F475587
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 692 | 499 | 561 | 174 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10223600|Ga0265338_102236002 |
| Length | 172 |
| Sequence | MAKTSSQKFIARNRCPRVQIEYDVELYGAEKKVELPFVMGVMADLTGKPAEGQEPPPVGDRKFLEIDVDNFDDRLKACKPRVAFQVPNTLTGEGNLSVEMTFDSMDDFSPAAVARKVDSLNKLLQTRTELANLLTYMDGKDKAEELIGRLLNDPELMKSLGSAPAPTVKPAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 2 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 3 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 4 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 5 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 6 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 7 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 8 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 9 | 2608642108 | Pantoea agglomerans NFPP29 | Isolate | Rhizoplane |
| 10 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 11 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 12 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 13 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 14 | 2687453341 | Pirellula sp. SH-Sr6A | Isolate | Unclassified |
| 15 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 16 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 17 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 18 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 19 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 20 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 21 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 22 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 23 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 24 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 25 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 26 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 27 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 28 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 29 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 30 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 31 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 32 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 33 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 34 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 35 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 36 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 37 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 38 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 39 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 40 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 41 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 42 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 43 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 44 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 45 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 46 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 47 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 48 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 49 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 50 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 51 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 52 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 53 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 54 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 55 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 56 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 57 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 58 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 59 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 60 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 61 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 62 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 63 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 64 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 65 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 66 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 67 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 68 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 69 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 70 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 71 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 72 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 73 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 74 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 75 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 76 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 77 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 78 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 79 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 80 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 81 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 82 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 83 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 84 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 85 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 86 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 87 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 88 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 89 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 90 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 91 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 92 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 93 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 94 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 95 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 96 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 97 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 98 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 99 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 100 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 101 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 102 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 103 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 104 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 105 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 106 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 107 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 108 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 109 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 110 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 111 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 112 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 113 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 114 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 115 | 2978975091 | Pantoea anthophila SORGH_AS 797 | Isolate | Unclassified |
| 116 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 117 | 3000376612 | Enterobacteriaceae bacterium 4M9 | Isolate | Rhizosphere |
| 118 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 119 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 120 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 121 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 122 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 123 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 124 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 125 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 126 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 127 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 128 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 129 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 130 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 131 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 132 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 133 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 134 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 135 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 136 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 138 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 139 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 140 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 141 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 142 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 144 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 145 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 147 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 149 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 150 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 151 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 152 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 155 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 158 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 159 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 160 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 161 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 166 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 168 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 169 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 170 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 171 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 172 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 173 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 175 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 176 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 179 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 181 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 182 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 183 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 184 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 185 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 186 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 187 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 188 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 189 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 190 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 191 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 192 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 193 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 194 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 195 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 196 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 197 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 199 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 200 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 201 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 202 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 203 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 204 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 205 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 206 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 215 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 221 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 222 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 223 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 224 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 229 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 230 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 231 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 232 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 233 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 234 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 235 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 236 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 237 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 238 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 239 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 240 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 241 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 242 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 243 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 244 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 245 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 246 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 247 | 3300023672 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 249 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 250 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 251 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 253 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 254 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 255 