bacteria 2842395702 2842402174 164
204 iso_pu_bacteria 2842402390 2842408471 164
205 iso_pu_bacteria 2842409023 2842414593 164
206 iso_pu_bacteria 2842415677 2842421829 164
207 iso_pu_bacteria 2842428310 2842434374 164
208 iso_pu_bacteria 2842434925 2842440709 164
209 iso_pu_bacteria 2842441272 2842447361 164
210 iso_pu_bacteria 2842447887 2842453775 164
211 iso_pu_bacteria 2842462802 2842468730 164
212 iso_pu_bacteria 2842469257 2842475283 164
213 iso_pu_bacteria 2842489311 2842495604 164
214 iso_pu_bacteria 2842495871 2842502256 164
215 iso_pu_bacteria 2935901341 2935907807 164
216 iso_pu_bacteria 2936381700 2936386099 164
217 iso_pu_bacteria 8001522603 8001523634 164
218 iso_pu_bacteria 8005275841 8005276777 164
219 iso_pu_bacteria 8005282627 8005286903 164
220 iso_pu_bacteria 8005307578 8005310029 164
221 iso_pu_bacteria 8005430974 8005435378 164
222 iso_pu_bacteria 8005619151 8005625111 164
223 iso_pu_bacteria 8005626139 8005628869 164
224 iso_pu_bacteria 8005668836 8005674773 164
225 iso_pu_bacteria 8005695170 8005699087 164
226 iso_pu_bacteria 8018176218 8018182126 164
227 iso_pu_bacteria 8024501048 8024504817 164
228 iso_pu_bacteria 8056375014 8056379652 164
229 iso_pu_bacteria 8056382006 8056385702 164
230 3300005340 Ga0070689_100809673 Ga0070689_1008096731 165
231 3300005536 Ga0070697_100006665 Ga0070697_1000066655 165
232 3300005544 Ga0070686_100172160 Ga0070686_1001721602 165
233 3300005545 Ga0070695_100344913 Ga0070695_1003449131 165
234 3300005617 Ga0068859_100902597 Ga0068859_1009025971 165
235 3300006173 Ga0070716_100364728 Ga0070716_1003647281 165
236 3300006195 Ga0075366_10132709 Ga0075366_101327092 165
237 3300006931 Ga0097620_100902643 Ga0097620_1009026431 165
238 3300009093 Ga0105240_10417581 Ga0105240_104175812 165
239 3300009094 Ga0111539_10332414 Ga0111539_103324142 165
240 3300013104 Ga0157370_10646277 Ga0157370_106462771 165
241 3300013306 Ga0163162_10252643 Ga0163162_102526432 165
242 3300014968 Ga0157379_10141281 Ga0157379_101412811 165
243 3300017792 Ga0163161_10118567 Ga0163161_101185672 165
244 3300025913 Ga0207695_10320613 Ga0207695_103206132 165
245 3300025939 Ga0207665_10023132 Ga0207665_100231321 165
246 3300028381 Ga0268264_11157188 Ga0268264_111571882 165
247 3300031344 Ga0265316_10069217 Ga0265316_100692172 165
248 3300031344 Ga0265316_10222637 Ga0265316_102226372 165
249 3300031727 Ga0316576_10092149 Ga0316576_100921492 165
250 3300033528 Ga0316588_1021639 Ga0316588_10216392 165
251 3300039062 Ga0400483_199082 Ga0400483_199082_361_870 165
252 3300039450 Ga0436363_1688978 Ga0436363_1688978_1240_1752 165
253 3300042876 Ga0451577_0005076 Ga0451577_0005076_12854_13363 165
254 3300044712 Ga0453684_0151515 Ga0453684_0151515_777_1286 165
255 3300046452 Ga0495617_000351 Ga0495617_000351_23795_24307 165
256 3300046457 Ga0495590_0000330 Ga0495590_0000330_18883_19389 165
257 3300046507 Ga0495606_0001952 Ga0495606_0001952_6820_7332 165
258 3300046507 Ga0495606_0213863 Ga0495606_0213863_120_626 165
259 3300047444 Ga0495675_0454107 Ga0495675_0454107_196_696 165
260 3300047447 Ga0495685_143103 Ga0495685_143103_156_656 165
261 3300048916 Ga0496113_1016570 Ga0496113_1016570_70_576 165
262 3300049569 Ga0501032_0010263 Ga0501032_0010263_414_917 165
263 3300049570 Ga0501033_0044696 Ga0501033_0044696_1016_1519 165
264 3300049571 Ga0501034_0000360 Ga0501034_0000360_28713_29216 165
265 3300049572 Ga0501036_0052069 Ga0501036_0052069_2359_2862 165
266 3300049573 Ga0501037_0017106 Ga0501037_0017106_2657_3160 165
267 3300049574 Ga0501038_0001066 Ga0501038_0001066_3136_3639 165
268 3300049575 Ga0501039_0057645 Ga0501039_0057645_686_1189 165
269 3300049579 Ga0501043_0141259 Ga0501043_0141259_689_1192 165