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 256 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 257 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 258 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 259 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 261 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 262 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 263 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 264 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 265 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 266 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 267 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 268 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 305 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 307 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 310 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 313 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 315 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 316 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 318 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 319 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 320 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 321 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 323 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 324 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 325 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 326 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 327 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 328 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 329 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 330 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 331 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 332 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 333 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 340 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 341 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 342 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 343 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 344 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 345 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 346 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 347 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 348 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 349 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 350 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 351 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 352 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 353 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 354 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 355 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 356 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 357 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 358 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 359 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 360 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 361 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 362 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 363 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 364 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 365 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 366 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 367 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 368 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 369 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 370 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 371 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 372 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 373 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 374 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 375 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 376 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 413 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 414 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 415 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 416 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 417 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 418 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 419 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 420 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 421 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 422 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 423 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 424 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 425 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 426 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 427 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 428 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 429 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 430 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 431 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 432 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 433 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 434 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 435 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 436 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 437 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 438 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 439 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 442 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 444 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 445 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 446 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 447 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 449 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 450 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 451 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 452 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 453 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 454 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 455 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 459 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 464 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 465 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 466 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 467 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 468 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 469 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 470 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 471 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 472 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 473 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 474 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 476 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 477 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 479 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 480 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 481 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 482 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 484 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 485 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 486 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 487 | 8001522603 | Methylomicrobium sp. RS1 | Isolate | Unclassified |
| 488 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 489 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 490 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 491 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 492 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 493 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 494 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 495 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 496 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 497 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 498 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 499 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.17 |
| Metatranscriptomes | 3.76 |
| Isolates | 19.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.78 |
| Nodule | 14.16 |
| Rhizoplane | 3.76 |
| Rhizosphere | 64.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1020172 | 3300001977 | Bacteria | 936 |
| 2 | JGI24739J22299_10056948 | 3300001989 | Bacteria | 1245 |
| 3 | JGI25162J39368_1008911 | 3300002737 | Bacteria | 1391 |
| 4 | JGI25154J39366_1000539 | 3300002738 | Bacteria | 18841 |
| 5 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 6 | JGI25159J45721_1008197 | 3300002987 | Bacteria | 2898 |
| 7 | JGI25151J46595_10000340 | 3300003187 | Bacteria | 50006 |
| 8 | JGI25153J46596_10022598 | 3300003215 | Bacteria | 2312 |
| 9 | Ga0006770J48903_1073083 | 3300003305 | Bacteria | 550 |
| 10 | rootH1_10008298 | 3300003316 | Bacteria | 7116 |
| 11 | rootH1_10008298 | 3300003323 | Bacteria | 13422 |
| 12 | rootH1_10017599 | 3300003316 | Bacteria | 8038 |
| 13 | rootL2_10077243 | 3300003322 | Bacteria | 9028 |
| 14 | JGI25160J50197_1000767 | 3300003354 | Bacteria | 17314 |
| 15 | Ga0055539_1000437 | 3300003752 | Bacteria | 14566 |
| 16 | Ga0055539_1001061 | 3300003752 | Bacteria | 5842 |
| 17 | Ga0055533_1000011 | 3300003756 | Bacteria | 467893 |
| 18 | Ga0055525_1000691 | 3300003759 | Bacteria | 12485 |
| 19 | Ga0055535_1009861 | 3300003761 | Bacteria | 1611 |
| 20 | Ga0055536_1001503 | 3300003781 | Bacteria | 14011 |
| 21 | Ga0055540_1005504 | 3300003792 | Bacteria | 5299 |
| 22 | Ga0058863_11714636 | 3300004799 | Bacteria | 701 |
| 23 | Ga0058860_11994122 | 3300004801 | Bacteria | 1092 |
| 24 | Ga0058860_12025189 | 3300004801 | Bacteria | 1529 |
| 25 | Ga0065704_10121329 | 3300005289 | Bacteria | 1768 |
| 26 | Ga0065712_10007612 | 3300005290 | Bacteria | 4322 |
| 27 | Ga0065712_10443677 | 3300005290 | Bacteria | 692 |
| 28 | Ga0065715_10011248 | 3300005293 | Bacteria | 2386 |
| 29 | Ga0065715_10107974 | 3300005293 | Bacteria | 2741 |
| 30 | Ga0065707_10174252 | 3300005295 | Bacteria | 1462 |
| 31 | Ga0070658_10690559 | 3300005327 | Bacteria | 886 |
| 32 | Ga0070683_100000387 | 3300005329 | Bacteria | 30469 |
| 33 | Ga0070683_100089142 | 3300005329 | Bacteria | 2895 |
| 34 | Ga0070690_100001642 | 3300005330 | Bacteria | 11759 |
| 35 | Ga0070670_100032038 | 3300005331 | Bacteria | 4526 |
| 36 | Ga0070670_100491359 | 3300005331 | Bacteria | 1091 |
| 37 | Ga0070670_100806480 | 3300005331 | Bacteria | 848 |
| 38 | Ga0068869_100029452 | 3300005334 | Bacteria | 3847 |
| 39 | Ga0070666_10142274 | 3300005335 | Bacteria | 1671 |
| 40 | Ga0070682_100808671 | 3300005337 | Bacteria | 762 |
| 41 | Ga0068868_100094804 | 3300005338 | Bacteria | 2408 |
| 42 | Ga0068868_100350634 | 3300005338 | Bacteria | 1264 |
| 43 | Ga0070660_100833273 | 3300005339 | Bacteria | 776 |
| 44 | Ga0070689_100001730 | 3300005340 | Bacteria | 13955 |
| 45 | Ga0070689_100391515 | 3300005340 | Bacteria | 1173 |
| 46 | Ga0070689_100809673 | 3300005340 | Bacteria | 824 |
| 47 | Ga0070661_100142807 | 3300005344 | Bacteria | 1805 |
| 48 | Ga0070668_100006994 | 3300005347 | Bacteria | 8361 |
| 49 | Ga0070669_100000810 | 3300005353 | Bacteria | 22749 |
| 50 | Ga0070669_100563751 | 3300005353 | Bacteria | 951 |
| 51 | Ga0070675_100018854 | 3300005354 | Bacteria | 5494 |
| 52 | Ga0070675_100519511 | 3300005354 | Bacteria | 1074 |
| 53 | Ga0070675_100544653 | 3300005354 | Bacteria | 1049 |
| 54 | Ga0070671_100032811 | 3300005355 | Bacteria | 4292 |
| 55 | Ga0070671_100837463 | 3300005355 | Bacteria | 802 |
| 56 | Ga0070671_101040503 | 3300005355 | Bacteria | 718 |
| 57 | Ga0070688_100297510 | 3300005365 | Bacteria | 1165 |
| 58 | Ga0070659_100445203 | 3300005366 | Bacteria | 1098 |
| 59 | Ga0070659_101053508 | 3300005366 | Bacteria | 715 |
| 60 | Ga0070667_100087043 | 3300005367 | Bacteria | 2681 |
| 61 | Ga0070711_101221980 | 3300005439 | Bacteria | 650 |
| 62 | Ga0070708_100829694 | 3300005445 | Unclassified | 869 |
| 63 | Ga0070663_100022964 | 3300005455 | Bacteria | 4176 |
| 64 | Ga0070678_100312544 | 3300005456 | Bacteria | 1339 |
| 65 | Ga0070662_100126089 | 3300005457 | Bacteria | 1968 |
| 66 | Ga0068867_100478716 | 3300005459 | Bacteria | 1066 |
| 67 | Ga0070707_100191004 | 3300005468 | Bacteria | 1997 |
| 68 | Ga0070698_100515477 | 3300005471 | Bacteria | 1134 |
| 69 | Ga0070699_100037802 | 3300005518 | Unclassified | 4179 |
| 70 | Ga0070679_100417650 | 3300005530 | Bacteria | 1287 |
| 71 | Ga0070684_100000221 | 3300005535 | Bacteria | 39898 |
| 72 | Ga0070697_100006665 | 3300005536 | Bacteria | 8957 |
| 73 | Ga0068853_100539418 | 3300005539 | Bacteria | 1104 |
| 74 | Ga0070672_100219876 | 3300005543 | Bacteria | 1593 |
| 75 | Ga0070672_100300810 | 3300005543 | Bacteria | 1360 |
| 76 | Ga0070686_100172160 | 3300005544 | Bacteria | 1532 |
| 77 | Ga0070686_100314922 | 3300005544 | Bacteria | 1165 |
| 78 | Ga0070695_100344913 | 3300005545 | Bacteria | 1114 |
| 79 | Ga0070696_100479588 | 3300005546 | Bacteria | 986 |
| 80 | Ga0070665_100114464 | 3300005548 | Bacteria | 2700 |
| 81 | Ga0070665_100190780 | 3300005548 | Bacteria | 2050 |
| 82 | Ga0070665_100411879 | 3300005548 | Bacteria | 1360 |
| 83 | Ga0068855_100002070 | 3300005563 | Bacteria | 24846 |
| 84 | Ga0068855_100096411 | 3300005563 | Bacteria | 3408 |
| 85 | Ga0068855_101105248 | 3300005563 | Bacteria | 828 |
| 86 | Ga0070664_100001047 | 3300005564 | Bacteria | 21733 |
| 87 | Ga0070664_100211037 | 3300005564 | Bacteria | 1735 |
| 88 | Ga0068857_100012736 | 3300005577 | Bacteria | 7329 |
| 89 | Ga0068857_100013094 | 3300005577 | Bacteria | 7228 |
| 90 | Ga0068856_100003249 | 3300005614 | Bacteria | 16544 |
| 91 | Ga0068856_100067645 | 3300005614 | Bacteria | 3530 |
| 92 | Ga0068856_100321156 | 3300005614 | Bacteria | 1565 |
| 93 | Ga0068856_101435215 | 3300005614 | Bacteria | 704 |
| 94 | Ga0070702_100070087 | 3300005615 | Bacteria | 2068 |
| 95 | Ga0070702_100135005 | 3300005615 | Bacteria | 1564 |
| 96 | Ga0068852_101368889 | 3300005616 | Bacteria | 730 |
| 97 | Ga0068859_100902597 | 3300005617 | Bacteria | 968 |
| 98 | Ga0068864_100210475 | 3300005618 | Bacteria | 1790 |
| 99 | Ga0068861_100011157 | 3300005719 | Bacteria | 6239 |
| 100 | Ga0068851_10127117 | 3300005834 | Bacteria | 1375 |
| 101 | Ga0068858_100042506 | 3300005842 | Bacteria | 4214 |
| 102 | Ga0068858_100228354 | 3300005842 | Bacteria | 1764 |
| 103 | Ga0068862_100238646 | 3300005844 | Bacteria | 1652 |
| 104 | Ga0081455_10499960 | 3300005937 | Bacteria | 817 |
| 105 | Ga0081540_1046343 | 3300005983 | Bacteria | 2196 |
| 106 | Ga0075363_100563875 | 3300006048 | Bacteria | 680 |
| 107 | Ga0075364_10001642 | 3300006051 | Bacteria | 12275 |
| 108 | Ga0070716_100364728 | 3300006173 | Bacteria | 1027 |
| 109 | Ga0070712_100268044 | 3300006175 | Bacteria | 1371 |
| 110 | Ga0075366_10132709 | 3300006195 | Bacteria | 1503 |
| 111 | Ga0097621_100119281 | 3300006237 | Bacteria | 2236 |
| 112 | Ga0068871_100580109 | 3300006358 | Bacteria | 1018 |
| 113 | Ga0075428_100020972 | 3300006844 | Bacteria | 7238 |
| 114 | Ga0075428_100124334 | 3300006844 | Bacteria | 2808 |
| 115 | Ga0075428_100299789 | 3300006844 | Bacteria | 1728 |
| 116 | Ga0075428_100942295 | 3300006844 | Bacteria | 915 |
| 117 | Ga0075430_100000716 | 3300006846 | Bacteria | 25364 |
| 118 | Ga0075431_100020300 | 3300006847 | Bacteria | 6786 |
| 119 | Ga0075431_100290211 | 3300006847 | Bacteria | 1655 |
| 120 | Ga0075431_100638363 | 3300006847 | Bacteria | 1046 |
| 121 | Ga0075433_10052359 | 3300006852 | Bacteria | 3557 |
| 122 | Ga0075434_100108516 | 3300006871 | Bacteria | 2786 |
| 123 | Ga0075434_101061046 | 3300006871 | Bacteria | 824 |
| 124 | Ga0075429_100005556 | 3300006880 | Bacteria | 10861 |
| 125 | Ga0075429_100021139 | 3300006880 | Bacteria | 5642 |
| 126 | Ga0075429_100164669 | 3300006880 | Bacteria | 1942 |
| 127 | Ga0075429_100475425 | 3300006880 | Bacteria | 1095 |
| 128 | Ga0068865_100692750 | 3300006881 | Bacteria | 870 |
| 129 | Ga0097620_100902643 | 3300006931 | Bacteria | 968 |
| 130 | Ga0105251_10315113 | 3300009011 | Bacteria | 710 |
| 131 | Ga0105244_10038121 | 3300009036 | Bacteria | 2508 |
| 132 | Ga0105244_10244760 | 3300009036 | Bacteria | 837 |
| 133 | Ga0105250_10055792 | 3300009092 | Bacteria | 1585 |
| 134 | Ga0105240_10138124 | 3300009093 | Bacteria | 2916 |
| 135 | Ga0105240_10344605 | 3300009093 | Bacteria | 1692 |
| 136 | Ga0105240_10417581 | 3300009093 | Bacteria | 1508 |
| 137 | Ga0111539_10007570 | 3300009094 | Bacteria | 13881 |
| 138 | Ga0111539_10332414 | 3300009094 | Bacteria | 1769 |
| 139 | Ga0111539_11075457 | 3300009094 | Bacteria | 935 |
| 140 | Ga0105245_10039092 | 3300009098 | Bacteria | 4223 |
| 141 | Ga0114129_10015179 | 3300009147 | Bacteria | 10963 |
| 142 | Ga0114129_10246155 | 3300009147 | Bacteria | 2402 |
| 143 | Ga0114129_10711678 | 3300009147 | Bacteria | 1290 |
| 144 | Ga0105243_10002392 | 3300009148 | Bacteria | 15724 |
| 145 | Ga0105243_10884629 | 3300009148 | Bacteria | 887 |
| 146 | Ga0105241_10113847 | 3300009174 | Bacteria | 2169 |
| 147 | Ga0105241_10326067 | 3300009174 | Bacteria | 1326 |
| 148 | Ga0105248_10045882 | 3300009177 | Bacteria | 4899 |
| 149 | Ga0105248_10726498 | 3300009177 | Bacteria | 1120 |
| 150 | Ga0105237_10025360 | 3300009545 | Bacteria | 6063 |
| 151 | Ga0105237_11038102 | 3300009545 | Bacteria | 826 |
| 152 | Ga0105238_10007111 | 3300009551 | Bacteria | 11199 |
| 153 | Ga0105249_10002713 | 3300009553 | Bacteria | 15297 |
| 154 | Ga0123341_1006170 | 3300009765 | Bacteria | 10805 |
| 155 | Ga0123342_1018906 | 3300009766 | Bacteria | 5372 |
| 156 | Ga0123342_1027741 | 3300009766 | Bacteria | 3132 |
| 157 | Ga0105239_10284729 | 3300010375 | Bacteria | 1861 |
| 158 | Ga0105239_10538941 | 3300010375 | Bacteria | 1329 |
| 159 | Ga0105239_10756639 | 3300010375 | Bacteria | 1112 |
| 160 | Ga0105239_11338040 | 3300010375 | Bacteria | 826 |
| 161 | Ga0105246_10004710 | 3300011119 | Bacteria | 8304 |
| 162 | Ga0105246_10017444 | 3300011119 | Bacteria | 4562 |
| 163 | Ga0157373_10068497 | 3300013100 | Bacteria | 2508 |
| 164 | Ga0157373_11080308 | 3300013100 | Bacteria | 601 |
| 165 | Ga0157371_10310175 | 3300013102 | Bacteria | 1143 |
| 166 | Ga0157371_10330882 | 3300013102 | Bacteria | 1107 |
| 167 | Ga0157370_10120323 | 3300013104 | Bacteria | 2451 |
| 168 | Ga0157370_10646277 | 3300013104 | Bacteria | 967 |
| 169 | Ga0157369_10015923 | 3300013105 | Bacteria | 8467 |
| 170 | Ga0157369_10053690 | 3300013105 | Bacteria | 4354 |
| 171 | Ga0157369_10582141 | 3300013105 | Bacteria | 1156 |
| 172 | Ga0157374_10036487 | 3300013296 | Bacteria | 4503 |
| 173 | Ga0157374_10114702 | 3300013296 | Bacteria | 2594 |
| 174 | Ga0157378_10029581 | 3300013297 | Bacteria | 4837 |
| 175 | Ga0157378_11296510 | 3300013297 | Unclassified | 769 |
| 176 | Ga0163162_10001320 | 3300013306 | Bacteria | 23166 |
| 177 | Ga0163162_10252643 | 3300013306 | Bacteria | 1895 |
| 178 | Ga0157372_10134794 | 3300013307 | Bacteria | 2843 |
| 179 | Ga0157372_10171417 | 3300013307 | Bacteria | 2511 |
| 180 | Ga0157375_10013045 | 3300013308 | Bacteria | 7384 |
| 181 | Ga0157375_10984314 | 3300013308 | Bacteria | 984 |
| 182 | Ga0157375_11198331 | 3300013308 | Bacteria | 891 |
| 183 | Ga0163163_10073601 | 3300014325 | Bacteria | 3408 |
| 184 | Ga0182008_10011812 | 3300014497 | Bacteria | 4631 |
| 185 | Ga0182008_10067121 | 3300014497 | Bacteria | 1765 |
| 186 | Ga0182008_10074079 | 3300014497 | Bacteria | 1675 |
| 187 | Ga0157377_10778261 | 3300014745 | Bacteria | 703 |
| 188 | Ga0157379_10141281 | 3300014968 | Bacteria | 2170 |
| 189 | Ga0157376_10234776 | 3300014969 | Bacteria | 1705 |
| 190 | Ga0157376_11957041 | 3300014969 | Bacteria | 623 |
| 191 | Ga0182006_1046717 | 3300015261 | Bacteria | 1681 |
| 192 | Ga0182007_10028397 | 3300015262 | Bacteria | 1922 |
| 193 | Ga0163161_10000161 | 3300017792 | Bacteria | 61815 |
| 194 | Ga0163161_10023197 | 3300017792 | Bacteria | 4374 |
| 195 | Ga0163161_10118567 | 3300017792 | Bacteria | 1986 |
| 196 | Ga0206352_10308299 | 3300020078 | Bacteria | 741 |
| 197 | Ga0213872_10013913 | 3300021361 | Unclassified | 3761 |
| 198 | Ga0213872_10035024 | 3300021361 | Bacteria | 2296 |
| 199 | Ga0213874_10177113 | 3300021377 | Bacteria | 757 |
| 200 | Ga0213874_10202220 | 3300021377 | Bacteria | 715 |
| 201 | Ga0213876_10008738 | 3300021384 | Bacteria | 5473 |
| 202 | Ga0213876_10032007 | 3300021384 | Bacteria | 2774 |
| 203 | Ga0213875_10062661 | 3300021388 | Bacteria | 1739 |
| 204 | Ga0213871_10030033 | 3300021441 | Bacteria | 1412 |
| 205 | Ga0247553_100425 | 3300023672 | Bacteria | 1511 |
| 206 | Ga0209760_106254 | 3300025207 | Bacteria | 955 |
| 207 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 208 | Ga0209674_100104 | 3300025226 | Bacteria | 154080 |
| 209 | Ga0209672_100009 | 3300025228 | Bacteria | 883623 |
| 210 | Ga0209563_100010 | 3300025230 | Bacteria | 1337457 |
| 211 | Ga0209437_100035 | 3300025233 | Bacteria | 481110 |
| 212 | Ga0209258_100011 | 3300025242 | Bacteria | 867542 |
| 213 | Ga0209258_101616 | 3300025242 | Bacteria | 7335 |
| 214 | Ga0209646_1000188 | 3300025246 | Bacteria | 76972 |
| 215 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 216 | Ga0209677_100068 | 3300025253 | Bacteria | 146135 |
| 217 | Ga0209677_100159 | 3300025253 | Bacteria | 61322 |
| 218 | Ga0209677_101949 | 3300025253 | Bacteria | 8239 |
| 219 | Ga0209148_1000013 | 3300025254 | Bacteria | 956684 |
| 220 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 221 | Ga0207666_1005952 | 3300025271 | Bacteria | 1570 |
| 222 | Ga0209455_1000012 | 3300025272 | Bacteria | 867234 |
| 223 | Ga0209455_1039536 | 3300025272 | Bacteria | 727 |
| 224 | Ga0209130_1000252 | 3300025284 | Bacteria | 67611 |
| 225 | Ga0209676_1000361 | 3300025292 | Bacteria | 85925 |
| 226 | Ga0209025_1000633 | 3300025294 | Bacteria | 62208 |
| 227 | Ga0209758_1002743 | 3300025297 | Bacteria | 17298 |
| 228 | Ga0207426_1000098 | 3300025302 | Bacteria | 264264 |
| 229 | Ga0209051_1000184 | 3300025303 | Bacteria | 112134 |
| 230 | Ga0209257_1014244 | 3300025304 | Bacteria | 3434 |
| 231 | Ga0207656_10080509 | 3300025321 | Bacteria | 1463 |
| 232 | Ga0207696_1003005 | 3300025711 | Bacteria | 7881 |
| 233 | Ga0207655_1005696 | 3300025728 | Bacteria | 8419 |
| 234 | Ga0207713_1000001 | 3300025735 | Bacteria | 2295391 |
| 235 | Ga0207713_1000191 | 3300025735 | Bacteria | 85634 |
| 236 | Ga0207713_1092495 | 3300025735 | Bacteria | 1060 |
| 237 | Ga0207688_10126059 | 3300025901 | Bacteria | 1497 |
| 238 | Ga0207680_10114877 | 3300025903 | Bacteria | 1752 |
| 239 | Ga0207643_10125518 | 3300025908 | Bacteria | 1523 |
| 240 | Ga0207684_11056103 | 3300025910 | Bacteria | 678 |
| 241 | Ga0207654_10061360 | 3300025911 | Bacteria | 2200 |
| 242 | Ga0207654_10406732 | 3300025911 | Bacteria | 947 |
| 243 | Ga0207695_10000367 | 3300025913 | Bacteria | 103313 |
| 244 | Ga0207695_10009048 | 3300025913 | Bacteria | 12379 |
| 245 | Ga0207695_10096782 | 3300025913 | Bacteria | 2953 |
| 246 | Ga0207695_10320613 | 3300025913 | Bacteria | 1439 |
| 247 | Ga0207671_10033198 | 3300025914 | Bacteria | 3840 |
| 248 | Ga0207693_10257805 | 3300025915 | Bacteria | 1368 |
| 249 | Ga0207693_10274949 | 3300025915 | Unclassified | 1320 |
| 250 | Ga0207663_10924975 | 3300025916 | Bacteria | 698 |
| 251 | Ga0207657_10050442 | 3300025919 | Bacteria | 3622 |
| 252 | Ga0207649_10449572 | 3300025920 | Bacteria | 972 |
| 253 | Ga0207652_10299642 | 3300025921 | Bacteria | 1451 |
| 254 | Ga0207646_10157502 | 3300025922 | Bacteria | 2049 |
| 255 | Ga0207646_10192556 | 3300025922 | Bacteria | 1842 |
| 256 | Ga0207681_10003328 | 3300025923 | Bacteria | 10062 |
| 257 | Ga0207694_10441111 | 3300025924 | Bacteria | 1086 |
| 258 | Ga0207650_10021599 | 3300025925 | Bacteria | 4548 |
| 259 | Ga0207650_10202213 | 3300025925 | Bacteria | 1592 |
| 260 | Ga0207659_10014095 | 3300025926 | Bacteria | 5147 |
| 261 | Ga0207659_10200081 | 3300025926 | Bacteria | 1595 |
| 262 | Ga0207664_10166103 | 3300025929 | Bacteria | 1886 |
| 263 | Ga0207644_10024515 | 3300025931 | Bacteria | 4143 |
| 264 | Ga0207644_10758387 | 3300025931 | Bacteria | 811 |
| 265 | Ga0207690_10519281 | 3300025932 | Bacteria | 965 |
| 266 | Ga0207706_10446359 | 3300025933 | Bacteria | 1119 |
| 267 | Ga0207709_10001520 | 3300025935 | Bacteria | 16003 |
| 268 | Ga0207709_10224695 | 3300025935 | Bacteria | 1356 |
| 269 | Ga0207670_10001268 | 3300025936 | Bacteria | 13343 |
| 270 | Ga0207670_10364038 | 3300025936 | Bacteria | 1148 |
| 271 | Ga0207704_10693974 | 3300025938 | Bacteria | 842 |
| 272 | Ga0207665_10023132 | 3300025939 | Bacteria | 4093 |
| 273 | Ga0207665_10129343 | 3300025939 | Bacteria | 1791 |
| 274 | Ga0207691_10155232 | 3300025940 | Bacteria | 2010 |
| 275 | Ga0207691_10176513 | 3300025940 | Bacteria | 1868 |
| 276 | Ga0207711_10024965 | 3300025941 | Bacteria | 5013 |
| 277 | Ga0207711_10055594 | 3300025941 | Bacteria | 3398 |
| 278 | Ga0207689_10014798 | 3300025942 | Bacteria | 6623 |
| 279 | Ga0207661_10001828 | 3300025944 | Bacteria | 14543 |
| 280 | Ga0207661_10759338 | 3300025944 | Bacteria | 893 |
| 281 | Ga0207679_10000614 | 3300025945 | Bacteria | 23779 |
| 282 | Ga0207667_10053462 | 3300025949 | Bacteria | 4250 |
| 283 | Ga0207712_10021071 | 3300025961 | Bacteria | 4275 |
| 284 | Ga0207668_10133391 | 3300025972 | Bacteria | 1899 |
| 285 | Ga0207658_10135093 | 3300025986 | Bacteria | 1987 |
| 286 | Ga0207658_11528736 | 3300025986 | Bacteria | 610 |
| 287 | Ga0207677_10464250 | 3300026023 | Bacteria | 1087 |
| 288 | Ga0207703_10194438 | 3300026035 | Bacteria | 1799 |
| 289 | Ga0207708_10335657 | 3300026075 | Bacteria | 1237 |