270 3300049579 Ga0501043_0277487 Ga0501043_0277487_377_880 165
271 3300049581 Ga0501047_0051264 Ga0501047_0051264_640_1143 165
272 3300049589 Ga0501073_0086140 Ga0501073_0086140_758_1261 165
273 3300049822 Ga0501035_0141518 Ga0501035_0141518_844_1347 165
274 3300049823 Ga0501044_0751562 Ga0501044_0751562_272_775 165
275 3300050511 nmdc:mga08y16_659104_c1 nmdc:mga08y16_659104_c1_97_597 165
276 3300061719 Ga0466962_0393800 Ga0466962_0393800_144_644 165
277 iso_pu_bacteria 2945909444 2945911985 165
278 iso_pu_bacteria 2945984333 2945986746 165
279 3300002738 JGI25154J39366_1000539 JGI25154J39366_10005398 166
280 3300002741 JGI25157J39369_1000018 JGI25157J39369_100001816 166
281 3300003316 rootH1_10008298 rootH1_100082983 166
282 3300003316 rootH1_10017599 rootH1_100175992 166
283 3300003322 rootL2_10077243 rootL2_1007724311 166
284 3300003752 Ga0055539_1000437 Ga0055539_10004377 166
285 3300003752 Ga0055539_1001061 Ga0055539_10010612 166
286 3300003756 Ga0055533_1000011 Ga0055533_100001141 166
287 3300003759 Ga0055525_1000691 Ga0055525_10006918 166
288 3300003761 Ga0055535_1009861 Ga0055535_10098612 166
289 3300004799 Ga0058863_11714636 Ga0058863_117146361 166
290 3300004801 Ga0058860_12025189 Ga0058860_120251892 166
291 3300005329 Ga0070683_100089142 Ga0070683_1000891423 166
292 3300005330 Ga0070690_100001642 Ga0070690_1000016424 166
293 3300005334 Ga0068869_100029452 Ga0068869_1000294523 166
294 3300005338 Ga0068868_100350634 Ga0068868_1003506342 166
295 3300005339 Ga0070660_100833273 Ga0070660_1008332731 166
296 3300005530 Ga0070679_100417650 Ga0070679_1004176502 166
297 3300005539 Ga0068853_100539418 Ga0068853_1005394181 166
298 3300005563 Ga0068855_101105248 Ga0068855_1011052482 166
299 3300005577 Ga0068857_100013094 Ga0068857_1000130947 166
300 3300005614 Ga0068856_100003249 Ga0068856_1000032497 166
301 3300005616 Ga0068852_101368889 Ga0068852_1013688892 166
302 3300005719 Ga0068861_100011157 Ga0068861_1000111574 166
303 3300009093 Ga0105240_10344605 Ga0105240_103446052 166
304 3300009174 Ga0105241_10113847 Ga0105241_101138472 166
305 3300009545 Ga0105237_10025360 Ga0105237_100253607 166
306 3300009551 Ga0105238_10007111 Ga0105238_100071119 166
307 3300010375 Ga0105239_10284729 Ga0105239_102847292 166
308 3300010375 Ga0105239_10756639 Ga0105239_107566392 166
309 3300011119 Ga0105246_10017444 Ga0105246_100174444 166
310 3300013102 Ga0157371_10330882 Ga0157371_103308822 166
311 3300013105 Ga0157369_10015923 Ga0157369_100159237 166
312 3300013105 Ga0157369_10582141 Ga0157369_105821412 166
313 3300013297 Ga0157378_10029581 Ga0157378_100295812 166
314 3300014969 Ga0157376_11957041 Ga0157376_119570411 166
315 3300025226 Ga0209674_100003 Ga0209674_100003342 166
316 3300025230 Ga0209563_100010 Ga0209563_10001071 166
317 3300025242 Ga0209258_101616 Ga0209258_1016166 166
318 3300025246 Ga0209646_1000188 Ga0209646_100018815 166
319 3300025250 Ga0209026_1000033 Ga0209026_1000033279 166
320 3300025253 Ga0209677_100068 Ga0209677_10006851 166
321 3300025253 Ga0209677_100159 Ga0209677_10015949 166
322 3300025256 Ga0209759_1000024 Ga0209759_1000024279 166
323 3300025272 Ga0209455_1039536 Ga0209455_10395361 166
324 3300025911 Ga0207654_10061360 Ga0207654_100613603 166
325 3300025913 Ga0207695_10009048 Ga0207695_1000904810 166
326 3300025914 Ga0207671_10033198 Ga0207671_100331984 166
327 3300025919 Ga0207657_10050442 Ga0207657_100504424 166
328 3300025920 Ga0207649_10449572 Ga0207649_104495721 166
329 3300025921 Ga0207652_10299642 Ga0207652_102996422 166
330 3300025924 Ga0207694_10441111 Ga0207694_104411112 166
331 3300025942 Ga0207689_10014798 Ga0207689_100147987 166
332 3300026023 Ga0207677_10464250 Ga0207677_104642501 166
333 3300026078 Ga0207702_10000553 Ga0207702_100005535 166