| 290 | Ga0207702_10000553 | 3300026078 | Bacteria | 41640 |
| 291 | Ga0207702_10010507 | 3300026078 | Bacteria | 7743 |
| 292 | Ga0207702_10748049 | 3300026078 | Bacteria | 965 |
| 293 | Ga0207674_10004589 | 3300026116 | Bacteria | 16584 |
| 294 | Ga0207674_10018697 | 3300026116 | Bacteria | 7524 |
| 295 | Ga0207675_100042747 | 3300026118 | Bacteria | 4231 |
| 296 | Ga0207683_10297604 | 3300026121 | Bacteria | 1476 |
| 297 | Ga0207698_10054912 | 3300026142 | Bacteria | 3067 |
| 298 | Ga0209371_1002254 | 3300027312 | Bacteria | 11080 |
| 299 | Ga0209371_1003244 | 3300027312 | Bacteria | 8116 |
| 300 | Ga0207428_10074873 | 3300027907 | Bacteria | 2654 |
| 301 | Ga0268266_10514215 | 3300028379 | Bacteria | 1144 |
| 302 | Ga0268266_10601452 | 3300028379 | Bacteria | 1056 |
| 303 | Ga0268266_10774798 | 3300028379 | Bacteria | 926 |
| 304 | Ga0268265_10097078 | 3300028380 | Bacteria | 2370 |
| 305 | Ga0268264_10529128 | 3300028381 | Bacteria | 1153 |
| 306 | Ga0268264_11157188 | 3300028381 | Bacteria | 783 |
| 307 | Ga0265338_10223600 | 3300028800 | Bacteria | 1405 |
| 308 | Ga0268256_1001589 | 3300030500 | Bacteria | 13256 |
| 309 | Ga0265768_100242 | 3300030963 | Bacteria | 2021 |
| 310 | Ga0265327_10007638 | 3300031251 | Bacteria | 8287 |
| 311 | Ga0265316_10043108 | 3300031344 | Bacteria | 3601 |
| 312 | Ga0265316_10069217 | 3300031344 | Bacteria | 2724 |
| 313 | Ga0265316_10222637 | 3300031344 | Bacteria | 1392 |
| 314 | Ga0316579_10013986 | 3300031691 | Bacteria | 3461 |
| 315 | Ga0316579_10041831 | 3300031691 | Bacteria | 2127 |
| 316 | Ga0316576_10009927 | 3300031727 | Bacteria | 6162 |
| 317 | Ga0316576_10092149 | 3300031727 | Bacteria | 2258 |
| 318 | Ga0316576_10170496 | 3300031727 | Bacteria | 1642 |
| 319 | Ga0316576_10170499 | 3300031727 | Bacteria | 1642 |
| 320 | Ga0316578_10179341 | 3300031728 | Bacteria | 1276 |
| 321 | Ga0316578_10301757 | 3300031728 | Bacteria | 957 |
| 322 | Ga0316577_10041335 | 3300031733 | Bacteria | 2579 |
| 323 | Ga0316577_10051452 | 3300031733 | Bacteria | 2298 |
| 324 | Ga0307412_10016003 | 3300031911 | Bacteria | 4457 |
| 325 | Ga0307414_10098255 | 3300032004 | Bacteria | 2196 |
| 326 | Ga0316583_10033426 | 3300032133 | Bacteria | 1827 |
| 327 | Ga0316583_10173901 | 3300032133 | Bacteria | 749 |
| 328 | Ga0316585_10005378 | 3300032137 | Bacteria | 3612 |
| 329 | Ga0316580_10001491 | 3300032139 | Bacteria | 6134 |
| 330 | Ga0316593_10000488 | 3300032168 | Bacteria | 7342 |
| 331 | Ga0316593_10020556 | 3300032168 | Bacteria | 2054 |
| 332 | Ga0316592_1001006 | 3300033524 | Bacteria | 4353 |
| 333 | Ga0316592_1002951 | 3300033524 | Bacteria | 3003 |
| 334 | Ga0316592_1003160 | 3300033524 | Bacteria | 2937 |
| 335 | Ga0316592_1042423 | 3300033524 | Bacteria | 1008 |
| 336 | Ga0316592_1046781 | 3300033524 | Unclassified | 963 |
| 337 | Ga0316592_1085722 | 3300033524 | Bacteria | 718 |
| 338 | Ga0316586_1002585 | 3300033527 | Bacteria | 2276 |
| 339 | Ga0316586_1029737 | 3300033527 | Bacteria | 931 |
| 340 | Ga0316588_1018969 | 3300033528 | Bacteria | 1545 |
| 341 | Ga0316588_1021639 | 3300033528 | Bacteria | 1464 |
| 342 | Ga0316587_1001414 | 3300033529 | Bacteria | 2949 |
| 343 | Ga0316596_1029621 | 3300033541 | Bacteria | 1417 |
| 344 | Ga0373934_0002760 | 3300035086 | Bacteria | 6439 |
| 345 | Ga0316574_0007153 | 3300035398 | Bacteria | 6101 |
| 346 | Ga0316574_0016600 | 3300035398 | Bacteria | 4293 |
| 347 | Ga0316584_0416826 | 3300036712 | Bacteria | 954 |
| 348 | Ga0395900_0237124 | 3300037418 | Bacteria | 1832 |
| 349 | Ga0395898_0433956 | 3300037466 | Bacteria | 1252 |
| 350 | Ga0316581_0121049 | 3300037588 | Bacteria | 807 |
| 351 | Ga0316581_0165608 | 3300037588 | Bacteria | 681 |
| 352 | Ga0436364_0037831 | 3300037853 | Bacteria | 3819 |
| 353 | Ga0436364_1085191 | 3300037853 | Bacteria | 15736 |
| 354 | Ga0395901_0020370 | 3300038443 | Bacteria | 6790 |
| 355 | Ga0395901_0818530 | 3300038443 | Bacteria | 919 |
| 356 | Ga0400485_05534 | 3300038735 | Bacteria | 1644 |
| 357 | Ga0400483_199082 | 3300039062 | Bacteria | 3226 |
| 358 | Ga0400489_37544 | 3300039093 | Bacteria | 5843 |
| 359 | Ga0400487_10280 | 3300039110 | Bacteria | 138613 |
| 360 | Ga0400487_17580 | 3300039110 | Bacteria | 5719 |
| 361 | Ga0400487_41326 | 3300039110 | Bacteria | 1229 |
| 362 | Ga0436365_0647074 | 3300039437 | Bacteria | 3335 |
| 363 | Ga0436365_1112230 | 3300039437 | Bacteria | 19675 |
| 364 | Ga0436365_1625636 | 3300039437 | Bacteria | 6413 |
| 365 | Ga0436360_0122311 | 3300039438 | Bacteria | 6258 |
| 366 | Ga0436360_0619086 | 3300039438 | Bacteria | 1074 |
| 367 | Ga0436360_0735944 | 3300039438 | Bacteria | 5963 |
| 368 | Ga0436360_0885445 | 3300039438 | Bacteria | 1485 |
| 369 | Ga0436360_1317915 | 3300039438 | Bacteria | 1677 |
| 370 | Ga0436361_0013250 | 3300039447 | Bacteria | 11384 |
| 371 | Ga0436361_0193310 | 3300039447 | Bacteria | 2431 |
| 372 | Ga0436361_0294503 | 3300039447 | Bacteria | 2459 |
| 373 | Ga0436361_0298641 | 3300039447 | Bacteria | 4915 |
| 374 | Ga0436361_0528059 | 3300039447 | Bacteria | 2892 |
| 375 | Ga0436361_0740948 | 3300039447 | Bacteria | 4091 |
| 376 | Ga0436363_0479409 | 3300039450 | Bacteria | 7404 |
| 377 | Ga0436363_1298424 | 3300039450 | Bacteria | 747 |
| 378 | Ga0436363_1688978 | 3300039450 | Bacteria | 1769 |
| 379 | Ga0436362_0579570 | 3300039453 | Bacteria | 1200 |
| 380 | Ga0436362_0829410 | 3300039453 | Bacteria | 1298 |
| 381 | Ga0436362_0999886 | 3300039453 | Bacteria | 1176 |
| 382 | Ga0436362_1117703 | 3300039453 | Bacteria | 1405 |
| 383 | Ga0439436_0003170 | 3300041404 | Bacteria | 4986 |
| 384 | Ga0439438_038442 | 3300041405 | Bacteria | 1249 |
| 385 | Ga0439439_0015255 | 3300041406 | Bacteria | 1874 |
| 386 | Ga0439466_0000057 | 3300041411 | Bacteria | 45095 |
| 387 | Ga0439465_0007042 | 3300041413 | Bacteria | 3573 |
| 388 | Ga0439465_0197813 | 3300041413 | Bacteria | 732 |
| 389 | Ga0451839_0778740 | 3300041496 | Bacteria | 599 |
| 390 | Ga0451841_0317458 | 3300041498 | Bacteria | 1381 |
| 391 | Ga0439431_0008305 | 3300041997 | Bacteria | 2332 |
| 392 | Ga0439432_107314 | 3300042006 | Bacteria | 832 |
| 393 | Ga0439449_0001163 | 3300042007 | Bacteria | 10312 |
| 394 | Ga0439452_020204 | 3300042010 | Bacteria | 1750 |
| 395 | Ga0439457_009092 | 3300042014 | Bacteria | 2320 |
| 396 | Ga0439462_0006135 | 3300042015 | Bacteria | 2979 |
| 397 | Ga0439463_054315 | 3300042016 | Bacteria | 1022 |
| 398 | Ga0450907_000087 | 3300042146 | Bacteria | 36820 |
| 399 | Ga0439464_0011074 | 3300042439 | Bacteria | 2384 |
| 400 | Ga0451577_0000645 | 3300042876 | Bacteria | 55477 |
| 401 | Ga0451577_0005076 | 3300042876 | Bacteria | 13585 |
| 402 | Ga0453684_0000625 | 3300044712 | Bacteria | 128854 |
| 403 | Ga0453684_0005496 | 3300044712 | Bacteria | 25046 |
| 404 | Ga0453684_0151515 | 3300044712 | Bacteria | 2755 |
| 405 | Ga0453684_2081223 | 3300044712 | Bacteria | 570 |
| 406 | Ga0451576_0369423 | 3300045051 | Bacteria | 1503 |
| 407 | Ga0451576_0504970 | 3300045051 | Bacteria | 1270 |
| 408 | Ga0466967_0640524 | 3300045976 | Bacteria | 1051 |
| 409 | Ga0466967_0671875 | 3300045976 | Bacteria | 1025 |
| 410 | Ga0466967_1128638 | 3300045976 | Bacteria | 781 |
| 411 | Ga0495617_000351 | 3300046452 | Bacteria | 25399 |
| 412 | Ga0495627_004507 | 3300046453 | Bacteria | 5809 |
| 413 | Ga0495590_0000330 | 3300046457 | Bacteria | 24619 |
| 414 | Ga0495591_000771 | 3300046458 | Bacteria | 23136 |
| 415 | Ga0495638_0017837 | 3300046460 | Bacteria | 4724 |
| 416 | Ga0495650_0049242 | 3300046471 | Bacteria | 1751 |
| 417 | Ga0495605_0002234 | 3300046474 | Bacteria | 12096 |
| 418 | Ga0495607_0015910 | 3300046501 | Bacteria | 4863 |
| 419 | Ga0495607_0176321 | 3300046501 | Bacteria | 1075 |
| 420 | Ga0495583_0301096 | 3300046506 | Bacteria | 637 |
| 421 | Ga0495606_0001952 | 3300046507 | Bacteria | 25463 |
| 422 | Ga0495606_0081511 | 3300046507 | Bacteria | 2011 |
| 423 | Ga0495606_0213863 | 3300046507 | Bacteria | 1090 |
| 424 | Ga0495610_0043936 | 3300046512 | Bacteria | 2222 |
| 425 | Ga0495610_0071082 | 3300046512 | Bacteria | 1623 |
| 426 | Ga0495632_0001068 | 3300046519 | Bacteria | 23479 |
| 427 | Ga0495648_0011077 | 3300046524 | Bacteria | 6827 |
| 428 | Ga0495648_0056432 | 3300046524 | Bacteria | 2363 |
| 429 | Ga0495642_0145131 | 3300046528 | Bacteria | 1025 |
| 430 | Ga0495667_0344900 | 3300046559 | Bacteria | 941 |
| 431 | Ga0495611_0038153 | 3300046648 | Bacteria | 2136 |
| 432 | Ga0495625_0111134 | 3300046660 | Bacteria | 1873 |
| 433 | Ga0495635_0099457 | 3300046663 | Bacteria | 1988 |
| 434 | Ga0495661_0000628 | 3300046665 | Bacteria | 35864 |
| 435 | Ga0495669_0018905 | 3300046684 | Bacteria | 2968 |
| 436 | Ga0495613_0172168 | 3300046689 | Bacteria | 1536 |
| 437 | Ga0495670_0040760 | 3300046691 | Bacteria | 2316 |
| 438 | Ga0495589_0040157 | 3300046794 | Bacteria | 2337 |
| 439 | Ga0495660_0056313 | 3300046810 | Bacteria | 2124 |
| 440 | Ga0495660_0140598 | 3300046810 | Bacteria | 1202 |
| 441 | Ga0495636_0337480 | 3300047318 | Bacteria | 710 |
| 442 | Ga0495674_0279321 | 3300047319 | Bacteria | 1368 |
| 443 | Ga0495672_0000418 | 3300047320 | Bacteria | 51297 |
| 444 | Ga0495683_0234612 | 3300047323 | Bacteria | 812 |
| 445 | Ga0495675_0454107 | 3300047444 | Bacteria | 741 |
| 446 | Ga0495679_002048 | 3300047446 | Bacteria | 10643 |
| 447 | Ga0495679_047506 | 3300047446 | Bacteria | 1302 |
| 448 | Ga0495685_143103 | 3300047447 | Bacteria | 778 |
| 449 | Ga0495673_0062452 | 3300047469 | Bacteria | 1591 |
| 450 | Ga0495673_0063322 | 3300047469 | Bacteria | 1577 |
| 451 | Ga0495681_0029578 | 3300047470 | Bacteria | 2802 |
| 452 | Ga0495684_0171327 | 3300047471 | Unclassified | 1614 |
| 453 | Ga0495686_0026685 | 3300047472 | Bacteria | 3778 |
| 454 | Ga0495626_0253806 | 3300048091 | Bacteria | 705 |
| 455 | Ga0496100_0065607 | 3300048903 | Bacteria | 2406 |
| 456 | Ga0496100_0271530 | 3300048903 | Bacteria | 1261 |
| 457 | Ga0496101_0165589 | 3300048904 | Bacteria | 1697 |
| 458 | Ga0496101_0364762 | 3300048904 | Bacteria | 1136 |
| 459 | Ga0496102_0005459 | 3300048905 | Bacteria | 10782 |
| 460 | Ga0496102_0029734 | 3300048905 | Bacteria | 4889 |
| 461 | Ga0496103_0601470 | 3300048906 | Bacteria | 700 |
| 462 | Ga0496104_0001980 | 3300048907 | Bacteria | 17748 |
| 463 | Ga0496104_0261089 | 3300048907 | Bacteria | 1645 |
| 464 | Ga0496105_0002026 | 3300048908 | Bacteria | 14644 |
| 465 | Ga0496105_0127690 | 3300048908 | Bacteria | 2096 |
| 466 | Ga0496105_0449582 | 3300048908 | Bacteria | 1017 |
| 467 | Ga0496105_0650575 | 3300048908 | Bacteria | 813 |
| 468 | Ga0496106_0181996 | 3300048909 | Bacteria | 1668 |
| 469 | Ga0496107_0093129 | 3300048910 | Bacteria | 2203 |
| 470 | Ga0496108_0008532 | 3300048911 | Bacteria | 8311 |
| 471 | Ga0496108_0927943 | 3300048911 | Bacteria | 746 |
| 472 | Ga0496109_0004929 | 3300048912 | Bacteria | 11141 |
| 473 | Ga0496110_0000797 | 3300048913 | Bacteria | 22029 |
| 474 | Ga0496111_0001605 | 3300048914 | Bacteria | 13078 |
| 475 | Ga0496112_0002405 | 3300048915 | Bacteria | 15065 |
| 476 | Ga0496113_0065318 | 3300048916 | Bacteria | 2754 |
| 477 | Ga0496113_1016570 | 3300048916 | Bacteria | 652 |
| 478 | Ga0496114_0432381 | 3300048917 | Bacteria | 1166 |
| 479 | Ga0496116_0016892 | 3300048919 | Bacteria | 5691 |
| 480 | Ga0496117_0000004 | 3300048920 | Bacteria | 877131 |
| 481 | Ga0496117_0000602 | 3300048920 | Bacteria | 58964 |
| 482 | Ga0496118_0000072 | 3300048921 | Bacteria | 201387 |
| 483 | Ga0496118_0000232 | 3300048921 | Bacteria | 97818 |
| 484 | Ga0496118_0059872 | 3300048921 | Bacteria | 2832 |
| 485 | Ga0496119_0000064 | 3300048922 | Bacteria | 167571 |
| 486 | Ga0496119_0004654 | 3300048922 | Bacteria | 13530 |
| 487 | Ga0496120_0000067 | 3300048923 | Bacteria | 167571 |
| 488 | Ga0496120_0000733 | 3300048923 | Bacteria | 48086 |
| 489 | Ga0496121_0000047 | 3300048924 | Bacteria | 335768 |
| 490 | Ga0496122_0001991 | 3300048925 | Bacteria | 30461 |
| 491 | Ga0496122_0236883 | 3300048925 | Bacteria | 1032 |
| 492 | Ga0496123_0000620 | 3300048926 | Bacteria | 59624 |
| 493 | Ga0496123_0001262 | 3300048926 | Bacteria | 36371 |
| 494 | Ga0496123_0093427 | 3300048926 | Bacteria | 1776 |
| 495 | Ga0496124_0011554 | 3300048927 | Bacteria | 8811 |
| 496 | Ga0496124_0020783 | 3300048927 | Bacteria | 6058 |
| 497 | Ga0496124_0026780 | 3300048927 | Bacteria | 5191 |
| 498 | Ga0496124_0067980 | 3300048927 | Bacteria | 2963 |
| 499 | Ga0496125_0010211 | 3300048928 | Bacteria | 9519 |
| 500 | Ga0496126_0094497 | 3300048929 | Bacteria | 2623 |
| 501 | Ga0501305_045353 | 3300049161 | Bacteria | 725 |
| 502 | Ga0495678_023508 | 3300049459 | Bacteria | 2677 |
| 503 | Ga0495682_0118519 | 3300049460 | Bacteria | 948 |
| 504 | Ga0501032_0010263 | 3300049569 | Bacteria | 6757 |
| 505 | Ga0501033_0044696 | 3300049570 | Bacteria | 3297 |
| 506 | Ga0501034_0000360 | 3300049571 | Bacteria | 77568 |
| 507 | Ga0501036_0052069 | 3300049572 | Bacteria | 3467 |
| 508 | Ga0501037_0017106 | 3300049573 | Bacteria | 5336 |
| 509 | Ga0501038_0001066 | 3300049574 | Bacteria | 24743 |
| 510 | Ga0501039_0057645 | 3300049575 | Bacteria | 3008 |
| 511 | Ga0501040_0240972 | 3300049576 | Bacteria | 1289 |
| 512 | Ga0501041_0337238 | 3300049577 | Bacteria | 952 |
| 513 | Ga0501043_0141259 | 3300049579 | Bacteria | 1886 |
| 514 | Ga0501043_0277487 | 3300049579 | Bacteria | 1285 |
| 515 | Ga0501047_0051264 | 3300049581 | Bacteria | 3987 |
| 516 | Ga0501070_0256868 | 3300049586 | Bacteria | 1429 |
| 517 | Ga0501070_0892663 | 3300049586 | Bacteria | 694 |
| 518 | Ga0501071_0043370 | 3300049587 | Bacteria | 3225 |
| 519 | Ga0501072_0187412 | 3300049588 | Bacteria | 1650 |
| 520 | Ga0501073_0086140 | 3300049589 | Bacteria | 2185 |
| 521 | Ga0501073_0642243 | 3300049589 | Bacteria | 733 |
| 522 | Ga0501075_0146537 | 3300049591 | Bacteria | 1799 |
| 523 | Ga0501076_0126635 | 3300049592 | Bacteria | 2070 |
| 524 | Ga0501077_0301729 | 3300049593 | Bacteria | 1020 |
| 525 | Ga0501079_0020772 | 3300049741 | Bacteria | 5021 |
| 526 | Ga0501080_0050121 | 3300049742 | Bacteria | 3887 |
| 527 | Ga0501080_0419990 | 3300049742 | Bacteria | 1201 |
| 528 | Ga0501081_0577002 | 3300049743 | Bacteria | 841 |
| 529 | Ga0501035_0141518 | 3300049822 | Bacteria | 2091 |
| 530 | Ga0501044_0751562 | 3300049823 | Bacteria | 857 |
| 531 | Ga0501045_0079226 | 3300049824 | Bacteria | 2422 |
| 532 | nmdc:mga00v17_573_c1 | 3300050491 | Bacteria | 20549 |
| 533 | nmdc:mga00v17_6948_c2 | 3300050491 | Bacteria | 3215 |
| 534 | nmdc:mga05p37_572542_c1 | 3300050507 | Bacteria | 1281 |
| 535 | nmdc:mga05p37_767580_c1 | 3300050507 | Bacteria | 1060 |
| 536 | nmdc:mga05p37_84853_c1 | 3300050507 | Bacteria | 3902 |
| 537 | nmdc:mga09592_102526_c1 | 3300050508 | Bacteria | 2451 |
| 538 | nmdc:mga09592_123224_c1 | 3300050508 | Bacteria | 2227 |
| 539 | nmdc:mga09592_454_c1 | 3300050508 | Bacteria | 30435 |
| 540 | nmdc:mga0qj67_3504_c1 | 3300050509 | Bacteria | 11318 |
| 541 | nmdc:mga06r32_1074283_c1 | 3300050510 | Bacteria | 755 |
| 542 | nmdc:mga06r32_4114_c1 | 3300050510 | Bacteria | 13027 |
| 543 | nmdc:mga06r32_873478_c1 | 3300050510 | Bacteria | 857 |
| 544 | nmdc:mga08y16_132674_c1 | 3300050511 | Bacteria | 2589 |
| 545 | nmdc:mga08y16_6519_c1 | 3300050511 | Bacteria | 12241 |
| 546 | nmdc:mga08y16_659104_c1 | 3300050511 | Bacteria | 1050 |
| 547 | nmdc:mga0n895_419834_c1 | 3300050512 | Bacteria | 1352 |
| 548 | nmdc:mga0n895_555639_c1 | 3300050512 | Bacteria | 1153 |
| 549 | nmdc:mga0rr50_321004_c1 | 3300050513 | Bacteria | 1298 |
| 550 | nmdc:mga0a205_81623_c1 | 3300050515 | Bacteria | 3123 |
| 551 | Ga0495619_0225062 | 3300053085 | Bacteria | 1299 |
| 552 | Ga0500568_0075403 | 3300053139 | Bacteria | 1286 |
| 553 | Ga0500622_0009545 | 3300053156 | Bacteria | 5364 |
| 554 | Ga0501084_0074109 | 3300054114 | Bacteria | 2850 |
| 555 | Ga0587082_109187 | 3300059504 | Bacteria | 612 |
| 556 | Ga0587085_024346 | 3300059506 | Bacteria | 948 |
| 557 | Ga0587079_094509 | 3300059647 | Bacteria | 705 |
| 558 | Ga0587105_014637 | 3300059651 | Bacteria | 637 |
| 559 | Ga0501082_0108180 | 3300060353 | Bacteria | 2406 |
| 560 | Ga0466962_0393800 | 3300061719 | Bacteria | 693 |
| 561 | Ga0530510_0173840 | 3300061734 | Bacteria | 1596 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050491 | nmdc:mga00v17_6948_c2 | nmdc:mga00v17_6948_c2_1289_1819 | 151 |
| 2 | 3300006048 | Ga0075363_100563875 | Ga0075363_1005638751 | 154 |
| 3 | iso_pu_bacteria | 2738541317 | 2738947197 | 159 |
| 4 | iso_pu_bacteria | 2913308742 | 2913312706 | 159 |
| 5 | iso_pu_bacteria | 2643221577 | 2643896951 | 160 |
| 6 | iso_pu_bacteria | 2643221685 | 2644479158 | 160 |
| 7 | iso_pu_bacteria | 2608642108 | 2608669145 | 161 |
| 8 | iso_pu_bacteria | 2791355123 | 2792751043 | 161 |
| 9 | iso_pu_bacteria | 2844528606 | 2844530645 | 161 |
| 10 | iso_pu_bacteria | 2865014394 | 2865018577 | 161 |
| 11 | iso_pu_bacteria | 2882632389 | 2882637740 | 161 |
| 12 | iso_pu_bacteria | 2945951305 | 2945953317 | 161 |
| 13 | iso_pu_bacteria | 2978975091 | 2978975847 | 161 |
| 14 | 3300005546 | Ga0070696_100479588 | Ga0070696_1004795882 | 162 |
| 15 | 3300053156 | Ga0500622_0009545 | Ga0500622_0009545_4212_4706 | 162 |
| 16 | iso_pu_bacteria | 2687453341 | 2688393926 | 162 |
| 17 | iso_pu_bacteria | 2718218334 | 2721027451 | 162 |
| 18 | iso_pu_bacteria | 2734482264 | 2735836975 | 162 |
| 19 | iso_pu_bacteria | 2738541296 | 2738822698 | 162 |
| 20 | iso_pu_bacteria | 2738541298 | 2738834905 | 162 |
| 21 | iso_pu_bacteria | 2738541306 | 2738876384 | 162 |
| 22 | iso_pu_bacteria | 2738543002 | 2739188328 | 162 |
| 23 | iso_pu_bacteria | 2738543008 | 2739222981 | 162 |
| 24 | iso_pu_bacteria | 2738543009 | 2739226376 | 162 |
| 25 | iso_pu_bacteria | 2894510363 | 2894512328 | 162 |
| 26 | iso_pu_bacteria | 2945934425 | 2945940000 | 162 |
| 27 | iso_pu_bacteria | 2990703756 | 2990707124 | 162 |
| 28 | iso_pu_bacteria | 641736151 | 642424080 | 162 |
| 29 | 3300006844 | Ga0075428_100942295 | Ga0075428_1009422951 | 163 |
| 30 | 3300006847 | Ga0075431_100638363 | Ga0075431_1006383632 | 163 |
| 31 | 3300006880 | Ga0075429_100164669 | Ga0075429_1001646692 | 163 |
| 32 | 3300009147 | Ga0114129_10711678 | Ga0114129_107116782 | 163 |
| 33 | iso_pu_bacteria | 2537561836 | 2538833918 | 163 |
| 34 | iso_pu_bacteria | 2643221562 | 2643831748 | 163 |
| 35 | iso_pu_bacteria | 3000376612 | 3000377678 | 163 |
| 36 | iso_pu_bacteria | 639633007 | 639789062 | 163 |
| 37 | 3300002737 | JGI25162J39368_1008911 | JGI25162J39368_10089112 | 164 |
| 38 | 3300005347 | Ga0070668_100006994 | Ga0070668_1000069945 | 164 |
| 39 | 3300005353 | Ga0070669_100563751 | Ga0070669_1005637512 | 164 |
| 40 | 3300005548 | Ga0070665_100411879 | Ga0070665_1004118791 | 164 |
| 41 | 3300005563 | Ga0068855_100096411 | Ga0068855_1000964114 | 164 |
| 42 | 3300005614 | Ga0068856_100067645 | Ga0068856_1000676452 | 164 |
| 43 | 3300009011 | Ga0105251_10315113 | Ga0105251_103151131 | 164 |
| 44 | 3300009036 | Ga0105244_10038121 | Ga0105244_100381211 | 164 |
| 45 | 3300009036 | Ga0105244_10244760 | Ga0105244_102447602 | 164 |
| 46 | 3300009174 | Ga0105241_10326067 | Ga0105241_103260672 | 164 |
| 47 | 3300011119 | Ga0105246_10004710 | Ga0105246_100047109 | 164 |
| 48 | 3300013100 | Ga0157373_10068497 | Ga0157373_100684971 | 164 |
| 49 | 3300013100 | Ga0157373_11080308 | Ga0157373_110803081 | 164 |
| 50 | 3300013102 | Ga0157371_10310175 | Ga0157371_103101751 | 164 |
| 51 | 3300013104 | Ga0157370_10120323 | Ga0157370_101203232 | 164 |
| 52 | 3300013105 | Ga0157369_10053690 | Ga0157369_100536904 | 164 |
| 53 | 3300013307 | Ga0157372_10134794 | Ga0157372_101347943 | 164 |
| 54 | 3300013307 | Ga0157372_10171417 | Ga0157372_101714171 | 164 |
| 55 | 3300014497 | Ga0182008_10067121 | Ga0182008_100671212 | 164 |
| 56 | 3300015261 | Ga0182006_1046717 | Ga0182006_10467172 | 164 |
| 57 | 3300015262 | Ga0182007_10028397 | Ga0182007_100283972 | 164 |
| 58 | 3300017792 | Ga0163161_10023197 | Ga0163161_100231972 | 164 |
| 59 | 3300020078 | Ga0206352_10308299 | Ga0206352_103082991 | 164 |
| 60 | 3300025207 | Ga0209760_106254 | Ga0209760_1062542 | 164 |
| 61 | 3300025226 | Ga0209674_100104 | Ga0209674_10010424 | 164 |
| 62 | 3300025228 | Ga0209672_100009 | Ga0209672_100009426 | 164 |
| 63 | 3300025233 | Ga0209437_100035 | Ga0209437_100035456 | 164 |
| 64 | 3300025242 | Ga0209258_100011 | Ga0209258_100011218 | 164 |
| 65 | 3300025253 | Ga0209677_101949 | Ga0209677_1019499 | 164 |
| 66 | 3300025254 | Ga0209148_1000013 | Ga0209148_1000013218 | 164 |
| 67 | 3300025272 | Ga0209455_1000012 | Ga0209455_1000012218 | 164 |
| 68 | 3300025711 | Ga0207696_1003005 | Ga0207696_10030057 | 164 |
| 69 | 3300025728 | Ga0207655_1005696 | Ga0207655_10056965 | 164 |
| 70 | 3300025735 | Ga0207713_1000001 | Ga0207713_1000001757 | 164 |
| 71 | 3300025735 | Ga0207713_1092495 | Ga0207713_10924951 | 164 |
| 72 | 3300025911 | Ga0207654_10406732 | Ga0207654_104067322 | 164 |
| 73 | 3300025913 | Ga0207695_10000367 | Ga0207695_1000036728 | 164 |
| 74 | 3300025929 | Ga0207664_10166103 | Ga0207664_101661033 | 164 |
| 75 | 3300025972 | Ga0207668_10133391 | Ga0207668_101333912 | 164 |
| 76 | 3300026078 | Ga0207702_10010507 | Ga0207702_100105079 | 164 |
| 77 | 3300027312 | Ga0209371_1002254 | Ga0209371_100225411 | 164 |
| 78 | 3300027312 | Ga0209371_1003244 | Ga0209371_10032447 | 164 |
| 79 | 3300028379 | Ga0268266_10601452 | Ga0268266_106014522 | 164 |
| 80 | 3300030500 | Ga0268256_1001589 | Ga0268256_10015894 | 164 |
| 81 | 3300041405 | Ga0439438_038442 | Ga0439438_038442_552_1097 | 164 |
| 82 | 3300041411 | Ga0439466_0000057 | Ga0439466_0000057_39290_39835 | 164 |
| 83 | 3300041498 | Ga0451841_0317458 | Ga0451841_0317458_800_1309 | 164 |
| 84 | 3300042006 | Ga0439432_107314 | Ga0439432_107314_71_616 | 164 |
| 85 | 3300042010 | Ga0439452_020204 | Ga0439452_020204_127_672 | 164 |
| 86 | 3300042016 | Ga0439463_054315 | Ga0439463_054315_62_607 | 164 |
| 87 | 3300042146 | Ga0450907_000087 | Ga0450907_000087_16684_17229 | 164 |
| 88 | 3300042439 | Ga0439464_0011074 | Ga0439464_0011074_1770_2315 | 164 |
| 89 | 3300046453 | Ga0495627_004507 | Ga0495627_004507_3990_4490 | 164 |
| 90 | 3300046458 | Ga0495591_000771 | Ga0495591_000771_21224_21724 | 164 |
| 91 | 3300046501 | Ga0495607_0015910 | Ga0495607_0015910_2984_3484 | 164 |
| 92 | 3300046519 | Ga0495632_0001068 | Ga0495632_0001068_21614_22114 | 164 |
| 93 | 3300046524 | Ga0495648_0011077 | Ga0495648_0011077_2522_3067 | 164 |
| 94 | 3300046665 | Ga0495661_0000628 | Ga0495661_0000628_1413_1913 | 164 |
| 95 | 3300046810 | Ga0495660_0056313 | Ga0495660_0056313_685_1230 | 164 |
| 96 | 3300047320 | Ga0495672_0000418 | Ga0495672_0000418_4847_5392 | 164 |
| 97 | 3300047446 | Ga0495679_002048 | Ga0495679_002048_1666_2211 | 164 |
| 98 | 3300047469 | Ga0495673_0062452 | Ga0495673_0062452_478_978 | 164 |
| 99 | 3300047470 | Ga0495681_0029578 | Ga0495681_0029578_1286_1786 | 164 |
| 100 | 3300048903 | Ga0496100_0271530 | Ga0496100_0271530_332_877 | 164 |
| 101 | 3300048905 | Ga0496102_0029734 | Ga0496102_0029734_1925_2470 | 164 |
| 102 | 3300048908 | Ga0496105_0002026 | Ga0496105_0002026_10455_11000 | 164 |
| 103 | 3300048908 | Ga0496105_0650575 | Ga0496105_0650575_171_716 | 164 |
| 104 | 3300048919 | Ga0496116_0016892 | Ga0496116_0016892_5084_5629 | 164 |
| 105 | 3300048920 | Ga0496117_0000004 | Ga0496117_0000004_252471_253016 | 164 |
| 106 | 3300048920 | Ga0496117_0000602 | Ga0496117_0000602_17811_18356 | 164 |
| 107 | 3300048921 | Ga0496118_0000072 | Ga0496118_0000072_200781_201326 | 164 |
| 108 | 3300048921 | Ga0496118_0000232 | Ga0496118_0000232_65612_66157 | 164 |
| 109 | 3300048922 | Ga0496119_0000064 | Ga0496119_0000064_119159_119704 | 164 |
| 110 | 3300048922 | Ga0496119_0004654 | Ga0496119_0004654_9732_10277 | 164 |
| 111 | 3300048923 | Ga0496120_0000067 | Ga0496120_0000067_47869_48414 | 164 |
| 112 | 3300048923 | Ga0496120_0000733 | Ga0496120_0000733_5641_6186 | 164 |
| 113 | 3300048924 | Ga0496121_0000047 | Ga0496121_0000047_25322_25867 | 164 |
| 114 | 3300048925 | Ga0496122_0001991 | Ga0496122_0001991_16601_17146 | 164 |
| 115 | 3300048925 | Ga0496122_0236883 | Ga0496122_0236883_171_716 | 164 |
| 116 | 3300048926 | Ga0496123_0000620 | Ga0496123_0000620_40545_41090 | 164 |
| 117 | 3300048926 | Ga0496123_0093427 | Ga0496123_0093427_685_1230 | 164 |
| 118 | 3300048927 | Ga0496124_0011554 | Ga0496124_0011554_1373_1918 | 164 |
| 119 | 3300048927 | Ga0496124_0026780 | Ga0496124_0026780_4471_5016 | 164 |
| 120 | 3300048928 | Ga0496125_0010211 | Ga0496125_0010211_3351_3896 | 164 |
| 121 | 3300048929 | Ga0496126_0094497 | Ga0496126_0094497_140_685 | 164 |
| 122 | 3300049459 | Ga0495678_023508 | Ga0495678_023508_1050_1595 | 164 |
| 123 | 3300049460 | Ga0495682_0118519 | Ga0495682_0118519_424_924 | 164 |
| 124 | 3300049586 | Ga0501070_0892663 | Ga0501070_0892663_29_541 | 164 |
| 125 | 3300050507 | nmdc:mga05p37_572542_c1 | nmdc:mga05p37_572542_c1_223_747 | 164 |
| 126 | 3300050508 | nmdc:mga09592_102526_c1 | nmdc:mga09592_102526_c1_947_1471 | 164 |
| 127 | 3300050510 | nmdc:mga06r32_873478_c1 | nmdc:mga06r32_873478_c1_218_742 | 164 |
| 128 | iso_pu_bacteria | 2513237093 | 2513636271 | 164 |
| 129 | iso_pu_bacteria | 2513237156 | 2513988173 | 164 |
| 130 | iso_pu_bacteria | 2515154134 | 2515744540 | 164 |
| 131 | iso_pu_bacteria | 2516653085 | 2517081945 | 164 |
| 132 | iso_pu_bacteria | 2519899620 | 2520381760 | 164 |
| 133 | iso_pu_bacteria | 2529292951 | 2530649693 | 164 |
| 134 | iso_pu_bacteria | 2588253730 | 2588513610 | 164 |
| 135 | iso_pu_bacteria | 2615840624 | 2616298376 | 164 |
| 136 | iso_pu_bacteria | 2718217882 | 2719178995 | 164 |
| 137 | iso_pu_bacteria | 2718217927 | 2719383551 | 164 |
| 138 | iso_pu_bacteria | 2718217997 | 2719663352 | 164 |
| 139 | iso_pu_bacteria | 2718218009 | 2719729360 | 164 |
| 140 | iso_pu_bacteria | 2718218199 | 2720488756 | 164 |
| 141 | iso_pu_bacteria | 2718218232 | 2720615784 | 164 |