334 3300026116 Ga0207674_10004589 Ga0207674_100045897 166
335 3300026118 Ga0207675_100042747 Ga0207675_1000427472 166
336 3300026142 Ga0207698_10054912 Ga0207698_100549121 166
337 3300032004 Ga0307414_10098255 Ga0307414_100982552 166
338 3300033524 Ga0316592_1042423 Ga0316592_10424232 166
339 3300035086 Ga0373934_0002760 Ga0373934_0002760_4670_5179 166
340 3300039447 Ga0436361_0740948 Ga0436361_0740948_2423_2935 166
341 3300039453 Ga0436362_0999886 Ga0436362_0999886_143_682 166
342 3300044712 Ga0453684_0000625 Ga0453684_0000625_27390_27926 166
343 3300045976 Ga0466967_1128638 Ga0466967_1128638_181_693 166
344 3300047471 Ga0495684_0171327 Ga0495684_0171327_1015_1527 166
345 3300047472 Ga0495686_0026685 Ga0495686_0026685_3031_3540 166
346 3300048904 Ga0496101_0364762 Ga0496101_0364762_334_843 166
347 3300048927 Ga0496124_0020783 Ga0496124_0020783_2604_3128 166
348 3300059506 Ga0587085_024346 Ga0587085_024346_299_808 166
349 3300059647 Ga0587079_094509 Ga0587079_094509_78_602 166
350 3300059651 Ga0587105_014637 Ga0587105_014637_44_568 166
351 3300003305 Ga0006770J48903_1073083 Ga0006770J48903_10730831 167
352 3300003781 Ga0055536_1001503 Ga0055536_10015036 167
353 3300003792 Ga0055540_1005504 Ga0055540_10055045 167
354 3300005290 Ga0065712_10443677 Ga0065712_104436771 167
355 3300005327 Ga0070658_10690559 Ga0070658_106905592 167
356 3300005337 Ga0070682_100808671 Ga0070682_1008086712 167
357 3300005338 Ga0068868_100094804 Ga0068868_1000948042 167
358 3300005340 Ga0070689_100001730 Ga0070689_1000017302 167
359 3300005365 Ga0070688_100297510 Ga0070688_1002975102 167
360 3300005366 Ga0070659_101053508 Ga0070659_1010535081 167
361 3300005367 Ga0070667_100087043 Ga0070667_1000870433 167
362 3300005456 Ga0070678_100312544 Ga0070678_1003125442 167
363 3300005459 Ga0068867_100478716 Ga0068867_1004787162 167
364 3300005548 Ga0070665_100114464 Ga0070665_1001144641 167
365 3300005548 Ga0070665_100190780 Ga0070665_1001907802 167
366 3300005563 Ga0068855_100002070 Ga0068855_10000207015 167
367 3300005614 Ga0068856_101435215 Ga0068856_1014352152 167
368 3300005615 Ga0070702_100070087 Ga0070702_1000700872 167
369 3300005842 Ga0068858_100042506 Ga0068858_1000425064 167
370 3300006237 Ga0097621_100119281 Ga0097621_1001192812 167
371 3300006880 Ga0075429_100021139 Ga0075429_1000211396 167
372 3300006881 Ga0068865_100692750 Ga0068865_1006927502 167
373 3300009093 Ga0105240_10138124 Ga0105240_101381242 167
374 3300009094 Ga0111539_11075457 Ga0111539_110754571 167
375 3300009098 Ga0105245_10039092 Ga0105245_100390924 167
376 3300009148 Ga0105243_10002392 Ga0105243_100023922 167
377 3300009177 Ga0105248_10045882 Ga0105248_100458825 167
378 3300010375 Ga0105239_10538941 Ga0105239_105389412 167
379 3300013296 Ga0157374_10114702 Ga0157374_101147023 167
380 3300013306 Ga0163162_10001320 Ga0163162_1000132015 167
381 3300013308 Ga0157375_10013045 Ga0157375_100130458 167
382 3300021388 Ga0213875_10062661 Ga0213875_100626612 167
383 3300025292 Ga0209676_1000361 Ga0209676_100036156 167
384 3300025303 Ga0209051_1000184 Ga0209051_100018478 167
385 3300025304 Ga0209257_1014244 Ga0209257_10142442 167
386 3300025910 Ga0207684_11056103 Ga0207684_110561031 167
387 3300025913 Ga0207695_10096782 Ga0207695_100967822 167
388 3300025935 Ga0207709_10001520 Ga0207709_1000152017 167
389 3300025936 Ga0207670_10001268 Ga0207670_100012682 167
390 3300025938 Ga0207704_10693974 Ga0207704_106939741 167
391 3300025941 Ga0207711_10055594 Ga0207711_100555942 167
392 3300025949 Ga0207667_10053462 Ga0207667_100534624 167
393 3300025986 Ga0207658_10135093 Ga0207658_101350932 167
394 3300026078 Ga0207702_10748049 Ga0207702_107480492 167