| 142 | iso_pu_bacteria | 2718218235 | 2720633917 | 164 |
| 143 | iso_pu_bacteria | 2718218269 | 2720777661 | 164 |
| 144 | iso_pu_bacteria | 2718218363 | 2721143607 | 164 |
| 145 | iso_pu_bacteria | 2718218365 | 2721155355 | 164 |
| 146 | iso_pu_bacteria | 2718218366 | 2721166703 | 164 |
| 147 | iso_pu_bacteria | 2721755514 | 2722837681 | 164 |
| 148 | iso_pu_bacteria | 2721755556 | 2723031111 | 164 |
| 149 | iso_pu_bacteria | 2721755684 | 2723563775 | 164 |
| 150 | iso_pu_bacteria | 2721755685 | 2723570639 | 164 |
| 151 | iso_pu_bacteria | 2721755810 | 2724041253 | 164 |
| 152 | iso_pu_bacteria | 2721755819 | 2724087403 | 164 |
| 153 | iso_pu_bacteria | 2721755822 | 2724102186 | 164 |
| 154 | iso_pu_bacteria | 2721755823 | 2724107377 | 164 |
| 155 | iso_pu_bacteria | 2728369352 | 2730104802 | 164 |
| 156 | iso_pu_bacteria | 2728369365 | 2730161456 | 164 |
| 157 | iso_pu_bacteria | 2728369397 | 2730296235 | 164 |
| 158 | iso_pu_bacteria | 2791355256 | 2793299675 | 164 |
| 159 | iso_pu_bacteria | 2791355259 | 2793318930 | 164 |
| 160 | iso_pu_bacteria | 2791355260 | 2793325175 | 164 |
| 161 | iso_pu_bacteria | 2791355261 | 2793331423 | 164 |
| 162 | iso_pu_bacteria | 2791355262 | 2793338372 | 164 |
| 163 | iso_pu_bacteria | 2791355263 | 2793343482 | 164 |
| 164 | iso_pu_bacteria | 2791355264 | 2793351097 | 164 |
| 165 | iso_pu_bacteria | 2791355265 | 2793357319 | 164 |
| 166 | iso_pu_bacteria | 2791355266 | 2793364341 | 164 |
| 167 | iso_pu_bacteria | 2791355267 | 2793371337 | 164 |
| 168 | iso_pu_bacteria | 2802429605 | 2805931670 | 164 |
| 169 | iso_pu_bacteria | 2802429606 | 2805937935 | 164 |
| 170 | iso_pu_bacteria | 2802429633 | 2806049409 | 164 |
| 171 | iso_pu_bacteria | 2802429635 | 2806063802 | 164 |
| 172 | iso_pu_bacteria | 2802429636 | 2806071030 | 164 |
| 173 | iso_pu_bacteria | 2838016132 | 2838022059 | 164 |
| 174 | iso_pu_bacteria | 2838022645 | 2838027337 | 164 |
| 175 | iso_pu_bacteria | 2838048938 | 2838054023 | 164 |
| 176 | iso_pu_bacteria | 2838061910 | 2838066901 | 164 |
| 177 | iso_pu_bacteria | 2838668709 | 2838674605 | 164 |
| 178 | iso_pu_bacteria | 2838694306 | 2838700956 | 164 |
| 179 | iso_pu_bacteria | 2838701080 | 2838707046 | 164 |
| 180 | iso_pu_bacteria | 2838729681 | 2838736033 | 164 |
| 181 | iso_pu_bacteria | 2838742623 | 2838748288 | 164 |
| 182 | iso_pu_bacteria | 2842077413 | 2842083697 | 164 |
| 183 | iso_pu_bacteria | 2842118031 | 2842124774 | 164 |
| 184 | iso_pu_bacteria | 2842146304 | 2842151647 | 164 |
| 185 | iso_pu_bacteria | 2842198810 | 2842203514 | 164 |
| 186 | iso_pu_bacteria | 2842205361 | 2842210978 | 164 |
| 187 | iso_pu_bacteria | 2842217011 | 2842223277 | 164 |
| 188 | iso_pu_bacteria | 2842229732 | 2842236757 | 164 |
| 189 | iso_pu_bacteria | 2842243621 | 2842249473 | 164 |
| 190 | iso_pu_bacteria | 2842250916 | 2842256835 | 164 |
| 191 | iso_pu_bacteria | 2842257432 | 2842263462 | 164 |
| 192 | iso_pu_bacteria | 2842264693 | 2842270554 | 164 |
| 193 | iso_pu_bacteria | 2842278818 | 2842284527 | 164 |
| 194 | iso_pu_bacteria | 2842285085 | 2842290648 | 164 |
| 195 | iso_pu_bacteria | 2842291075 | 2842297886 | 164 |
| 196 | iso_pu_bacteria | 2842311132 | 2842317279 | 164 |
| 197 | iso_pu_bacteria | 2842317721 | 2842323532 | 164 |
| 198 | iso_pu_bacteria | 2842341865 | 2842347993 | 164 |
| 199 | iso_pu_bacteria | 2842363717 | 2842369539 | 164 |
| 200 | iso_pu_bacteria | 2842370503 | 2842377264 | 164 |
| 201 | iso_pu_bacteria | 2842377471 | 2842384350 | 164 |
| 202 | iso_pu_bacteria | 2842384541 | 2842391369 | 164 |
| 203 | iso_pu_bacteria | 2842395702 | 2842402174 | 164 |
| 204 | iso_pu_bacteria | 2842402390 | 2842408471 | 164 |
| 205 | iso_pu_bacteria | 2842409023 | 2842414593 | 164 |
| 206 | iso_pu_bacteria | 2842415677 | 2842421829 | 164 |
| 207 | iso_pu_bacteria | 2842428310 | 2842434374 | 164 |
| 208 | iso_pu_bacteria | 2842434925 | 2842440709 | 164 |
| 209 | iso_pu_bacteria | 2842441272 | 2842447361 | 164 |
| 210 | iso_pu_bacteria | 2842447887 | 2842453775 | 164 |
| 211 | iso_pu_bacteria | 2842462802 | 2842468730 | 164 |
| 212 | iso_pu_bacteria | 2842469257 | 2842475283 | 164 |
| 213 | iso_pu_bacteria | 2842489311 | 2842495604 | 164 |
| 214 | iso_pu_bacteria | 2842495871 | 2842502256 | 164 |
| 215 | iso_pu_bacteria | 2935901341 | 2935907807 | 164 |
| 216 | iso_pu_bacteria | 2936381700 | 2936386099 | 164 |
| 217 | iso_pu_bacteria | 8001522603 | 8001523634 | 164 |
| 218 | iso_pu_bacteria | 8005275841 | 8005276777 | 164 |
| 219 | iso_pu_bacteria | 8005282627 | 8005286903 | 164 |
| 220 | iso_pu_bacteria | 8005307578 | 8005310029 | 164 |
| 221 | iso_pu_bacteria | 8005430974 | 8005435378 | 164 |
| 222 | iso_pu_bacteria | 8005619151 | 8005625111 | 164 |
| 223 | iso_pu_bacteria | 8005626139 | 8005628869 | 164 |
| 224 | iso_pu_bacteria | 8005668836 | 8005674773 | 164 |
| 225 | iso_pu_bacteria | 8005695170 | 8005699087 | 164 |
| 226 | iso_pu_bacteria | 8018176218 | 8018182126 | 164 |
| 227 | iso_pu_bacteria | 8024501048 | 8024504817 | 164 |
| 228 | iso_pu_bacteria | 8056375014 | 8056379652 | 164 |
| 229 | iso_pu_bacteria | 8056382006 | 8056385702 | 164 |
| 230 | 3300005340 | Ga0070689_100809673 | Ga0070689_1008096731 | 165 |
| 231 | 3300005536 | Ga0070697_100006665 | Ga0070697_1000066655 | 165 |
| 232 | 3300005544 | Ga0070686_100172160 | Ga0070686_1001721602 | 165 |
| 233 | 3300005545 | Ga0070695_100344913 | Ga0070695_1003449131 | 165 |
| 234 | 3300005617 | Ga0068859_100902597 | Ga0068859_1009025971 | 165 |
| 235 | 3300006173 | Ga0070716_100364728 | Ga0070716_1003647281 | 165 |
| 236 | 3300006195 | Ga0075366_10132709 | Ga0075366_101327092 | 165 |
| 237 | 3300006931 | Ga0097620_100902643 | Ga0097620_1009026431 | 165 |
| 238 | 3300009093 | Ga0105240_10417581 | Ga0105240_104175812 | 165 |
| 239 | 3300009094 | Ga0111539_10332414 | Ga0111539_103324142 | 165 |
| 240 | 3300013104 | Ga0157370_10646277 | Ga0157370_106462771 | 165 |
| 241 | 3300013306 | Ga0163162_10252643 | Ga0163162_102526432 | 165 |
| 242 | 3300014968 | Ga0157379_10141281 | Ga0157379_101412811 | 165 |
| 243 | 3300017792 | Ga0163161_10118567 | Ga0163161_101185672 | 165 |
| 244 | 3300025913 | Ga0207695_10320613 | Ga0207695_103206132 | 165 |
| 245 | 3300025939 | Ga0207665_10023132 | Ga0207665_100231321 | 165 |
| 246 | 3300028381 | Ga0268264_11157188 | Ga0268264_111571882 | 165 |
| 247 | 3300031344 | Ga0265316_10069217 | Ga0265316_100692172 | 165 |
| 248 | 3300031344 | Ga0265316_10222637 | Ga0265316_102226372 | 165 |
| 249 | 3300031727 | Ga0316576_10092149 | Ga0316576_100921492 | 165 |
| 250 | 3300033528 | Ga0316588_1021639 | Ga0316588_10216392 | 165 |
| 251 | 3300039062 | Ga0400483_199082 | Ga0400483_199082_361_870 | 165 |
| 252 | 3300039450 | Ga0436363_1688978 | Ga0436363_1688978_1240_1752 | 165 |
| 253 | 3300042876 | Ga0451577_0005076 | Ga0451577_0005076_12854_13363 | 165 |
| 254 | 3300044712 | Ga0453684_0151515 | Ga0453684_0151515_777_1286 | 165 |
| 255 | 3300046452 | Ga0495617_000351 | Ga0495617_000351_23795_24307 | 165 |
| 256 | 3300046457 | Ga0495590_0000330 | Ga0495590_0000330_18883_19389 | 165 |
| 257 | 3300046507 | Ga0495606_0001952 | Ga0495606_0001952_6820_7332 | 165 |
| 258 | 3300046507 | Ga0495606_0213863 | Ga0495606_0213863_120_626 | 165 |
| 259 | 3300047444 | Ga0495675_0454107 | Ga0495675_0454107_196_696 | 165 |
| 260 | 3300047447 | Ga0495685_143103 | Ga0495685_143103_156_656 | 165 |
| 261 | 3300048916 | Ga0496113_1016570 | Ga0496113_1016570_70_576 | 165 |
| 262 | 3300049569 | Ga0501032_0010263 | Ga0501032_0010263_414_917 | 165 |
| 263 | 3300049570 | Ga0501033_0044696 | Ga0501033_0044696_1016_1519 | 165 |
| 264 | 3300049571 | Ga0501034_0000360 | Ga0501034_0000360_28713_29216 | 165 |
| 265 | 3300049572 | Ga0501036_0052069 | Ga0501036_0052069_2359_2862 | 165 |
| 266 | 3300049573 | Ga0501037_0017106 | Ga0501037_0017106_2657_3160 | 165 |
| 267 | 3300049574 | Ga0501038_0001066 | Ga0501038_0001066_3136_3639 | 165 |
| 268 | 3300049575 | Ga0501039_0057645 | Ga0501039_0057645_686_1189 | 165 |
| 269 | 3300049579 | Ga0501043_0141259 | Ga0501043_0141259_689_1192 | 165 |
| 270 | 3300049579 | Ga0501043_0277487 | Ga0501043_0277487_377_880 | 165 |
| 271 | 3300049581 | Ga0501047_0051264 | Ga0501047_0051264_640_1143 | 165 |
| 272 | 3300049589 | Ga0501073_0086140 | Ga0501073_0086140_758_1261 | 165 |
| 273 | 3300049822 | Ga0501035_0141518 | Ga0501035_0141518_844_1347 | 165 |
| 274 | 3300049823 | Ga0501044_0751562 | Ga0501044_0751562_272_775 | 165 |
| 275 | 3300050511 | nmdc:mga08y16_659104_c1 | nmdc:mga08y16_659104_c1_97_597 | 165 |
| 276 | 3300061719 | Ga0466962_0393800 | Ga0466962_0393800_144_644 | 165 |
| 277 | iso_pu_bacteria | 2945909444 | 2945911985 | 165 |
| 278 | iso_pu_bacteria | 2945984333 | 2945986746 | 165 |
| 279 | 3300002738 | JGI25154J39366_1000539 | JGI25154J39366_10005398 | 166 |
| 280 | 3300002741 | JGI25157J39369_1000018 | JGI25157J39369_100001816 | 166 |
| 281 | 3300003316 | rootH1_10008298 | rootH1_100082983 | 166 |
| 282 | 3300003316 | rootH1_10017599 | rootH1_100175992 | 166 |
| 283 | 3300003322 | rootL2_10077243 | rootL2_1007724311 | 166 |
| 284 | 3300003752 | Ga0055539_1000437 | Ga0055539_10004377 | 166 |
| 285 | 3300003752 | Ga0055539_1001061 | Ga0055539_10010612 | 166 |
| 286 | 3300003756 | Ga0055533_1000011 | Ga0055533_100001141 | 166 |
| 287 | 3300003759 | Ga0055525_1000691 | Ga0055525_10006918 | 166 |
| 288 | 3300003761 | Ga0055535_1009861 | Ga0055535_10098612 | 166 |
| 289 | 3300004799 | Ga0058863_11714636 | Ga0058863_117146361 | 166 |
| 290 | 3300004801 | Ga0058860_12025189 | Ga0058860_120251892 | 166 |
| 291 | 3300005329 | Ga0070683_100089142 | Ga0070683_1000891423 | 166 |
| 292 | 3300005330 | Ga0070690_100001642 | Ga0070690_1000016424 | 166 |
| 293 | 3300005334 | Ga0068869_100029452 | Ga0068869_1000294523 | 166 |
| 294 | 3300005338 | Ga0068868_100350634 | Ga0068868_1003506342 | 166 |
| 295 | 3300005339 | Ga0070660_100833273 | Ga0070660_1008332731 | 166 |
| 296 | 3300005530 | Ga0070679_100417650 | Ga0070679_1004176502 | 166 |
| 297 | 3300005539 | Ga0068853_100539418 | Ga0068853_1005394181 | 166 |
| 298 | 3300005563 | Ga0068855_101105248 | Ga0068855_1011052482 | 166 |
| 299 | 3300005577 | Ga0068857_100013094 | Ga0068857_1000130947 | 166 |
| 300 | 3300005614 | Ga0068856_100003249 | Ga0068856_1000032497 | 166 |
| 301 | 3300005616 | Ga0068852_101368889 | Ga0068852_1013688892 | 166 |
| 302 | 3300005719 | Ga0068861_100011157 | Ga0068861_1000111574 | 166 |
| 303 | 3300009093 | Ga0105240_10344605 | Ga0105240_103446052 | 166 |
| 304 | 3300009174 | Ga0105241_10113847 | Ga0105241_101138472 | 166 |
| 305 | 3300009545 | Ga0105237_10025360 | Ga0105237_100253607 | 166 |
| 306 | 3300009551 | Ga0105238_10007111 | Ga0105238_100071119 | 166 |
| 307 | 3300010375 | Ga0105239_10284729 | Ga0105239_102847292 | 166 |
| 308 | 3300010375 | Ga0105239_10756639 | Ga0105239_107566392 | 166 |
| 309 | 3300011119 | Ga0105246_10017444 | Ga0105246_100174444 | 166 |
| 310 | 3300013102 | Ga0157371_10330882 | Ga0157371_103308822 | 166 |
| 311 | 3300013105 | Ga0157369_10015923 | Ga0157369_100159237 | 166 |
| 312 | 3300013105 | Ga0157369_10582141 | Ga0157369_105821412 | 166 |
| 313 | 3300013297 | Ga0157378_10029581 | Ga0157378_100295812 | 166 |
| 314 | 3300014969 | Ga0157376_11957041 | Ga0157376_119570411 | 166 |
| 315 | 3300025226 | Ga0209674_100003 | Ga0209674_100003342 | 166 |
| 316 | 3300025230 | Ga0209563_100010 | Ga0209563_10001071 | 166 |
| 317 | 3300025242 | Ga0209258_101616 | Ga0209258_1016166 | 166 |
| 318 | 3300025246 | Ga0209646_1000188 | Ga0209646_100018815 | 166 |
| 319 | 3300025250 | Ga0209026_1000033 | Ga0209026_1000033279 | 166 |
| 320 | 3300025253 | Ga0209677_100068 | Ga0209677_10006851 | 166 |
| 321 | 3300025253 | Ga0209677_100159 | Ga0209677_10015949 | 166 |
| 322 | 3300025256 | Ga0209759_1000024 | Ga0209759_1000024279 | 166 |
| 323 | 3300025272 | Ga0209455_1039536 | Ga0209455_10395361 | 166 |
| 324 | 3300025911 | Ga0207654_10061360 | Ga0207654_100613603 | 166 |
| 325 | 3300025913 | Ga0207695_10009048 | Ga0207695_1000904810 | 166 |
| 326 | 3300025914 | Ga0207671_10033198 | Ga0207671_100331984 | 166 |
| 327 | 3300025919 | Ga0207657_10050442 | Ga0207657_100504424 | 166 |
| 328 | 3300025920 | Ga0207649_10449572 | Ga0207649_104495721 | 166 |
| 329 | 3300025921 | Ga0207652_10299642 | Ga0207652_102996422 | 166 |
| 330 | 3300025924 | Ga0207694_10441111 | Ga0207694_104411112 | 166 |
| 331 | 3300025942 | Ga0207689_10014798 | Ga0207689_100147987 | 166 |
| 332 | 3300026023 | Ga0207677_10464250 | Ga0207677_104642501 | 166 |
| 333 | 3300026078 | Ga0207702_10000553 | Ga0207702_100005535 | 166 |
| 334 | 3300026116 | Ga0207674_10004589 | Ga0207674_100045897 | 166 |
| 335 | 3300026118 | Ga0207675_100042747 | Ga0207675_1000427472 | 166 |
| 336 | 3300026142 | Ga0207698_10054912 | Ga0207698_100549121 | 166 |
| 337 | 3300032004 | Ga0307414_10098255 | Ga0307414_100982552 | 166 |
| 338 | 3300033524 | Ga0316592_1042423 | Ga0316592_10424232 | 166 |
| 339 | 3300035086 | Ga0373934_0002760 | Ga0373934_0002760_4670_5179 | 166 |
| 340 | 3300039447 | Ga0436361_0740948 | Ga0436361_0740948_2423_2935 | 166 |
| 341 | 3300039453 | Ga0436362_0999886 | Ga0436362_0999886_143_682 | 166 |
| 342 | 3300044712 | Ga0453684_0000625 | Ga0453684_0000625_27390_27926 | 166 |
| 343 | 3300045976 | Ga0466967_1128638 | Ga0466967_1128638_181_693 | 166 |
| 344 | 3300047471 | Ga0495684_0171327 | Ga0495684_0171327_1015_1527 | 166 |
| 345 | 3300047472 | Ga0495686_0026685 | Ga0495686_0026685_3031_3540 | 166 |
| 346 | 3300048904 | Ga0496101_0364762 | Ga0496101_0364762_334_843 | 166 |
| 347 | 3300048927 | Ga0496124_0020783 | Ga0496124_0020783_2604_3128 | 166 |
| 348 | 3300059506 | Ga0587085_024346 | Ga0587085_024346_299_808 | 166 |
| 349 | 3300059647 | Ga0587079_094509 | Ga0587079_094509_78_602 | 166 |
| 350 | 3300059651 | Ga0587105_014637 | Ga0587105_014637_44_568 | 166 |
| 351 | 3300003305 | Ga0006770J48903_1073083 | Ga0006770J48903_10730831 | 167 |
| 352 | 3300003781 | Ga0055536_1001503 | Ga0055536_10015036 | 167 |
| 353 | 3300003792 | Ga0055540_1005504 | Ga0055540_10055045 | 167 |
| 354 | 3300005290 | Ga0065712_10443677 | Ga0065712_104436771 | 167 |
| 355 | 3300005327 | Ga0070658_10690559 | Ga0070658_106905592 | 167 |
| 356 | 3300005337 | Ga0070682_100808671 | Ga0070682_1008086712 | 167 |
| 357 | 3300005338 | Ga0068868_100094804 | Ga0068868_1000948042 | 167 |
| 358 | 3300005340 | Ga0070689_100001730 | Ga0070689_1000017302 | 167 |
| 359 | 3300005365 | Ga0070688_100297510 | Ga0070688_1002975102 | 167 |
| 360 | 3300005366 | Ga0070659_101053508 | Ga0070659_1010535081 | 167 |
| 361 | 3300005367 | Ga0070667_100087043 | Ga0070667_1000870433 | 167 |
| 362 | 3300005456 | Ga0070678_100312544 | Ga0070678_1003125442 | 167 |
| 363 | 3300005459 | Ga0068867_100478716 | Ga0068867_1004787162 | 167 |
| 364 | 3300005548 | Ga0070665_100114464 | Ga0070665_1001144641 | 167 |
| 365 | 3300005548 | Ga0070665_100190780 | Ga0070665_1001907802 | 167 |
| 366 | 3300005563 | Ga0068855_100002070 | Ga0068855_10000207015 | 167 |
| 367 | 3300005614 | Ga0068856_101435215 | Ga0068856_1014352152 | 167 |
| 368 | 3300005615 | Ga0070702_100070087 | Ga0070702_1000700872 | 167 |
| 369 | 3300005842 | Ga0068858_100042506 | Ga0068858_1000425064 | 167 |
| 370 | 3300006237 | Ga0097621_100119281 | Ga0097621_1001192812 | 167 |
| 371 | 3300006880 | Ga0075429_100021139 | Ga0075429_1000211396 | 167 |
| 372 | 3300006881 | Ga0068865_100692750 | Ga0068865_1006927502 | 167 |
| 373 | 3300009093 | Ga0105240_10138124 | Ga0105240_101381242 | 167 |
| 374 | 3300009094 | Ga0111539_11075457 | Ga0111539_110754571 | 167 |
| 375 | 3300009098 | Ga0105245_10039092 | Ga0105245_100390924 | 167 |
| 376 | 3300009148 | Ga0105243_10002392 | Ga0105243_100023922 | 167 |
| 377 | 3300009177 | Ga0105248_10045882 | Ga0105248_100458825 | 167 |
| 378 | 3300010375 | Ga0105239_10538941 | Ga0105239_105389412 | 167 |
| 379 | 3300013296 | Ga0157374_10114702 | Ga0157374_101147023 | 167 |
| 380 | 3300013306 | Ga0163162_10001320 | Ga0163162_1000132015 | 167 |
| 381 | 3300013308 | Ga0157375_10013045 | Ga0157375_100130458 | 167 |
| 382 | 3300021388 | Ga0213875_10062661 | Ga0213875_100626612 | 167 |
| 383 | 3300025292 | Ga0209676_1000361 | Ga0209676_100036156 | 167 |
| 384 | 3300025303 | Ga0209051_1000184 | Ga0209051_100018478 | 167 |
| 385 | 3300025304 | Ga0209257_1014244 | Ga0209257_10142442 | 167 |
| 386 | 3300025910 | Ga0207684_11056103 | Ga0207684_110561031 | 167 |
| 387 | 3300025913 | Ga0207695_10096782 | Ga0207695_100967822 | 167 |
| 388 | 3300025935 | Ga0207709_10001520 | Ga0207709_1000152017 | 167 |
| 389 | 3300025936 | Ga0207670_10001268 | Ga0207670_100012682 | 167 |
| 390 | 3300025938 | Ga0207704_10693974 | Ga0207704_106939741 | 167 |
| 391 | 3300025941 | Ga0207711_10055594 | Ga0207711_100555942 | 167 |
| 392 | 3300025949 | Ga0207667_10053462 | Ga0207667_100534624 | 167 |
| 393 | 3300025986 | Ga0207658_10135093 | Ga0207658_101350932 | 167 |
| 394 | 3300026078 | Ga0207702_10748049 | Ga0207702_107480492 | 167 |
| 395 | 3300026121 | Ga0207683_10297604 | Ga0207683_102976042 | 167 |
| 396 | 3300028379 | Ga0268266_10514215 | Ga0268266_105142152 | 167 |
| 397 | 3300028379 | Ga0268266_10774798 | Ga0268266_107747982 | 167 |
| 398 | 3300031251 | Ga0265327_10007638 | Ga0265327_100076387 | 167 |
| 399 | 3300031691 | Ga0316579_10013986 | Ga0316579_100139862 | 167 |
| 400 | 3300031691 | Ga0316579_10041831 | Ga0316579_100418312 | 167 |
| 401 | 3300031727 | Ga0316576_10009927 | Ga0316576_100099276 | 167 |
| 402 | 3300031727 | Ga0316576_10170496 | Ga0316576_101704962 | 167 |
| 403 | 3300031727 | Ga0316576_10170499 | Ga0316576_101704992 | 167 |
| 404 | 3300031728 | Ga0316578_10179341 | Ga0316578_101793412 | 167 |
| 405 | 3300031728 | Ga0316578_10301757 | Ga0316578_103017571 | 167 |
| 406 | 3300031733 | Ga0316577_10041335 | Ga0316577_100413352 | 167 |
| 407 | 3300031733 | Ga0316577_10051452 | Ga0316577_100514523 | 167 |
| 408 | 3300032133 | Ga0316583_10033426 | Ga0316583_100334262 | 167 |
| 409 | 3300032133 | Ga0316583_10173901 | Ga0316583_101739011 | 167 |
| 410 | 3300032137 | Ga0316585_10005378 | Ga0316585_100053784 | 167 |
| 411 | 3300032139 | Ga0316580_10001491 | Ga0316580_100014915 | 167 |
| 412 | 3300032168 | Ga0316593_10000488 | Ga0316593_100004886 | 167 |
| 413 | 3300032168 | Ga0316593_10020556 | Ga0316593_100205562 | 167 |
| 414 | 3300033524 | Ga0316592_1003160 | Ga0316592_10031602 | 167 |
| 415 | 3300033524 | Ga0316592_1085722 | Ga0316592_10857221 | 167 |
| 416 | 3300033527 | Ga0316586_1002585 | Ga0316586_10025852 | 167 |
| 417 | 3300033527 | Ga0316586_1029737 | Ga0316586_10297372 | 167 |
| 418 | 3300033529 | Ga0316587_1001414 | Ga0316587_10014144 | 167 |
| 419 | 3300035398 | Ga0316574_0007153 | Ga0316574_0007153_3006_3542 | 167 |
| 420 | 3300035398 | Ga0316574_0016600 | Ga0316574_0016600_587_1129 | 167 |
| 421 | 3300036712 | Ga0316584_0416826 | Ga0316584_0416826_289_831 | 167 |
| 422 | 3300037466 | Ga0395898_0433956 | Ga0395898_0433956_278_805 | 167 |
| 423 | 3300037588 | Ga0316581_0121049 | Ga0316581_0121049_201_743 | 167 |
| 424 | 3300037588 | Ga0316581_0165608 | Ga0316581_0165608_41_577 | 167 |
| 425 | 3300037853 | Ga0436364_1085191 | Ga0436364_1085191_1350_1871 | 167 |
| 426 | 3300038443 | Ga0395901_0020370 | Ga0395901_0020370_5653_6180 | 167 |
| 427 | 3300038735 | Ga0400485_05534 | Ga0400485_05534_791_1324 | 167 |
| 428 | 3300039093 | Ga0400489_37544 | Ga0400489_37544_1865_2398 | 167 |
| 429 | 3300039110 | Ga0400487_10280 | Ga0400487_10280_87470_88003 | 167 |
| 430 | 3300039110 | Ga0400487_17580 | Ga0400487_17580_4049_4582 | 167 |
| 431 | 3300039110 | Ga0400487_41326 | Ga0400487_41326_435_968 | 167 |
| 432 | 3300041413 | Ga0439465_0197813 | Ga0439465_0197813_68_619 | 167 |
| 433 | 3300041496 | Ga0451839_0778740 | Ga0451839_0778740_45_557 | 167 |
| 434 | 3300042876 | Ga0451577_0000645 | Ga0451577_0000645_44882_45391 | 167 |
| 435 | 3300044712 | Ga0453684_0005496 | Ga0453684_0005496_8443_8952 | 167 |
| 436 | 3300044712 | Ga0453684_2081223 | Ga0453684_2081223_23_544 | 167 |
| 437 | 3300045051 | Ga0451576_0369423 | Ga0451576_0369423_953_1468 | 167 |
| 438 | 3300045976 | Ga0466967_0640524 | Ga0466967_0640524_460_990 | 167 |
| 439 | 3300046460 | Ga0495638_0017837 | Ga0495638_0017837_3010_3516 | 167 |
| 440 | 3300046471 | Ga0495650_0049242 | Ga0495650_0049242_769_1275 | 167 |
| 441 | 3300046474 | Ga0495605_0002234 | Ga0495605_0002234_1091_1597 | 167 |
| 442 | 3300046501 | Ga0495607_0176321 | Ga0495607_0176321_271_777 | 167 |
| 443 | 3300046507 | Ga0495606_0081511 | Ga0495606_0081511_358_864 | 167 |
| 444 | 3300046524 | Ga0495648_0056432 | Ga0495648_0056432_928_1434 | 167 |
| 445 | 3300046528 | Ga0495642_0145131 | Ga0495642_0145131_282_788 | 167 |
| 446 | 3300046648 | Ga0495611_0038153 | Ga0495611_0038153_523_1029 | 167 |
| 447 | 3300046660 | Ga0495625_0111134 | Ga0495625_0111134_1022_1528 | 167 |
| 448 | 3300046663 | Ga0495635_0099457 | Ga0495635_0099457_300_818 | 167 |
| 449 | 3300046684 | Ga0495669_0018905 | Ga0495669_0018905_1340_1846 | 167 |
| 450 | 3300046691 | Ga0495670_0040760 | Ga0495670_0040760_483_989 | 167 |
| 451 | 3300046794 | Ga0495589_0040157 | Ga0495589_0040157_652_1158 | 167 |
| 452 | 3300046810 | Ga0495660_0140598 | Ga0495660_0140598_685_1191 | 167 |
| 453 | 3300047319 | Ga0495674_0279321 | Ga0495674_0279321_457_1023 | 167 |
| 454 | 3300047323 | Ga0495683_0234612 | Ga0495683_0234612_104_610 | 167 |
| 455 | 3300047446 | Ga0495679_047506 | Ga0495679_047506_581_1087 | 167 |
| 456 | 3300048903 | Ga0496100_0065607 | Ga0496100_0065607_603_1109 | 167 |
| 457 | 3300048904 | Ga0496101_0165589 | Ga0496101_0165589_1031_1537 | 167 |
| 458 | 3300048905 | Ga0496102_0005459 | Ga0496102_0005459_856_1362 | 167 |
| 459 | 3300048906 | Ga0496103_0601470 | Ga0496103_0601470_155_661 | 167 |
| 460 | 3300048907 | Ga0496104_0261089 | Ga0496104_0261089_66_572 | 167 |
| 461 | 3300048908 | Ga0496105_0449582 | Ga0496105_0449582_276_782 | 167 |
| 462 | 3300048909 | Ga0496106_0181996 | Ga0496106_0181996_1145_1651 | 167 |
| 463 | 3300048910 | Ga0496107_0093129 | Ga0496107_0093129_992_1498 | 167 |
| 464 | 3300048921 | Ga0496118_0059872 | Ga0496118_0059872_1064_1570 | 167 |
| 465 | 3300049161 | Ga0501305_045353 | Ga0501305_045353_190_699 | 167 |
| 466 | 3300053085 | Ga0495619_0225062 | Ga0495619_0225062_125_697 | 167 |
| 467 | 3300059504 | Ga0587082_109187 | Ga0587082_109187_73_591 | 167 |
| 468 | 3300001977 | JGI24746J21847_1020172 | JGI24746J21847_10201722 | 168 |
| 469 | 3300001989 | JGI24739J22299_10056948 | JGI24739J22299_100569482 | 168 |
| 470 | 3300002987 | JGI25159J45721_1008197 | JGI25159J45721_10081973 | 168 |
| 471 | 3300003187 | JGI25151J46595_10000340 | JGI25151J46595_1000034017 | 168 |
| 472 | 3300003215 | JGI25153J46596_10022598 | JGI25153J46596_100225982 | 168 |
| 473 | 3300003354 | JGI25160J50197_1000767 | JGI25160J50197_10007677 | 168 |
| 474 | 3300004801 | Ga0058860_11994122 | Ga0058860_119941222 | 168 |
| 475 | 3300005289 | Ga0065704_10121329 | Ga0065704_101213292 | 168 |
| 476 | 3300005290 | Ga0065712_10007612 | Ga0065712_100076122 | 168 |
| 477 | 3300005293 | Ga0065715_10011248 | Ga0065715_100112483 | 168 |
| 478 | 3300005293 | Ga0065715_10107974 | Ga0065715_101079742 | 168 |
| 479 | 3300005295 | Ga0065707_10174252 | Ga0065707_101742522 | 168 |
| 480 | 3300005329 | Ga0070683_100000387 | Ga0070683_10000038716 | 168 |
| 481 | 3300005331 | Ga0070670_100032038 | Ga0070670_1000320383 | 168 |
| 482 | 3300005331 | Ga0070670_100491359 | Ga0070670_1004913591 | 168 |
| 483 | 3300005331 | Ga0070670_100806480 | Ga0070670_1008064802 | 168 |
| 484 | 3300005335 | Ga0070666_10142274 | Ga0070666_101422742 | 168 |
| 485 | 3300005340 | Ga0070689_100391515 | Ga0070689_1003915152 | 168 |
| 486 | 3300005344 | Ga0070661_100142807 | Ga0070661_1001428072 | 168 |
| 487 | 3300005353 | Ga0070669_100000810 | Ga0070669_1000008109 | 168 |
| 488 | 3300005354 | Ga0070675_100018854 | Ga0070675_1000188542 | 168 |
| 489 | 3300005354 | Ga0070675_100519511 | Ga0070675_1005195112 | 168 |
| 490 | 3300005354 | Ga0070675_100544653 | Ga0070675_1005446531 | 168 |
| 491 | 3300005355 | Ga0070671_100032811 | Ga0070671_1000328114 | 168 |
| 492 | 3300005355 | Ga0070671_100837463 | Ga0070671_1008374631 | 168 |
| 493 | 3300005355 | Ga0070671_101040503 | Ga0070671_1010405031 | 168 |
| 494 | 3300005366 | Ga0070659_100445203 | Ga0070659_1004452032 | 168 |
| 495 | 3300005439 | Ga0070711_101221980 | Ga0070711_1012219801 | 168 |
| 496 | 3300005445 | Ga0070708_100829694 | Ga0070708_1008296941 | 168 |
| 497 | 3300005455 | Ga0070663_100022964 | Ga0070663_1000229644 | 168 |
| 498 | 3300005457 | Ga0070662_100126089 | Ga0070662_1001260892 | 168 |
| 499 | 3300005468 | Ga0070707_100191004 | Ga0070707_1001910042 | 168 |
| 500 | 3300005471 | Ga0070698_100515477 | Ga0070698_1005154771 | 168 |
| 501 | 3300005518 | Ga0070699_100037802 | Ga0070699_1000378022 | 168 |
| 502 | 3300005535 | Ga0070684_100000221 | Ga0070684_1000002219 | 168 |
| 503 | 3300005543 | Ga0070672_100219876 | Ga0070672_1002198762 | 168 |
| 504 | 3300005543 | Ga0070672_100300810 | Ga0070672_1003008102 | 168 |
| 505 | 3300005544 | Ga0070686_100314922 | Ga0070686_1003149222 | 168 |
| 506 | 3300005564 | Ga0070664_100001047 | Ga0070664_10000104711 | 168 |
| 507 | 3300005564 | Ga0070664_100211037 | Ga0070664_1002110372 | 168 |
| 508 | 3300005577 | Ga0068857_100012736 | Ga0068857_1000127364 | 168 |
| 509 | 3300005614 | Ga0068856_100321156 | Ga0068856_1003211562 | 168 |
| 510 | 3300005615 | Ga0070702_100135005 | Ga0070702_1001350052 | 168 |
| 511 | 3300005618 | Ga0068864_100210475 | Ga0068864_1002104752 | 168 |
| 512 | 3300005834 | Ga0068851_10127117 | Ga0068851_101271171 | 168 |
| 513 | 3300005842 | Ga0068858_100228354 | Ga0068858_1002283542 | 168 |
| 514 | 3300005844 | Ga0068862_100238646 | Ga0068862_1002386462 | 168 |
| 515 | 3300005937 | Ga0081455_10499960 | Ga0081455_104999602 | 168 |
| 516 | 3300005983 | Ga0081540_1046343 | Ga0081540_10463432 | 168 |
| 517 | 3300006051 | Ga0075364_10001642 | Ga0075364_100016428 | 168 |