395 3300026121 Ga0207683_10297604 Ga0207683_102976042 167
396 3300028379 Ga0268266_10514215 Ga0268266_105142152 167
397 3300028379 Ga0268266_10774798 Ga0268266_107747982 167
398 3300031251 Ga0265327_10007638 Ga0265327_100076387 167
399 3300031691 Ga0316579_10013986 Ga0316579_100139862 167
400 3300031691 Ga0316579_10041831 Ga0316579_100418312 167
401 3300031727 Ga0316576_10009927 Ga0316576_100099276 167
402 3300031727 Ga0316576_10170496 Ga0316576_101704962 167
403 3300031727 Ga0316576_10170499 Ga0316576_101704992 167
404 3300031728 Ga0316578_10179341 Ga0316578_101793412 167
405 3300031728 Ga0316578_10301757 Ga0316578_103017571 167
406 3300031733 Ga0316577_10041335 Ga0316577_100413352 167
407 3300031733 Ga0316577_10051452 Ga0316577_100514523 167
408 3300032133 Ga0316583_10033426 Ga0316583_100334262 167
409 3300032133 Ga0316583_10173901 Ga0316583_101739011 167
410 3300032137 Ga0316585_10005378 Ga0316585_100053784 167
411 3300032139 Ga0316580_10001491 Ga0316580_100014915 167
412 3300032168 Ga0316593_10000488 Ga0316593_100004886 167
413 3300032168 Ga0316593_10020556 Ga0316593_100205562 167
414 3300033524 Ga0316592_1003160 Ga0316592_10031602 167
415 3300033524 Ga0316592_1085722 Ga0316592_10857221 167
416 3300033527 Ga0316586_1002585 Ga0316586_10025852 167
417 3300033527 Ga0316586_1029737 Ga0316586_10297372 167
418 3300033529 Ga0316587_1001414 Ga0316587_10014144 167
419 3300035398 Ga0316574_0007153 Ga0316574_0007153_3006_3542 167
420 3300035398 Ga0316574_0016600 Ga0316574_0016600_587_1129 167
421 3300036712 Ga0316584_0416826 Ga0316584_0416826_289_831 167
422 3300037466 Ga0395898_0433956 Ga0395898_0433956_278_805 167
423 3300037588 Ga0316581_0121049 Ga0316581_0121049_201_743 167
424 3300037588 Ga0316581_0165608 Ga0316581_0165608_41_577 167
425 3300037853 Ga0436364_1085191 Ga0436364_1085191_1350_1871 167
426 3300038443 Ga0395901_0020370 Ga0395901_0020370_5653_6180 167
427 3300038735 Ga0400485_05534 Ga0400485_05534_791_1324 167
428 3300039093 Ga0400489_37544 Ga0400489_37544_1865_2398 167
429 3300039110 Ga0400487_10280 Ga0400487_10280_87470_88003 167
430 3300039110 Ga0400487_17580 Ga0400487_17580_4049_4582 167
431 3300039110 Ga0400487_41326 Ga0400487_41326_435_968 167
432 3300041413 Ga0439465_0197813 Ga0439465_0197813_68_619 167
433 3300041496 Ga0451839_0778740 Ga0451839_0778740_45_557 167
434 3300042876 Ga0451577_0000645 Ga0451577_0000645_44882_45391 167
435 3300044712 Ga0453684_0005496 Ga0453684_0005496_8443_8952 167
436 3300044712 Ga0453684_2081223 Ga0453684_2081223_23_544 167
437 3300045051 Ga0451576_0369423 Ga0451576_0369423_953_1468 167
438 3300045976 Ga0466967_0640524 Ga0466967_0640524_460_990 167
439 3300046460 Ga0495638_0017837 Ga0495638_0017837_3010_3516 167
440 3300046471 Ga0495650_0049242 Ga0495650_0049242_769_1275 167
441 3300046474 Ga0495605_0002234 Ga0495605_0002234_1091_1597 167
442 3300046501 Ga0495607_0176321 Ga0495607_0176321_271_777 167
443 3300046507 Ga0495606_0081511 Ga0495606_0081511_358_864 167
444 3300046524 Ga0495648_0056432 Ga0495648_0056432_928_1434 167
445 3300046528 Ga0495642_0145131 Ga0495642_0145131_282_788 167
446 3300046648 Ga0495611_0038153 Ga0495611_0038153_523_1029 167
447 3300046660 Ga0495625_0111134 Ga0495625_0111134_1022_1528 167
448 3300046663 Ga0495635_0099457 Ga0495635_0099457_300_818 167
449 3300046684 Ga0495669_0018905 Ga0495669_0018905_1340_1846 167
450 3300046691 Ga0495670_0040760 Ga0495670_0040760_483_989 167
451 3300046794 Ga0495589_0040157 Ga0495589_0040157_652_1158 167
452 3300046810 Ga0495660_0140598 Ga0495660_0140598_685_1191 167
453 3300047319 Ga0495674_0279321 Ga0495674_0279321_457_1023 167
454 3300047323 Ga0495683_0234612 Ga0495683_0234612_104_610 167
455 3300047446 Ga0495679_047506 Ga0495679_047506_581_1087 167
456 3300048903 Ga0496100_0065607 Ga0496100_0065607_603_1109 167
457 3300048904 Ga0496101_0165589 Ga0496101_0165589_1031_1537 167
458 3300048905 Ga0496102_0005459 Ga0496102_0005459_856_1362 167
459 3300048906 Ga0496103_0601470 Ga0496103_0601470_155_661 167
460 3300048907 Ga0496104_0261089 Ga0496104_0261089_66_572 167
461 3300048908 Ga0496105_0449582 Ga0496105_0449582_276_782 167
462 3300048909 Ga0496106_0181996 Ga0496106_0181996_1145_1651 167
463 3300048910 Ga0496107_0093129 Ga0496107_0093129_992_1498 167
464 3300048921 Ga0496118_0059872 Ga0496118_0059872_1064_1570 167
465 3300049161 Ga0501305_045353 Ga0501305_045353_190_699 167
466 3300053085 Ga0495619_0225062 Ga0495619_0225062_125_697 167
467 3300059504 Ga0587082_109187 Ga0587082_109187_73_591 167
468 3300001977 JGI24746J21847_1020172 JGI24746J21847_10201722 168
469 3300001989 JGI24739J22299_10056948 JGI24739J22299_100569482 168
470 3300002987 JGI25159J45721_1008197 JGI25159J45721_10081973 168
471 3300003187 JGI25151J46595_10000340 JGI25151J46595_1000034017 168
472 3300003215 JGI25153J46596_10022598 JGI25153J46596_100225982 168
473 3300003354 JGI25160J50197_1000767 JGI25160J50197_10007677 168
474 3300004801 Ga0058860_11994122 Ga0058860_119941222 168
475 3300005289 Ga0065704_10121329 Ga0065704_101213292 168
476 3300005290 Ga0065712_10007612 Ga0065712_100076122 168
477 3300005293 Ga0065715_10011248 Ga0065715_100112483 168
478 3300005293 Ga0065715_10107974 Ga0065715_101079742 168
479 3300005295 Ga0065707_10174252 Ga0065707_101742522 168
480 3300005329 Ga0070683_100000387 Ga0070683_10000038716 168
481 3300005331 Ga0070670_100032038 Ga0070670_1000320383 168
482 3300005331 Ga0070670_100491359 Ga0070670_1004913591 168
483 3300005331 Ga0070670_100806480 Ga0070670_1008064802 168
484 3300005335 Ga0070666_10142274 Ga0070666_101422742 168
485 3300005340 Ga0070689_100391515 Ga0070689_1003915152 168
486 3300005344 Ga0070661_100142807 Ga0070661_1001428072 168
487 3300005353 Ga0070669_100000810 Ga0070669_1000008109 168
488 3300005354 Ga0070675_100018854 Ga0070675_1000188542 168
489 3300005354 Ga0070675_100519511 Ga0070675_1005195112 168
490 3300005354 Ga0070675_100544653 Ga0070675_1005446531 168
491 3300005355 Ga0070671_100032811 Ga0070671_1000328114 168
492 3300005355 Ga0070671_100837463 Ga0070671_1008374631 168
493 3300005355 Ga0070671_101040503 Ga0070671_1010405031 168
494 3300005366 Ga0070659_100445203 Ga0070659_1004452032 168
495 3300005439 Ga0070711_101221980 Ga0070711_1012219801 168
496 3300005445 Ga0070708_100829694 Ga0070708_1008296941 168
497 3300005455 Ga0070663_100022964 Ga0070663_1000229644 168
498 3300005457 Ga0070662_100126089 Ga0070662_1001260892 168
499 3300005468 Ga0070707_100191004 Ga0070707_1001910042 168
500 3300005471 Ga0070698_100515477 Ga0070698_1005154771 168
501 3300005518 Ga0070699_100037802 Ga0070699_1000378022 168
502 3300005535 Ga0070684_100000221 Ga0070684_1000002219 168
503 3300005543 Ga0070672_100219876 Ga0070672_1002198762 168
504 3300005543 Ga0070672_100300810 Ga0070672_1003008102 168
505 3300005544 Ga0070686_100314922 Ga0070686_1003149222 168
506 3300005564 Ga0070664_100001047 Ga0070664_10000104711 168
507 3300005564 Ga0070664_100211037 Ga0070664_1002110372 168
508 3300005577 Ga0068857_100012736 Ga0068857_1000127364 168
509 3300005614 Ga0068856_100321156 Ga0068856_1003211562 168
510 3300005615 Ga0070702_100135005 Ga0070702_1001350052 168
511 3300005618 Ga0068864_100210475 Ga0068864_1002104752 168
512 3300005834 Ga0068851_10127117 Ga0068851_101271171 168
513 3300005842 Ga0068858_100228354 Ga0068858_1002283542 168
514 3300005844 Ga0068862_100238646 Ga0068862_1002386462 168
515 3300005937 Ga0081455_10499960 Ga0081455_104999602 168
516 3300005983 Ga0081540_1046343 Ga0081540_10463432 168
517 3300006051 Ga0075364_10001642 Ga0075364_100016428 168
518 3300006175 Ga0070712_100268044 Ga0070712_1002680442 168
519 3300006358 Ga0068871_100580109 Ga0068871_1005801092 168
520 3300006844 Ga0075428_100020972 Ga0075428_1000209728 168
521 3300006844 Ga0075428_100124334 Ga0075428_1001243341 168
522 3300006844 Ga0075428_100299789 Ga0075428_1002997892 168
523 3300006846 Ga0075430_100000716 Ga0075430_1000007164 168
524 3300006847 Ga0075431_100020300 Ga0075431_1000203005 168
525 3300006847 Ga0075431_100290211 Ga0075431_1002902112 168
526 3300006852 Ga0075433_10052359 Ga0075433_100523593 168
527 3300006871 Ga0075434_100108516 Ga0075434_1001085162 168
528 3300006871 Ga0075434_101061046 Ga0075434_1010610462 168
529 3300006880 Ga0075429_100005556 Ga0075429_1000055568 168
530 3300006880 Ga0075429_100475425 Ga0075429_1004754252 168
531 3300009092 Ga0105250_10055792 Ga0105250_100557922 168
532 3300009094 Ga0111539_10007570 Ga0111539_100075704 168
533 3300009147 Ga0114129_10015179 Ga0114129_100151792 168
534 3300009147 Ga0114129_10246155 Ga0114129_102461552 168
535 3300009148 Ga0105243_10884629 Ga0105243_108846292 168
536 3300009177 Ga0105248_10726498 Ga0105248_107264982 168
537 3300009545 Ga0105237_11038102 Ga0105237_110381022 168
538 3300009553 Ga0105249_10002713 Ga0105249_1000271310 168
539 3300009765 Ga0123341_1006170 Ga0123341_10061708 168
540 3300009766 Ga0123342_1018906 Ga0123342_10189062 168
541 3300009766 Ga0123342_1027741 Ga0123342_10277412 168
542 3300010375 Ga0105239_11338040 Ga0105239_113380402 168
543 3300013296 Ga0157374_10036487 Ga0157374_100364874 168
544 3300013297 Ga0157378_11296510 Ga0157378_112965101 168
545 3300013308 Ga0157375_10984314 Ga0157375_109843142 168
546 3300013308 Ga0157375_11198331 Ga0157375_111983312 168
547 3300014325 Ga0163163_10073601 Ga0163163_100736012 168
548 3300014497 Ga0182008_10011812 Ga0182008_100118122 168
549 3300014497 Ga0182008_10074079 Ga0182008_100740791 168
550 3300014745 Ga0157377_10778261 Ga0157377_107782612 168
551 3300014969 Ga0157376_10234776 Ga0157376_102347763 168
552 3300017792 Ga0163161_10000161 Ga0163161_1000016160 168
553 3300021361 Ga0213872_10013913 Ga0213872_100139131 168
554 3300021361 Ga0213872_10035024 Ga0213872_100350243 168
555 3300021377 Ga0213874_10177113 Ga0213874_101771131 168
556 3300021377 Ga0213874_10202220 Ga0213874_102022201 168
557 3300021384 Ga0213876_10008738 Ga0213876_100087384 168
558 3300021384 Ga0213876_10032007 Ga0213876_100320072 168
559 3300021441 Ga0213871_10030033 Ga0213871_100300332 168
560 3300023672 Ga0247553_100425 Ga0247553_1004251 168
561 3300025271 Ga0207666_1005952 Ga0207666_10059522 168
562 3300025284 Ga0209130_1000252 Ga0209130_100025257 168
563 3300025294 Ga0209025_1000633 Ga0209025_100063323 168
564 3300025297 Ga0209758_1002743 Ga0209758_10027438 168
565 3300025302 Ga0207426_1000098 Ga0207426_1000098124 168
566 3300025321 Ga0207656_10080509 Ga0207656_100805092 168
567 3300025735 Ga0207713_1000191 Ga0207713_100019126 168
568 3300025901 Ga0207688_10126059 Ga0207688_101260592 168
569 3300025903 Ga0207680_10114877 Ga0207680_101148772 168
570 3300025908 Ga0207643_10125518 Ga0207643_101255182 168
571 3300025915 Ga0207693_10257805 Ga0207693_102578052 168
572 3300025915 Ga0207693_10274949 Ga0207693_102749493 168
573 3300025916 Ga0207663_10924975 Ga0207663_109249751 168
574 3300025922 Ga0207646_10157502 Ga0207646_101575022 168
575 3300025922 Ga0207646_10192556 Ga0207646_101925562 168
576 3300025923 Ga0207681_10003328 Ga0207681_100033284 168
577 3300025925 Ga0207650_10021599 Ga0207650_100215995 168
578 3300025925 Ga0207650_10202213 Ga0207650_102022132 168
579 3300025926 Ga0207659_10014095 Ga0207659_100140954 168
580 3300025926 Ga0207659_10200081 Ga0207659_102000811 168
581 3300025931 Ga0207644_10024515 Ga0207644_100245152 168
582 3300025931 Ga0207644_10758387 Ga0207644_107583872 168
583 3300025932 Ga0207690_10519281 Ga0207690_105192812 168
584 3300025933 Ga0207706_10446359 Ga0207706_104463592 168
585 3300025935 Ga0207709_10224695 Ga0207709_102246953 168
586 3300025936 Ga0207670_10364038 Ga0207670_103640382 168
587 3300025939 Ga0207665_10129343 Ga0207665_101293432 168
588 3300025940 Ga0207691_10155232 Ga0207691_101552322 168
589 3300025940 Ga0207691_10176513 Ga0207691_101765133 168
590 3300025941 Ga0207711_10024965 Ga0207711_100249655 168
591 3300025944 Ga0207661_10001828 Ga0207661_100018282 168
592 3300025944 Ga0207661_10759338 Ga0207661_107593381 168
593 3300025945 Ga0207679_10000614 Ga0207679_1000061411 168
594 3300025961 Ga0207712_10021071 Ga0207712_100210713 168
595 3300025986 Ga0207658_11528736 Ga0207658_115287361 168
596 3300026035 Ga0207703_10194438 Ga0207703_101944382 168
597 3300026075 Ga0207708_10335657 Ga0207708_103356572 168
598 3300026116 Ga0207674_10018697 Ga0207674_100186975 168
599 3300027907 Ga0207428_10074873 Ga0207428_100748733 168
600 3300028380 Ga0268265_10097078 Ga0268265_100970782 168
601 3300028381 Ga0268264_10529128 Ga0268264_105291282 168
602 3300028800 Ga0265338_10223600 Ga0265338_102236002 168
603 3300030963 Ga0265768_100242 Ga0265768_1002422 168
604 3300031344 Ga0265316_10043108 Ga0265316_100431082 168
605 3300031911 Ga0307412_10016003 Ga0307412_100160033 168
606 3300033524 Ga0316592_1001006 Ga0316592_10010065 168
607 3300033524 Ga0316592_1002951 Ga0316592_10029512 168
608 3300033524 Ga0316592_1046781 Ga0316592_10467812 168
609 3300033528 Ga0316588_1018969 Ga0316588_10189692 168
610 3300033541 Ga0316596_1029621 Ga0316596_10296211 168
611 3300037418 Ga0395900_0237124 Ga0395900_0237124_338_865 168
612 3300037853 Ga0436364_0037831 Ga0436364_0037831_2937_3458 168
613 3300038443 Ga0395901_0818530 Ga0395901_0818530_51_578 168
614 3300039437 Ga0436365_0647074 Ga0436365_0647074_76_597 168
615 3300039437 Ga0436365_1112230 Ga0436365_1112230_15784_16308 168
616 3300039437 Ga0436365_1625636 Ga0436365_1625636_2000_2521 168
617 3300039438 Ga0436360_0122311 Ga0436360_0122311_5545_6069 168
618 3300039438 Ga0436360_0619086 Ga0436360_0619086_236_760 168
619 3300039438 Ga0436360_0735944 Ga0436360_0735944_3446_3988 168
620 3300039438 Ga0436360_0885445 Ga0436360_0885445_611_1141 168
621 3300039438 Ga0436360_1317915 Ga0436360_1317915_437_961 168
622 3300039447 Ga0436361_0013250 Ga0436361_0013250_1850_2374 168
623 3300039447 Ga0436361_0193310 Ga0436361_0193310_971_1495 168
624 3300039447 Ga0436361_0294503 Ga0436361_0294503_1808_2332 168
625 3300039447 Ga0436361_0298641 Ga0436361_0298641_945_1469 168
626 3300039447 Ga0436361_0528059 Ga0436361_0528059_24_548 168
627 3300039450 Ga0436363_0479409 Ga0436363_0479409_45_569 168
628 3300039450 Ga0436363_1298424 Ga0436363_1298424_133_672 168
629 3300039453 Ga0436362_0579570 Ga0436362_0579570_20_544 168
630 3300039453 Ga0436362_0829410 Ga0436362_0829410_489_1013 168
631 3300039453 Ga0436362_1117703 Ga0436362_1117703_713_1255 168
632 3300041404 Ga0439436_0003170 Ga0439436_0003170_4130_4684 168
633 3300041406 Ga0439439_0015255 Ga0439439_0015255_102_656 168
634 3300041413 Ga0439465_0007042 Ga0439465_0007042_2099_2653 168
635 3300041997 Ga0439431_0008305 Ga0439431_0008305_180_746 168
636 3300042007 Ga0439449_0001163 Ga0439449_0001163_9743_10297 168
637 3300042014 Ga0439457_009092 Ga0439457_009092_127_681 168
638 3300042015 Ga0439462_0006135 Ga0439462_0006135_53_607 168
639 3300045051 Ga0451576_0504970 Ga0451576_0504970_49_564 168
640 3300045976 Ga0466967_0671875 Ga0466967_0671875_455_979 168
641 3300046506 Ga0495583_0301096 Ga0495583_0301096_36_590 168
642 3300046512 Ga0495610_0043936 Ga0495610_0043936_1158_1712 168
643 3300046512 Ga0495610_0071082 Ga0495610_0071082_405_971 168
644 3300046559 Ga0495667_0344900 Ga0495667_0344900_38_550 168
645 3300046689 Ga0495613_0172168 Ga0495613_0172168_411_932 168
646 3300047318 Ga0495636_0337480 Ga0495636_0337480_70_588 168
647 3300047469 Ga0495673_0063322 Ga0495673_0063322_252_806 168
648 3300048091 Ga0495626_0253806 Ga0495626_0253806_53_619 168
649 3300048907 Ga0496104_0001980 Ga0496104_0001980_11781_12290 168
650 3300048908 Ga0496105_0127690 Ga0496105_0127690_877_1386 168
651 3300048911 Ga0496108_0008532 Ga0496108_0008532_979_1488 168
652 3300048911 Ga0496108_0927943 Ga0496108_0927943_172_702 168
653 3300048912 Ga0496109_0004929 Ga0496109_0004929_1139_1648 168
654 3300048913 Ga0496110_0000797 Ga0496110_0000797_12098_12607 168
655 3300048914 Ga0496111_0001605 Ga0496111_0001605_11528_12037 168
656 3300048915 Ga0496112_0002405 Ga0496112_0002405_13491_14000 168
657 3300048916 Ga0496113_0065318 Ga0496113_0065318_645_1154 168
658 3300048917 Ga0496114_0432381 Ga0496114_0432381_634_1143 168
659 3300048926 Ga0496123_0001262 Ga0496123_0001262_12601_13131 168
660 3300048927 Ga0496124_0067980 Ga0496124_0067980_1714_2247 168
661 3300049576 Ga0501040_0240972 Ga0501040_0240972_421_930 168
662 3300049577 Ga0501041_0337238 Ga0501041_0337238_198_707 168
663 3300049586 Ga0501070_0256868 Ga0501070_0256868_683_1192 168
664 3300049587 Ga0501071_0043370 Ga0501071_0043370_202_711 168
665 3300049588 Ga0501072_0187412 Ga0501072_0187412_112_621 168
666 3300049589 Ga0501073_0642243 Ga0501073_0642243_77_586 168
667 3300049591 Ga0501075_0146537 Ga0501075_0146537_1270_1779 168
668 3300049592 Ga0501076_0126635 Ga0501076_0126635_1318_1827 168
669 3300049593 Ga0501077_0301729 Ga0501077_0301729_310_819 168
670 3300049741 Ga0501079_0020772 Ga0501079_0020772_1357_1866 168
671 3300049742 Ga0501080_0050121 Ga0501080_0050121_3308_3817 168
672 3300049742 Ga0501080_0419990 Ga0501080_0419990_445_960 168
673 3300049743 Ga0501081_0577002 Ga0501081_0577002_257_766 168
674 3300049824 Ga0501045_0079226 Ga0501045_0079226_615_1124 168
675 3300050491 nmdc:mga00v17_573_c1 nmdc:mga00v17_573_c1_17564_18151 168
676 3300050507 nmdc:mga05p37_767580_c1 nmdc:mga05p37_767580_c1_493_1002 168
677 3300050507 nmdc:mga05p37_84853_c1 nmdc:mga05p37_84853_c1_17_544 168
678 3300050508 nmdc:mga09592_123224_c1 nmdc:mga09592_123224_c1_1387_1893 168
679 3300050508 nmdc:mga09592_454_c1 nmdc:mga09592_454_c1_6746_7273 168
680 3300050509 nmdc:mga0qj67_3504_c1 nmdc:mga0qj67_3504_c1_2543_3070 168
681 3300050510 nmdc:mga06r32_1074283_c1 nmdc:mga06r32_1074283_c1_129_656 168
682 3300050510 nmdc:mga06r32_4114_c1 nmdc:mga06r32_4114_c1_6962_7489 168
683 3300050511 nmdc:mga08y16_132674_c1 nmdc:mga08y16_132674_c1_1332_1841 168
684 3300050511 nmdc:mga08y16_6519_c1 nmdc:mga08y16_6519_c1_7712_8218 168
685 3300050512 nmdc:mga0n895_419834_c1 nmdc:mga0n895_419834_c1_747_1256 168
686 3300050512 nmdc:mga0n895_555639_c1 nmdc:mga0n895_555639_c1_625_1134 168
687 3300050513 nmdc:mga0rr50_321004_c1 nmdc:mga0rr50_321004_c1_349_858 168
688 3300050515 nmdc:mga0a205_81623_c1 nmdc:mga0a205_81623_c1_89_598 168
689 3300053139 Ga0500568_0075403 Ga0500568_0075403_349_903 168
690 3300054114 Ga0501084_0074109 Ga0501084_0074109_1154_1663 168
691 3300060353 Ga0501082_0108180 Ga0501082_0108180_1554_2063 168
692 3300061734 Ga0530510_0173840 Ga0530510_0173840_274_783 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05591

T6SS_VipA

Type VI secretion system, VipA, VC_A0107 or Hcp2

10

165

0.96

Feature Viewer

pLDDT pTM Quality
67.08 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map