| 518 | 3300006175 | Ga0070712_100268044 | Ga0070712_1002680442 | 168 |
| 519 | 3300006358 | Ga0068871_100580109 | Ga0068871_1005801092 | 168 |
| 520 | 3300006844 | Ga0075428_100020972 | Ga0075428_1000209728 | 168 |
| 521 | 3300006844 | Ga0075428_100124334 | Ga0075428_1001243341 | 168 |
| 522 | 3300006844 | Ga0075428_100299789 | Ga0075428_1002997892 | 168 |
| 523 | 3300006846 | Ga0075430_100000716 | Ga0075430_1000007164 | 168 |
| 524 | 3300006847 | Ga0075431_100020300 | Ga0075431_1000203005 | 168 |
| 525 | 3300006847 | Ga0075431_100290211 | Ga0075431_1002902112 | 168 |
| 526 | 3300006852 | Ga0075433_10052359 | Ga0075433_100523593 | 168 |
| 527 | 3300006871 | Ga0075434_100108516 | Ga0075434_1001085162 | 168 |
| 528 | 3300006871 | Ga0075434_101061046 | Ga0075434_1010610462 | 168 |
| 529 | 3300006880 | Ga0075429_100005556 | Ga0075429_1000055568 | 168 |
| 530 | 3300006880 | Ga0075429_100475425 | Ga0075429_1004754252 | 168 |
| 531 | 3300009092 | Ga0105250_10055792 | Ga0105250_100557922 | 168 |
| 532 | 3300009094 | Ga0111539_10007570 | Ga0111539_100075704 | 168 |
| 533 | 3300009147 | Ga0114129_10015179 | Ga0114129_100151792 | 168 |
| 534 | 3300009147 | Ga0114129_10246155 | Ga0114129_102461552 | 168 |
| 535 | 3300009148 | Ga0105243_10884629 | Ga0105243_108846292 | 168 |
| 536 | 3300009177 | Ga0105248_10726498 | Ga0105248_107264982 | 168 |
| 537 | 3300009545 | Ga0105237_11038102 | Ga0105237_110381022 | 168 |
| 538 | 3300009553 | Ga0105249_10002713 | Ga0105249_1000271310 | 168 |
| 539 | 3300009765 | Ga0123341_1006170 | Ga0123341_10061708 | 168 |
| 540 | 3300009766 | Ga0123342_1018906 | Ga0123342_10189062 | 168 |
| 541 | 3300009766 | Ga0123342_1027741 | Ga0123342_10277412 | 168 |
| 542 | 3300010375 | Ga0105239_11338040 | Ga0105239_113380402 | 168 |
| 543 | 3300013296 | Ga0157374_10036487 | Ga0157374_100364874 | 168 |
| 544 | 3300013297 | Ga0157378_11296510 | Ga0157378_112965101 | 168 |
| 545 | 3300013308 | Ga0157375_10984314 | Ga0157375_109843142 | 168 |
| 546 | 3300013308 | Ga0157375_11198331 | Ga0157375_111983312 | 168 |
| 547 | 3300014325 | Ga0163163_10073601 | Ga0163163_100736012 | 168 |
| 548 | 3300014497 | Ga0182008_10011812 | Ga0182008_100118122 | 168 |
| 549 | 3300014497 | Ga0182008_10074079 | Ga0182008_100740791 | 168 |
| 550 | 3300014745 | Ga0157377_10778261 | Ga0157377_107782612 | 168 |
| 551 | 3300014969 | Ga0157376_10234776 | Ga0157376_102347763 | 168 |
| 552 | 3300017792 | Ga0163161_10000161 | Ga0163161_1000016160 | 168 |
| 553 | 3300021361 | Ga0213872_10013913 | Ga0213872_100139131 | 168 |
| 554 | 3300021361 | Ga0213872_10035024 | Ga0213872_100350243 | 168 |
| 555 | 3300021377 | Ga0213874_10177113 | Ga0213874_101771131 | 168 |
| 556 | 3300021377 | Ga0213874_10202220 | Ga0213874_102022201 | 168 |
| 557 | 3300021384 | Ga0213876_10008738 | Ga0213876_100087384 | 168 |
| 558 | 3300021384 | Ga0213876_10032007 | Ga0213876_100320072 | 168 |
| 559 | 3300021441 | Ga0213871_10030033 | Ga0213871_100300332 | 168 |
| 560 | 3300023672 | Ga0247553_100425 | Ga0247553_1004251 | 168 |
| 561 | 3300025271 | Ga0207666_1005952 | Ga0207666_10059522 | 168 |
| 562 | 3300025284 | Ga0209130_1000252 | Ga0209130_100025257 | 168 |
| 563 | 3300025294 | Ga0209025_1000633 | Ga0209025_100063323 | 168 |
| 564 | 3300025297 | Ga0209758_1002743 | Ga0209758_10027438 | 168 |
| 565 | 3300025302 | Ga0207426_1000098 | Ga0207426_1000098124 | 168 |
| 566 | 3300025321 | Ga0207656_10080509 | Ga0207656_100805092 | 168 |
| 567 | 3300025735 | Ga0207713_1000191 | Ga0207713_100019126 | 168 |
| 568 | 3300025901 | Ga0207688_10126059 | Ga0207688_101260592 | 168 |
| 569 | 3300025903 | Ga0207680_10114877 | Ga0207680_101148772 | 168 |
| 570 | 3300025908 | Ga0207643_10125518 | Ga0207643_101255182 | 168 |
| 571 | 3300025915 | Ga0207693_10257805 | Ga0207693_102578052 | 168 |
| 572 | 3300025915 | Ga0207693_10274949 | Ga0207693_102749493 | 168 |
| 573 | 3300025916 | Ga0207663_10924975 | Ga0207663_109249751 | 168 |
| 574 | 3300025922 | Ga0207646_10157502 | Ga0207646_101575022 | 168 |
| 575 | 3300025922 | Ga0207646_10192556 | Ga0207646_101925562 | 168 |
| 576 | 3300025923 | Ga0207681_10003328 | Ga0207681_100033284 | 168 |
| 577 | 3300025925 | Ga0207650_10021599 | Ga0207650_100215995 | 168 |
| 578 | 3300025925 | Ga0207650_10202213 | Ga0207650_102022132 | 168 |
| 579 | 3300025926 | Ga0207659_10014095 | Ga0207659_100140954 | 168 |
| 580 | 3300025926 | Ga0207659_10200081 | Ga0207659_102000811 | 168 |
| 581 | 3300025931 | Ga0207644_10024515 | Ga0207644_100245152 | 168 |
| 582 | 3300025931 | Ga0207644_10758387 | Ga0207644_107583872 | 168 |
| 583 | 3300025932 | Ga0207690_10519281 | Ga0207690_105192812 | 168 |
| 584 | 3300025933 | Ga0207706_10446359 | Ga0207706_104463592 | 168 |
| 585 | 3300025935 | Ga0207709_10224695 | Ga0207709_102246953 | 168 |
| 586 | 3300025936 | Ga0207670_10364038 | Ga0207670_103640382 | 168 |
| 587 | 3300025939 | Ga0207665_10129343 | Ga0207665_101293432 | 168 |
| 588 | 3300025940 | Ga0207691_10155232 | Ga0207691_101552322 | 168 |
| 589 | 3300025940 | Ga0207691_10176513 | Ga0207691_101765133 | 168 |
| 590 | 3300025941 | Ga0207711_10024965 | Ga0207711_100249655 | 168 |
| 591 | 3300025944 | Ga0207661_10001828 | Ga0207661_100018282 | 168 |
| 592 | 3300025944 | Ga0207661_10759338 | Ga0207661_107593381 | 168 |
| 593 | 3300025945 | Ga0207679_10000614 | Ga0207679_1000061411 | 168 |
| 594 | 3300025961 | Ga0207712_10021071 | Ga0207712_100210713 | 168 |
| 595 | 3300025986 | Ga0207658_11528736 | Ga0207658_115287361 | 168 |
| 596 | 3300026035 | Ga0207703_10194438 | Ga0207703_101944382 | 168 |
| 597 | 3300026075 | Ga0207708_10335657 | Ga0207708_103356572 | 168 |
| 598 | 3300026116 | Ga0207674_10018697 | Ga0207674_100186975 | 168 |
| 599 | 3300027907 | Ga0207428_10074873 | Ga0207428_100748733 | 168 |
| 600 | 3300028380 | Ga0268265_10097078 | Ga0268265_100970782 | 168 |
| 601 | 3300028381 | Ga0268264_10529128 | Ga0268264_105291282 | 168 |
| 602 | 3300028800 | Ga0265338_10223600 | Ga0265338_102236002 | 168 |
| 603 | 3300030963 | Ga0265768_100242 | Ga0265768_1002422 | 168 |
| 604 | 3300031344 | Ga0265316_10043108 | Ga0265316_100431082 | 168 |
| 605 | 3300031911 | Ga0307412_10016003 | Ga0307412_100160033 | 168 |
| 606 | 3300033524 | Ga0316592_1001006 | Ga0316592_10010065 | 168 |
| 607 | 3300033524 | Ga0316592_1002951 | Ga0316592_10029512 | 168 |
| 608 | 3300033524 | Ga0316592_1046781 | Ga0316592_10467812 | 168 |
| 609 | 3300033528 | Ga0316588_1018969 | Ga0316588_10189692 | 168 |
| 610 | 3300033541 | Ga0316596_1029621 | Ga0316596_10296211 | 168 |
| 611 | 3300037418 | Ga0395900_0237124 | Ga0395900_0237124_338_865 | 168 |
| 612 | 3300037853 | Ga0436364_0037831 | Ga0436364_0037831_2937_3458 | 168 |
| 613 | 3300038443 | Ga0395901_0818530 | Ga0395901_0818530_51_578 | 168 |
| 614 | 3300039437 | Ga0436365_0647074 | Ga0436365_0647074_76_597 | 168 |
| 615 | 3300039437 | Ga0436365_1112230 | Ga0436365_1112230_15784_16308 | 168 |
| 616 | 3300039437 | Ga0436365_1625636 | Ga0436365_1625636_2000_2521 | 168 |
| 617 | 3300039438 | Ga0436360_0122311 | Ga0436360_0122311_5545_6069 | 168 |
| 618 | 3300039438 | Ga0436360_0619086 | Ga0436360_0619086_236_760 | 168 |
| 619 | 3300039438 | Ga0436360_0735944 | Ga0436360_0735944_3446_3988 | 168 |
| 620 | 3300039438 | Ga0436360_0885445 | Ga0436360_0885445_611_1141 | 168 |
| 621 | 3300039438 | Ga0436360_1317915 | Ga0436360_1317915_437_961 | 168 |
| 622 | 3300039447 | Ga0436361_0013250 | Ga0436361_0013250_1850_2374 | 168 |
| 623 | 3300039447 | Ga0436361_0193310 | Ga0436361_0193310_971_1495 | 168 |
| 624 | 3300039447 | Ga0436361_0294503 | Ga0436361_0294503_1808_2332 | 168 |
| 625 | 3300039447 | Ga0436361_0298641 | Ga0436361_0298641_945_1469 | 168 |
| 626 | 3300039447 | Ga0436361_0528059 | Ga0436361_0528059_24_548 | 168 |
| 627 | 3300039450 | Ga0436363_0479409 | Ga0436363_0479409_45_569 | 168 |
| 628 | 3300039450 | Ga0436363_1298424 | Ga0436363_1298424_133_672 | 168 |
| 629 | 3300039453 | Ga0436362_0579570 | Ga0436362_0579570_20_544 | 168 |
| 630 | 3300039453 | Ga0436362_0829410 | Ga0436362_0829410_489_1013 | 168 |
| 631 | 3300039453 | Ga0436362_1117703 | Ga0436362_1117703_713_1255 | 168 |
| 632 | 3300041404 | Ga0439436_0003170 | Ga0439436_0003170_4130_4684 | 168 |
| 633 | 3300041406 | Ga0439439_0015255 | Ga0439439_0015255_102_656 | 168 |
| 634 | 3300041413 | Ga0439465_0007042 | Ga0439465_0007042_2099_2653 | 168 |
| 635 | 3300041997 | Ga0439431_0008305 | Ga0439431_0008305_180_746 | 168 |
| 636 | 3300042007 | Ga0439449_0001163 | Ga0439449_0001163_9743_10297 | 168 |
| 637 | 3300042014 | Ga0439457_009092 | Ga0439457_009092_127_681 | 168 |
| 638 | 3300042015 | Ga0439462_0006135 | Ga0439462_0006135_53_607 | 168 |
| 639 | 3300045051 | Ga0451576_0504970 | Ga0451576_0504970_49_564 | 168 |
| 640 | 3300045976 | Ga0466967_0671875 | Ga0466967_0671875_455_979 | 168 |
| 641 | 3300046506 | Ga0495583_0301096 | Ga0495583_0301096_36_590 | 168 |
| 642 | 3300046512 | Ga0495610_0043936 | Ga0495610_0043936_1158_1712 | 168 |
| 643 | 3300046512 | Ga0495610_0071082 | Ga0495610_0071082_405_971 | 168 |
| 644 | 3300046559 | Ga0495667_0344900 | Ga0495667_0344900_38_550 | 168 |
| 645 | 3300046689 | Ga0495613_0172168 | Ga0495613_0172168_411_932 | 168 |
| 646 | 3300047318 | Ga0495636_0337480 | Ga0495636_0337480_70_588 | 168 |
| 647 | 3300047469 | Ga0495673_0063322 | Ga0495673_0063322_252_806 | 168 |
| 648 | 3300048091 | Ga0495626_0253806 | Ga0495626_0253806_53_619 | 168 |
| 649 | 3300048907 | Ga0496104_0001980 | Ga0496104_0001980_11781_12290 | 168 |
| 650 | 3300048908 | Ga0496105_0127690 | Ga0496105_0127690_877_1386 | 168 |
| 651 | 3300048911 | Ga0496108_0008532 | Ga0496108_0008532_979_1488 | 168 |
| 652 | 3300048911 | Ga0496108_0927943 | Ga0496108_0927943_172_702 | 168 |
| 653 | 3300048912 | Ga0496109_0004929 | Ga0496109_0004929_1139_1648 | 168 |
| 654 | 3300048913 | Ga0496110_0000797 | Ga0496110_0000797_12098_12607 | 168 |
| 655 | 3300048914 | Ga0496111_0001605 | Ga0496111_0001605_11528_12037 | 168 |
| 656 | 3300048915 | Ga0496112_0002405 | Ga0496112_0002405_13491_14000 | 168 |
| 657 | 3300048916 | Ga0496113_0065318 | Ga0496113_0065318_645_1154 | 168 |
| 658 | 3300048917 | Ga0496114_0432381 | Ga0496114_0432381_634_1143 | 168 |
| 659 | 3300048926 | Ga0496123_0001262 | Ga0496123_0001262_12601_13131 | 168 |
| 660 | 3300048927 | Ga0496124_0067980 | Ga0496124_0067980_1714_2247 | 168 |
| 661 | 3300049576 | Ga0501040_0240972 | Ga0501040_0240972_421_930 | 168 |
| 662 | 3300049577 | Ga0501041_0337238 | Ga0501041_0337238_198_707 | 168 |
| 663 | 3300049586 | Ga0501070_0256868 | Ga0501070_0256868_683_1192 | 168 |
| 664 | 3300049587 | Ga0501071_0043370 | Ga0501071_0043370_202_711 | 168 |
| 665 | 3300049588 | Ga0501072_0187412 | Ga0501072_0187412_112_621 | 168 |
| 666 | 3300049589 | Ga0501073_0642243 | Ga0501073_0642243_77_586 | 168 |
| 667 | 3300049591 | Ga0501075_0146537 | Ga0501075_0146537_1270_1779 | 168 |
| 668 | 3300049592 | Ga0501076_0126635 | Ga0501076_0126635_1318_1827 | 168 |
| 669 | 3300049593 | Ga0501077_0301729 | Ga0501077_0301729_310_819 | 168 |
| 670 | 3300049741 | Ga0501079_0020772 | Ga0501079_0020772_1357_1866 | 168 |
| 671 | 3300049742 | Ga0501080_0050121 | Ga0501080_0050121_3308_3817 | 168 |
| 672 | 3300049742 | Ga0501080_0419990 | Ga0501080_0419990_445_960 | 168 |
| 673 | 3300049743 | Ga0501081_0577002 | Ga0501081_0577002_257_766 | 168 |
| 674 | 3300049824 | Ga0501045_0079226 | Ga0501045_0079226_615_1124 | 168 |
| 675 | 3300050491 | nmdc:mga00v17_573_c1 | nmdc:mga00v17_573_c1_17564_18151 | 168 |
| 676 | 3300050507 | nmdc:mga05p37_767580_c1 | nmdc:mga05p37_767580_c1_493_1002 | 168 |
| 677 | 3300050507 | nmdc:mga05p37_84853_c1 | nmdc:mga05p37_84853_c1_17_544 | 168 |
| 678 | 3300050508 | nmdc:mga09592_123224_c1 | nmdc:mga09592_123224_c1_1387_1893 | 168 |
| 679 | 3300050508 | nmdc:mga09592_454_c1 | nmdc:mga09592_454_c1_6746_7273 | 168 |
| 680 | 3300050509 | nmdc:mga0qj67_3504_c1 | nmdc:mga0qj67_3504_c1_2543_3070 | 168 |
| 681 | 3300050510 | nmdc:mga06r32_1074283_c1 | nmdc:mga06r32_1074283_c1_129_656 | 168 |
| 682 | 3300050510 | nmdc:mga06r32_4114_c1 | nmdc:mga06r32_4114_c1_6962_7489 | 168 |
| 683 | 3300050511 | nmdc:mga08y16_132674_c1 | nmdc:mga08y16_132674_c1_1332_1841 | 168 |
| 684 | 3300050511 | nmdc:mga08y16_6519_c1 | nmdc:mga08y16_6519_c1_7712_8218 | 168 |
| 685 | 3300050512 | nmdc:mga0n895_419834_c1 | nmdc:mga0n895_419834_c1_747_1256 | 168 |
| 686 | 3300050512 | nmdc:mga0n895_555639_c1 | nmdc:mga0n895_555639_c1_625_1134 | 168 |
| 687 | 3300050513 | nmdc:mga0rr50_321004_c1 | nmdc:mga0rr50_321004_c1_349_858 | 168 |
| 688 | 3300050515 | nmdc:mga0a205_81623_c1 | nmdc:mga0a205_81623_c1_89_598 | 168 |
| 689 | 3300053139 | Ga0500568_0075403 | Ga0500568_0075403_349_903 | 168 |
| 690 | 3300054114 | Ga0501084_0074109 | Ga0501084_0074109_1154_1663 | 168 |
| 691 | 3300060353 | Ga0501082_0108180 | Ga0501082_0108180_1554_2063 | 168 |
| 692 | 3300061734 | Ga0530510_0173840 | Ga0530510_0173840_274_783 | 168 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar