F474962
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 683 | 353 | 657 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100033763|Ga0068853_1000337633 |
| Length | 345 |
| Sequence | VRVVRGVSAPGFTGGTLDRADPLRSDVEKLAAAMADPRARLLRLVRLEPELGEDDRLIWDSLAAAPEGGELVLLGLDAEGVPHFAAANPEEAIVTGRAFTIFRILERLHPEDAAHFAAARSVVDWHMRHRFCAVCGARTEPFRAGWGRKCHNCSAEHFPRVDPVVIMLAEFGDKVLLGRGPGWPPGRYSALAGFLEPGESLEEAVARETFEEAGVRVRDVRYIASQPWPFPSSLMIAAIGVADDDTLVIDTNELEDAIWVTRDEVRAVMAGEPGPFLPPPPYAIAFTLLNAWAEESEDRLDAWYDGSAVCVIAAGRQGDPLDLGEHEVAAFVAKLQGALGEAERG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 4 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 5 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 6 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 7 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 8 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 9 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 10 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 11 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 12 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 13 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 14 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 15 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 16 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 17 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 18 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 19 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 20 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 21 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 22 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 23 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 24 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 25 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 26 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 27 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 28 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 29 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 30 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 31 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 32 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 33 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 34 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 35 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 36 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 37 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 38 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 39 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 40 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 43 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 47 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 48 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 55 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 58 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 76 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 83 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 84 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 85 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 96 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 101 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 119 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 200 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 203 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 204 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 222 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 223 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 224 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 228 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 229 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 230 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 231 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 232 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 233 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 234 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 235 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 242 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 303 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 304 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 305 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 306 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 307 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 311 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 312 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 314 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 317 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 320 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 321 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 322 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 323 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 325 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 326 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 327 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 333 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 334 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 335 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 337 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 338 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 339 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 342 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 345 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 347 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 348 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 349 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 350 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 351 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 352 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 353 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.05 |
| Metatranscriptomes | 0.15 |
| Isolates | 3.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.73 |
| Bulb | 0 |
| Endosphere | 12.74 |
| Nodule | 0 |
| Rhizoplane | 8.35 |
| Rhizosphere | 70.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1799459 | 2162886007 | Bacteria | 6890 |
| 2 | JGI24736J21556_1000531 | 3300001904 | Bacteria | 7114 |
| 3 | JGI24741J21665_1000370 | 3300001915 | Bacteria | 13453 |
| 4 | JGI24752J21851_1000438 | 3300001976 | Bacteria | 5633 |
| 5 | JGI24752J21851_1000853 | 3300001976 | Bacteria | 4135 |
| 6 | JGI24740J21852_10001695 | 3300001979 | Bacteria | 10106 |
| 7 | JGI24739J22299_10000305 | 3300001989 | Bacteria | 16682 |
| 8 | JGI24737J22298_10000985 | 3300001990 | Bacteria | 10121 |
| 9 | JGI24737J22298_10001644 | 3300001990 | Bacteria | 7972 |
| 10 | JGI24735J21928_10000521 | 3300002067 | Bacteria | 13578 |
| 11 | JGI24738J21930_10002288 | 3300002075 | Bacteria | 5065 |
| 12 | JGI25150J39212_1000130 | 3300002774 | Bacteria | 42580 |
| 13 | JGI25151J46595_10053766 | 3300003187 | Bacteria | 1342 |
| 14 | JGI25153J46596_10000032 | 3300003215 | Bacteria | 196732 |
| 15 | JGI25153J46596_10016824 | 3300003215 | Bacteria | 2910 |
| 16 | Ga0055526_1013391 | 3300003771 | Bacteria | 3475 |
| 17 | Ga0055537_1001101 | 3300003773 | Bacteria | 11722 |
| 18 | Ga0055524_1000670 | 3300003775 | Bacteria | 24010 |
| 19 | Ga0055536_1010462 | 3300003781 | Bacteria | 3676 |
| 20 | Ga0055530_10001355 | 3300003791 | Bacteria | 18155 |
| 21 | Ga0055540_1002776 | 3300003792 | Bacteria | 8966 |
| 22 | Ga0055531_10000718 | 3300003794 | Bacteria | 28238 |
| 23 | Ga0055531_10020966 | 3300003794 | Bacteria | 2558 |
| 24 | Ga0065165_1002607 | 3300005262 | Bacteria | 14750 |
| 25 | Ga0065165_1006173 | 3300005262 | Bacteria | 6396 |
| 26 | Ga0065165_1010897 | 3300005262 | Bacteria | 3867 |
| 27 | Ga0065704_10000204 | 3300005289 | Bacteria | 211587 |
| 28 | Ga0065704_10000694 | 3300005289 | Bacteria | 17008 |
| 29 | Ga0065704_10002707 | 3300005289 | Bacteria | 5842 |
| 30 | Ga0065704_10025368 | 3300005289 | Bacteria | 1506 |
| 31 | Ga0065707_10251029 | 3300005295 | Bacteria | 1125 |
| 32 | Ga0070658_10027993 | 3300005327 | Bacteria | 4524 |
| 33 | Ga0070658_10145696 | 3300005327 | Bacteria | 1980 |
| 34 | Ga0070676_10050584 | 3300005328 | Bacteria | 2437 |
| 35 | Ga0070676_10114900 | 3300005328 | Bacteria | 1681 |
| 36 | Ga0070683_100003182 | 3300005329 | Bacteria | 13246 |
| 37 | Ga0070683_100337479 | 3300005329 | Bacteria | 1435 |
| 38 | Ga0070683_100435822 | 3300005329 | Bacteria | 1250 |
| 39 | Ga0070690_100042531 | 3300005330 | Bacteria | 2878 |
| 40 | Ga0070690_100082592 | 3300005330 | Bacteria | 2104 |
| 41 | Ga0070670_100000068 | 3300005331 | Bacteria | 106494 |
| 42 | Ga0070670_100012592 | 3300005331 | Bacteria | 7242 |
| 43 | Ga0070670_100026108 | 3300005331 | Bacteria | 5028 |
| 44 | Ga0070670_100058982 | 3300005331 | Bacteria | 3295 |
| 45 | Ga0070670_100166003 | 3300005331 | Bacteria | 1914 |
| 46 | Ga0068869_100091377 | 3300005334 | Bacteria | 2290 |
| 47 | Ga0070666_10017078 | 3300005335 | Bacteria | 4649 |
| 48 | Ga0070666_10018375 | 3300005335 | Bacteria | 4494 |
| 49 | Ga0070666_10034605 | 3300005335 | Bacteria | 3348 |
| 50 | Ga0070666_10093344 | 3300005335 | Bacteria | 2069 |
| 51 | Ga0070682_100060602 | 3300005337 | Bacteria | 2393 |
| 52 | Ga0068868_100224567 | 3300005338 | Bacteria | 1573 |
| 53 | Ga0068868_100241644 | 3300005338 | Bacteria | 1517 |
| 54 | Ga0070660_100415499 | 3300005339 | Bacteria | 1113 |
| 55 | Ga0070689_100213177 | 3300005340 | Bacteria | 1581 |
| 56 | Ga0070661_100004105 | 3300005344 | Bacteria | 10039 |
| 57 | Ga0070661_100108963 | 3300005344 | Bacteria | 2067 |
| 58 | Ga0070692_10014178 | 3300005345 | Bacteria | 3734 |
| 59 | Ga0070668_100000132 | 3300005347 | Bacteria | 46719 |
| 60 | Ga0070668_100006800 | 3300005347 | Bacteria | 8480 |
| 61 | Ga0070668_100019204 | 3300005347 | Bacteria | 5142 |
| 62 | Ga0070668_100029286 | 3300005347 | Bacteria | 4181 |
| 63 | Ga0070668_100045423 | 3300005347 | Bacteria | 3370 |
| 64 | Ga0070669_100000024 | 3300005353 | Bacteria | 173107 |
| 65 | Ga0070669_100173795 | 3300005353 | Bacteria | 1681 |
| 66 | Ga0070669_100245611 | 3300005353 | Bacteria | 1423 |
| 67 | Ga0070675_100215934 | 3300005354 | Bacteria | 1669 |
| 68 | Ga0070671_100000006 | 3300005355 | Bacteria | 250635 |
| 69 | Ga0070671_100001115 | 3300005355 | Bacteria | 19917 |
| 70 | Ga0070671_100002834 | 3300005355 | Bacteria | 13466 |
| 71 | Ga0070671_100075569 | 3300005355 | Bacteria | 2814 |
| 72 | Ga0070671_100266665 | 3300005355 | Bacteria | 1455 |
| 73 | Ga0070673_100055087 | 3300005364 | Bacteria | 3132 |
| 74 | Ga0070659_100006160 | 3300005366 | Bacteria | 8658 |
| 75 | Ga0070667_100000003 | 3300005367 | Bacteria | 447715 |
| 76 | Ga0070667_100001642 | 3300005367 | Bacteria | 19990 |
| 77 | Ga0070667_100003291 | 3300005367 | Bacteria | 13805 |
| 78 | Ga0070709_10007175 | 3300005434 | Bacteria | 6103 |
| 79 | Ga0070701_10036058 | 3300005438 | Bacteria | 2489 |
| 80 | Ga0070705_100263003 | 3300005440 | Bacteria | 1218 |
| 81 | Ga0070708_100095776 | 3300005445 | Bacteria | 2710 |
| 82 | Ga0070663_100001832 | 3300005455 | Bacteria | 11841 |
| 83 | Ga0070663_100320368 | 3300005455 | Bacteria | 1246 |
| 84 | Ga0068867_100086669 | 3300005459 | Bacteria | 2369 |
| 85 | Ga0070679_100216191 | 3300005530 | Bacteria | 1879 |
| 86 | Ga0070684_100240461 | 3300005535 | Bacteria | 1654 |
| 87 | Ga0068853_100033763 | 3300005539 | Bacteria | 4340 |
| 88 | Ga0070695_100334289 | 3300005545 | Bacteria | 1130 |
| 89 | Ga0070665_100000043 | 3300005548 | Bacteria | 279774 |
| 90 | Ga0070665_100011783 | 3300005548 | Bacteria | 8831 |
| 91 | Ga0070665_100106578 | 3300005548 | Bacteria | 2805 |
| 92 | Ga0070665_100385597 | 3300005548 | Bacteria | 1409 |
| 93 | Ga0068855_100252785 | 3300005563 | Bacteria | 1965 |
| 94 | Ga0070664_100010420 | 3300005564 | Bacteria | 7537 |
| 95 | Ga0070664_100027700 | 3300005564 | Bacteria | 4710 |
| 96 | Ga0068857_100209967 | 3300005577 | Bacteria | 1776 |
| 97 | Ga0068854_100151319 | 3300005578 | Bacteria | 1790 |
| 98 | Ga0068854_100334814 | 3300005578 | Bacteria | 1234 |
| 99 | Ga0068856_100110616 | 3300005614 | Bacteria | 2744 |
| 100 | Ga0070702_100071142 | 3300005615 | Bacteria | 2055 |
| 101 | Ga0068852_100218800 | 3300005616 | Bacteria | 1810 |
| 102 | Ga0068852_100408889 | 3300005616 | Bacteria | 1336 |
| 103 | Ga0068852_100656051 | 3300005616 | Bacteria | 1057 |
| 104 | Ga0068859_100003041 | 3300005617 | Bacteria | 17013 |
| 105 | Ga0068859_100100298 | 3300005617 | Bacteria | 2951 |
| 106 | Ga0068859_100126893 | 3300005617 | Bacteria | 2621 |
| 107 | Ga0068859_100356477 | 3300005617 | Bacteria | 1557 |
| 108 | Ga0068864_100000019 | 3300005618 | Bacteria | 271650 |
| 109 | Ga0068864_100004226 | 3300005618 | Bacteria | 11819 |
| 110 | Ga0068864_100016069 | 3300005618 | Bacteria | 6228 |
| 111 | Ga0068864_100095921 | 3300005618 | Bacteria | 2624 |
| 112 | Ga0068864_100178539 | 3300005618 | Bacteria | 1940 |
| 113 | Ga0068864_100199022 | 3300005618 | Bacteria | 1839 |
| 114 | Ga0068866_10025330 | 3300005718 | Bacteria | 2787 |
| 115 | Ga0068861_100036893 | 3300005719 | Bacteria | 3631 |
| 116 | Ga0068861_100084181 | 3300005719 | Bacteria | 2497 |
| 117 | Ga0068863_100000015 | 3300005841 | Bacteria | 214824 |
| 118 | Ga0068863_100019866 | 3300005841 | Bacteria | 6426 |
| 119 | Ga0068863_100072483 | 3300005841 | Bacteria | 3258 |
| 120 | Ga0068858_100000093 | 3300005842 | Bacteria | 93236 |
| 121 | Ga0068858_100000278 | 3300005842 | Bacteria | 55142 |
| 122 | Ga0068858_100007175 | 3300005842 | Bacteria | 10809 |
| 123 | Ga0068858_100201589 | 3300005842 | Bacteria | 1882 |
| 124 | Ga0068860_100000045 | 3300005843 | Bacteria | 223252 |
| 125 | Ga0068860_100053602 | 3300005843 | Bacteria | 3835 |
| 126 | Ga0068860_100149110 | 3300005843 | Bacteria | 2251 |
| 127 | Ga0068862_100000094 | 3300005844 | Bacteria | 106159 |
| 128 | Ga0068862_100000307 | 3300005844 | Bacteria | 53788 |
| 129 | Ga0068862_100001480 | 3300005844 | Bacteria | 21523 |
| 130 | Ga0068862_100074743 | 3300005844 | Bacteria | 2930 |
| 131 | Ga0081539_10092149 | 3300005985 | Bacteria | 1563 |
| 132 | Ga0075368_10005408 | 3300006042 | Bacteria | 4389 |
| 133 | Ga0075363_100025008 | 3300006048 | Bacteria | 3041 |
| 134 | Ga0075364_10019953 | 3300006051 | Bacteria | 4212 |
| 135 | Ga0070712_100094949 | 3300006175 | Bacteria | 2193 |
| 136 | Ga0070712_100129457 | 3300006175 | Bacteria | 1911 |
| 137 | Ga0075367_10000211 | 3300006178 | Bacteria | 19490 |
| 138 | Ga0075366_10008576 | 3300006195 | Bacteria | 5689 |
| 139 | Ga0097621_100109675 | 3300006237 | Bacteria | 2331 |
| 140 | Ga0097621_100199589 | 3300006237 | Bacteria | 1736 |
| 141 | Ga0075370_10026573 | 3300006353 | Bacteria | 3207 |
| 142 | Ga0075370_10173966 | 3300006353 | Bacteria | 1266 |
| 143 | Ga0097620_100003041 | 3300006931 | Bacteria | 17013 |
| 144 | Ga0097620_100100297 | 3300006931 | Bacteria | 2951 |
| 145 | Ga0097620_100126886 | 3300006931 | Bacteria | 2621 |
| 146 | Ga0097620_100309546 | 3300006931 | Bacteria | 1673 |
| 147 | Ga0097620_100356499 | 3300006931 | Bacteria | 1557 |
| 148 | Ga0105251_10001041 | 3300009011 | Bacteria | 24304 |
| 149 | Ga0105251_10066438 | 3300009011 | Bacteria | 1686 |
| 150 | Ga0105240_10192390 | 3300009093 | Bacteria | 2398 |
| 151 | Ga0111539_10223200 | 3300009094 | Bacteria | 2195 |
| 152 | Ga0105245_10008819 | 3300009098 | Bacteria | 8798 |
| 153 | Ga0105245_10048863 | 3300009098 | Bacteria | 3786 |
| 154 | Ga0105245_10106792 | 3300009098 | Bacteria | 2598 |
| 155 | Ga0105247_10002315 | 3300009101 | Bacteria | 13011 |
| 156 | Ga0105247_10003045 | 3300009101 | Bacteria | 11097 |
| 157 | Ga0105247_10013580 | 3300009101 | Bacteria | 4884 |
| 158 | Ga0114129_10366816 | 3300009147 | Bacteria | 1904 |
| 159 | Ga0105243_10070358 | 3300009148 | Bacteria | 2825 |
| 160 | Ga0105243_10078071 | 3300009148 | Bacteria | 2695 |
| 161 | Ga0105243_10420804 | 3300009148 | Bacteria | 1246 |
| 162 | Ga0105241_10003279 | 3300009174 | Bacteria | 12044 |
| 163 | Ga0105242_10075507 | 3300009176 | Bacteria | 2807 |
| 164 | Ga0105242_10238274 | 3300009176 | Bacteria | 1634 |
| 165 | Ga0105248_10000311 | 3300009177 | Bacteria | 57870 |
| 166 | Ga0105248_10062566 | 3300009177 | Bacteria | 4178 |
| 167 | Ga0105237_10019458 | 3300009545 | Bacteria | 7011 |
| 168 | Ga0105237_10137121 | 3300009545 | Bacteria | 2441 |
| 169 | Ga0105238_10031920 | 3300009551 | Bacteria | 5359 |
| 170 | Ga0105238_10055572 | 3300009551 | Bacteria | 3973 |
| 171 | Ga0105238_10184869 | 3300009551 | Bacteria | 2060 |
| 172 | Ga0105238_10224721 | 3300009551 | Bacteria | 1854 |
| 173 | Ga0105249_10001265 | 3300009553 | Bacteria | 22155 |
| 174 | Ga0105249_10004653 | 3300009553 | Bacteria | 11849 |
| 175 | Ga0105249_10018500 | 3300009553 | Bacteria | 6201 |
| 176 | Ga0105249_10028001 | 3300009553 | Bacteria | 5086 |
| 177 | Ga0105249_10315560 | 3300009553 | Bacteria | 1573 |
| 178 | Ga0105148_100172 | 3300009978 | Bacteria | 9528 |
| 179 | Ga0105147_102132 | 3300009982 | Bacteria | 1629 |
| 180 | Ga0105246_10117781 | 3300011119 | Bacteria | 1963 |
| 181 | Ga0105246_10289865 | 3300011119 | Bacteria | 1316 |
| 182 | Ga0105246_10412612 | 3300011119 | Bacteria | 1124 |
| 183 | Ga0157369_10292626 | 3300013105 | Bacteria | 1695 |
| 184 | Ga0157378_10073368 | 3300013297 | Bacteria | 3077 |
| 185 | Ga0157378_10477150 | 3300013297 | Bacteria | 1242 |
| 186 | Ga0157378_10634727 | 3300013297 | Bacteria | 1082 |
| 187 | Ga0163162_10030528 | 3300013306 | Bacteria | 5340 |
| 188 | Ga0157372_10444925 | 3300013307 | Bacteria | 1510 |
| 189 | Ga0157375_10052146 | 3300013308 | Bacteria | 4020 |
| 190 | Ga0163163_10007130 | 3300014325 | Bacteria | 9828 |
| 191 | Ga0163163_10016104 | 3300014325 | Bacteria | 6936 |
| 192 | Ga0163163_10138005 | 3300014325 | Bacteria | 2480 |
| 193 | Ga0157380_10031783 | 3300014326 | Bacteria | 4055 |
| 194 | Ga0157379_10424013 | 3300014968 | Bacteria | 1225 |
| 195 | Ga0157379_10450214 | 3300014968 | Bacteria | 1188 |
| 196 | Ga0157379_10479202 | 3300014968 | Bacteria | 1151 |
| 197 | Ga0206356_10366199 | 3300020070 | Bacteria | 1332 |
| 198 | Ga0209147_103284 | 3300025229 | Bacteria | 3243 |
| 199 | Ga0207425_1000025 | 3300025245 | Bacteria | 321872 |
| 200 | Ga0207425_1005597 | 3300025245 | Bacteria | 3556 |
| 201 | Ga0209129_1000887 | 3300025258 | Bacteria | 18393 |
| 202 | Ga0209233_1000140 | 3300025261 | Bacteria | 193274 |
| 203 | Ga0209565_1000029 | 3300025263 | Bacteria | 340335 |
| 204 | Ga0209565_1000220 | 3300025263 | Bacteria | 64333 |
| 205 | Ga0209455_1013632 | 3300025272 | Bacteria | 1877 |
| 206 | Ga0209673_1000889 | 3300025273 | Bacteria | 38489 |
| 207 | Ga0209673_1013952 | 3300025273 | Bacteria | 3138 |
| 208 | Ga0209675_1016052 | 3300025291 | Bacteria | 2197 |
| 209 | Ga0209676_1005827 | 3300025292 | Bacteria | 6300 |
| 210 | Ga0209025_1000176 | 3300025294 | Bacteria | 158186 |
| 211 | Ga0209564_1002011 | 3300025295 | Bacteria | 17752 |
| 212 | Ga0209564_1023265 | 3300025295 | Bacteria | 2160 |
| 213 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 214 | Ga0209758_1000108 | 3300025297 | Bacteria | 216541 |
| 215 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 216 | Ga0209050_1000131 | 3300025298 | Bacteria | 186028 |
| 217 | Ga0209050_1003561 | 3300025298 | Bacteria | 11337 |
| 218 | Ga0209050_1014376 | 3300025298 | Bacteria | 3414 |
| 219 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 220 | Ga0209051_1000405 | 3300025303 | Bacteria | 59735 |
| 221 | Ga0209257_1000028 | 3300025304 | Bacteria | 699493 |
| 222 | Ga0209257_1003282 | 3300025304 | Bacteria | 14110 |
| 223 | Ga0207697_10000244 | 3300025315 | Bacteria | 29795 |
| 224 | Ga0207696_1001087 | 3300025711 | Bacteria | 16011 |
| 225 | Ga0207713_1013836 | 3300025735 | Bacteria | 4225 |
| 226 | Ga0207713_1051017 | 3300025735 | Bacteria | 1647 |
| 227 | Ga0207710_10013220 | 3300025900 | Bacteria | 3478 |
| 228 | Ga0207710_10021848 | 3300025900 | Bacteria | 2745 |
| 229 | Ga0207710_10045602 | 3300025900 | Bacteria | 1955 |
| 230 | Ga0207688_10020660 | 3300025901 | Bacteria | 3595 |
| 231 | Ga0207680_10003253 | 3300025903 | Bacteria | 7649 |
| 232 | Ga0207680_10006266 | 3300025903 | Bacteria | 5741 |
| 233 | Ga0207680_10018640 | 3300025903 | Bacteria | 3694 |
| 234 | Ga0207680_10136131 | 3300025903 | Bacteria | 1624 |
| 235 | Ga0207647_10004140 | 3300025904 | Bacteria | 10765 |
| 236 | Ga0207647_10020983 | 3300025904 | Bacteria | 4369 |
| 237 | Ga0207705_10041001 | 3300025909 | Bacteria | 3321 |
| 238 | Ga0207654_10051500 | 3300025911 | Bacteria | 2370 |
| 239 | Ga0207695_10029867 | 3300025913 | Bacteria | 6014 |
| 240 | Ga0207693_10046192 | 3300025915 | Bacteria | 3421 |
| 241 | Ga0207693_10137441 | 3300025915 | Bacteria | 1922 |
| 242 | Ga0207662_10015394 | 3300025918 | Bacteria | 4304 |
| 243 | Ga0207657_10066783 | 3300025919 | Bacteria | 3060 |
| 244 | Ga0207657_10100871 | 3300025919 | Bacteria | 2396 |
| 245 | Ga0207657_10161010 | 3300025919 | Bacteria | 1823 |
| 246 | Ga0207649_10006343 | 3300025920 | Bacteria | 6429 |
| 247 | Ga0207649_10193273 | 3300025920 | Bacteria | 1433 |
| 248 | Ga0207681_10000004 | 3300025923 | Bacteria | 559005 |
| 249 | Ga0207681_10046875 | 3300025923 | Bacteria | 2908 |
| 250 | Ga0207681_10159756 | 3300025923 | Bacteria | 1697 |
| 251 | Ga0207681_10170243 | 3300025923 | Bacteria | 1650 |
| 252 | Ga0207681_10196795 | 3300025923 | Bacteria | 1545 |
| 253 | Ga0207694_10018242 | 3300025924 | Bacteria | 5303 |
| 254 | Ga0207694_10066645 | 3300025924 | Bacteria | 2809 |
| 255 | Ga0207650_10000054 | 3300025925 | Bacteria | 162602 |
| 256 | Ga0207650_10002697 | 3300025925 | Bacteria | 12265 |
| 257 | Ga0207650_10007038 | 3300025925 | Bacteria | 7672 |
| 258 | Ga0207687_10023037 | 3300025927 | Bacteria | 4148 |
| 259 | Ga0207687_10024261 | 3300025927 | Bacteria | 4049 |
| 260 | Ga0207687_10051938 | 3300025927 | Bacteria | 2859 |
| 261 | Ga0207644_10000009 | 3300025931 | Bacteria | 251643 |
| 262 | Ga0207644_10000142 | 3300025931 | Bacteria | 51611 |
| 263 | Ga0207644_10000294 | 3300025931 | Bacteria | 32960 |
| 264 | Ga0207644_10004595 | 3300025931 | Bacteria | 8978 |
| 265 | Ga0207644_10205848 | 3300025931 | Bacteria | 1554 |
| 266 | Ga0207690_10004171 | 3300025932 | Bacteria | 8536 |
| 267 | Ga0207706_10004203 | 3300025933 | Bacteria | 13558 |
| 268 | Ga0207706_10016282 | 3300025933 | Bacteria | 6716 |
| 269 | Ga0207706_10161644 | 3300025933 | Bacteria | 1968 |
| 270 | Ga0207686_10284629 | 3300025934 | Bacteria | 1222 |
| 271 | Ga0207709_10058780 | 3300025935 | Bacteria | 2391 |
| 272 | Ga0207709_10163664 | 3300025935 | Bacteria | 1554 |
| 273 | Ga0207709_10214487 | 3300025935 | Bacteria | 1384 |
| 274 | Ga0207691_10003665 | 3300025940 | Bacteria | 14903 |
| 275 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 276 | Ga0207711_10249496 | 3300025941 | Bacteria | 1629 |
| 277 | Ga0207711_10487689 | 3300025941 | Bacteria | 1148 |
| 278 | Ga0207689_10044334 | 3300025942 | Bacteria | 3677 |
| 279 | Ga0207661_10004832 | 3300025944 | Bacteria | 9441 |
| 280 | Ga0207661_10125695 | 3300025944 | Bacteria | 2190 |
| 281 | Ga0207679_10006239 | 3300025945 | Bacteria | 7523 |
| 282 | Ga0207679_10137052 | 3300025945 | Bacteria | 1972 |
| 283 | Ga0207667_10401687 | 3300025949 | Bacteria | 1395 |
| 284 | Ga0207651_10408398 | 3300025960 | Bacteria | 1156 |
| 285 | Ga0207712_10000113 | 3300025961 | Bacteria | 88030 |
| 286 | Ga0207712_10009154 | 3300025961 | Bacteria | 6267 |
| 287 | Ga0207712_10101081 | 3300025961 | Bacteria | 2144 |
| 288 | Ga0207712_10142670 | 3300025961 | Bacteria | 1840 |
| 289 | Ga0207712_10338067 | 3300025961 | Bacteria | 1248 |
| 290 | Ga0207668_10000030 | 3300025972 | Bacteria | 122797 |
| 291 | Ga0207668_10007606 | 3300025972 | Bacteria | 6449 |
| 292 | Ga0207668_10045105 | 3300025972 | Bacteria | 3004 |
| 293 | Ga0207668_10052652 | 3300025972 | Bacteria | 2817 |
| 294 | Ga0207668_10176804 | 3300025972 | Bacteria | 1680 |
| 295 | Ga0207640_10023212 | 3300025981 | Bacteria | 3725 |
| 296 | Ga0207640_10143017 | 3300025981 | Bacteria | 1746 |
| 297 | Ga0207640_10157678 | 3300025981 | Bacteria | 1675 |
| 298 | Ga0207640_10254786 | 3300025981 | Bacteria | 1364 |
| 299 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 300 | Ga0207658_10000223 | 3300025986 | Bacteria | 59510 |
| 301 | Ga0207658_10002362 | 3300025986 | Bacteria | 13864 |
| 302 | Ga0207658_10058638 | 3300025986 | Bacteria | 2865 |
| 303 | Ga0207677_10073828 | 3300026023 | Bacteria | 2417 |
| 304 | Ga0207677_10451856 | 3300026023 | Bacteria | 1101 |
| 305 | Ga0207703_10000587 | 3300026035 | Bacteria | 37079 |
| 306 | Ga0207703_10000784 | 3300026035 | Bacteria | 31249 |
| 307 | Ga0207703_10013558 | 3300026035 | Bacteria | 6349 |
| 308 | Ga0207703_10315470 | 3300026035 | Bacteria | 1430 |
| 309 | Ga0207639_10008050 | 3300026041 | Bacteria | 7206 |
| 310 | Ga0207678_10004677 | 3300026067 | Bacteria | 12295 |
| 311 | Ga0207678_10109423 | 3300026067 | Bacteria | 2357 |
| 312 | Ga0207702_10007166 | 3300026078 | Bacteria | 9544 |
| 313 | Ga0207702_10020933 | 3300026078 | Bacteria | 5413 |
| 314 | Ga0207702_10179298 | 3300026078 | Bacteria | 1950 |
| 315 | Ga0207641_10000008 | 3300026088 | Bacteria | 424415 |
| 316 | Ga0207641_10000199 | 3300026088 | Bacteria | 81050 |
| 317 | Ga0207641_10004015 | 3300026088 | Bacteria | 12840 |
| 318 | Ga0207641_10011086 | 3300026088 | Bacteria | 7393 |
| 319 | Ga0207648_10041746 | 3300026089 | Bacteria | 4029 |
| 320 | Ga0207676_10000019 | 3300026095 | Bacteria | 305653 |
| 321 | Ga0207676_10001170 | 3300026095 | Bacteria | 19720 |
| 322 | Ga0207676_10001996 | 3300026095 | Bacteria | 14859 |
| 323 | Ga0207676_10154638 | 3300026095 | Bacteria | 1979 |
| 324 | Ga0207676_10271014 | 3300026095 | Bacteria | 1537 |
| 325 | Ga0207674_10010279 | 3300026116 | Bacteria | 10620 |
| 326 | Ga0207674_10385163 | 3300026116 | Bacteria | 1356 |
| 327 | Ga0207675_100000199 | 3300026118 | Bacteria | 55487 |
| 328 | Ga0207675_100044123 | 3300026118 | Bacteria | 4165 |
| 329 | Ga0207675_100049053 | 3300026118 | Bacteria | 3941 |
| 330 | Ga0207675_100300961 | 3300026118 | Bacteria | 1562 |
| 331 | Ga0207683_10000682 | 3300026121 | Bacteria | 31182 |
| 332 | Ga0207698_10048304 | 3300026142 | Bacteria | 3230 |
| 333 | Ga0207698_10093158 | 3300026142 | Bacteria | 2472 |
| 334 | Ga0207698_10419826 | 3300026142 | Bacteria | 1283 |
| 335 | Ga0209813_10000033 | 3300027866 | Bacteria | 61945 |
| 336 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 337 | Ga0268266_10015858 | 3300028379 | Bacteria | 6449 |
| 338 | Ga0268266_10038079 | 3300028379 | Bacteria | 4095 |
| 339 | Ga0268266_10078423 | 3300028379 | Bacteria | 2874 |
| 340 | Ga0268266_10090953 | 3300028379 | Bacteria | 2675 |
| 341 | Ga0268265_10000011 | 3300028380 | Bacteria | 343832 |
| 342 | Ga0268265_10000109 | 3300028380 | Bacteria | 104063 |
| 343 | Ga0268265_10006925 | 3300028380 | Bacteria | 7668 |
| 344 | Ga0268264_10000069 | 3300028381 | Bacteria | 270492 |
| 345 | Ga0268264_10000101 | 3300028381 | Bacteria | 225109 |
| 346 | Ga0268264_10016417 | 3300028381 | Bacteria | 6061 |
| 347 | Ga0268264_10216521 | 3300028381 | Bacteria | 1761 |
| 348 | Ga0307517_10007999 | 3300028786 | Bacteria | 15254 |
| 349 | Ga0265338_10071540 | 3300028800 | Bacteria | 2966 |
| 350 | Ga0265324_10002449 | 3300029957 | Bacteria | 9464 |
| 351 | Ga0265328_10015231 | 3300031239 | Bacteria | 3016 |
| 352 | Ga0265331_10000170 | 3300031250 | Bacteria | 80298 |
| 353 | Ga0265331_10018640 | 3300031250 | Bacteria | 3594 |
| 354 | Ga0265327_10086868 | 3300031251 | Bacteria | 1533 |
| 355 | Ga0307513_10075477 | 3300031456 | Bacteria | 3500 |
| 356 | Ga0307513_10161421 | 3300031456 | Bacteria | 2133 |
| 357 | Ga0307408_100028851 | 3300031548 | Bacteria | 3838 |
| 358 | Ga0307408_100151228 | 3300031548 | Bacteria | 1832 |
| 359 | Ga0307408_100223808 | 3300031548 | Bacteria | 1537 |
| 360 | Ga0307508_10005943 | 3300031616 | Bacteria | 11515 |
| 361 | Ga0307405_10186124 | 3300031731 | Bacteria | 1495 |
| 362 | Ga0307413_10070759 | 3300031824 | Bacteria | 2195 |
| 363 | Ga0307410_10106345 | 3300031852 | Bacteria | 2022 |
| 364 | Ga0307406_10022655 | 3300031901 | Bacteria | 3729 |
| 365 | Ga0307407_10365861 | 3300031903 | Bacteria | 1025 |
| 366 | Ga0307412_10012191 | 3300031911 | Bacteria | 4999 |
| 367 | Ga0307412_10029017 | 3300031911 | Bacteria | 3468 |
| 368 | Ga0307412_10031646 | 3300031911 | Bacteria | 3343 |
| 369 | Ga0307416_100026279 | 3300032002 | Bacteria | 4287 |
| 370 | Ga0307416_100063636 | 3300032002 | Bacteria | 3022 |
| 371 | Ga0307416_100112519 | 3300032002 | Bacteria | 2402 |
| 372 | Ga0307416_100230210 | 3300032002 | Bacteria | 1786 |
| 373 | Ga0307414_10006195 | 3300032004 | Bacteria | 6650 |
| 374 | Ga0307414_10030685 | 3300032004 | Bacteria | 3515 |
| 375 | Ga0307414_10050750 | 3300032004 | Bacteria | 2875 |
| 376 | Ga0307414_10128864 | 3300032004 | Bacteria | 1960 |
| 377 | Ga0307414_10514055 | 3300032004 | Bacteria | 1062 |
| 378 | Ga0307411_10108272 | 3300032005 | Bacteria | 1982 |
| 379 | Ga0307415_100296324 | 3300032126 | Bacteria | 1338 |
| 380 | Ga0395899_0033974 | 3300037312 | Bacteria | 3829 |
| 381 | Ga0395899_0052958 | 3300037312 | Bacteria | 3006 |
| 382 | Ga0395899_0063383 | 3300037312 | Bacteria | 2719 |
| 383 | Ga0395899_0137013 | 3300037312 | Bacteria | 1744 |
| 384 | Ga0395900_0010748 | 3300037418 | Bacteria | 9363 |
| 385 | Ga0395900_0021596 | 3300037418 | Bacteria | 6581 |
| 386 | Ga0395900_0029328 | 3300037418 | Bacteria | 5644 |
| 387 | Ga0395900_0119526 | 3300037418 | Bacteria | 2704 |
| 388 | Ga0395900_0239106 | 3300037418 | Bacteria | 1822 |
| 389 | Ga0395898_0068362 | 3300037466 | Bacteria | 3437 |
| 390 | Ga0395898_0262259 | 3300037466 | Bacteria | 1648 |
| 391 | Ga0395898_0320133 | 3300037466 | Bacteria | 1479 |
| 392 | Ga0395898_0521796 | 3300037466 | Bacteria | 1129 |
| 393 | Ga0395905_0000743 | 3300037471 | Bacteria | 42932 |
| 394 | Ga0395905_0002628 | 3300037471 | Bacteria | 19724 |
| 395 | Ga0395905_0465062 | 3300037471 | Bacteria | 1163 |
| 396 | Ga0395905_0470581 | 3300037471 | Archaea | 1155 |
| 397 | Ga0395901_0020705 | 3300038443 | Bacteria | 6733 |
| 398 | Ga0395901_0074493 | 3300038443 | Bacteria | 3541 |
| 399 | Ga0395901_0091912 | 3300038443 | Bacteria | 3176 |
| 400 | Ga0436365_1166901 | 3300039437 | Bacteria | 26292 |
| 401 | Ga0436365_1348585 | 3300039437 | Bacteria | 1589 |
| 402 | Ga0436363_1533522 | 3300039450 | Bacteria | 1661 |
| 403 | Ga0439436_0041458 | 3300041404 | Bacteria | 1317 |
| 404 | Ga0439439_0016324 | 3300041406 | Bacteria | 1817 |
| 405 | Ga0439461_0000006 | 3300041410 | Bacteria | 28112 |
| 406 | Ga0439466_0050944 | 3300041411 | Bacteria | 1357 |
| 407 | Ga0439465_0000283 | 3300041413 | Bacteria | 14258 |
| 408 | Ga0439465_0000716 | 3300041413 | Bacteria | 10217 |
| 409 | Ga0439431_0002911 | 3300041997 | Bacteria | 3761 |
| 410 | Ga0439431_0021263 | 3300041997 | Bacteria | 1556 |
| 411 | Ga0439445_0001744 | 3300042004 | Bacteria | 4792 |
| 412 | Ga0439445_0006815 | 3300042004 | Bacteria | 2634 |
| 413 | Ga0439448_0007036 | 3300042005 | Bacteria | 3249 |
| 414 | Ga0439432_000186 | 3300042006 | Bacteria | 22271 |
| 415 | Ga0439452_019604 | 3300042010 | Bacteria | 1786 |
| 416 | Ga0439455_0040511 | 3300042012 | Bacteria | 1191 |
| 417 | Ga0439462_0000463 | 3300042015 | Bacteria | 7966 |
| 418 | Ga0439462_0015779 | 3300042015 | Bacteria | 1949 |
| 419 | Ga0439446_0039917 | 3300042156 | Bacteria | 1380 |
| 420 | Ga0439458_0000535 | 3300042157 | Bacteria | 9746 |
| 421 | Ga0439434_0000590 | 3300042435 | Bacteria | 10478 |
| 422 | Ga0466966_0005088 | 3300044684 | Bacteria | 8641 |
| 423 | Ga0466961_0003783 | 3300044693 | Bacteria | 9467 |
| 424 | Ga0466963_0018812 | 3300044694 | Bacteria | 4325 |
| 425 | Ga0466963_0053043 | 3300044694 | Bacteria | 2692 |
| 426 | Ga0466963_0068857 | 3300044694 | Bacteria | 2378 |
| 427 | Ga0453684_0097671 | 3300044712 | Bacteria | 3604 |
| 428 | Ga0466970_0005231 | 3300044765 | Bacteria | 6422 |
| 429 | Ga0466960_0047775 | 3300044901 | Bacteria | 2054 |
| 430 | Ga0451576_0000023 | 3300045051 | Bacteria | 477965 |
| 431 | Ga0466967_0014661 | 3300045976 | Bacteria | 6117 |
| 432 | Ga0466967_0130403 | 3300045976 | Bacteria | 2333 |
| 433 | Ga0466967_0150187 | 3300045976 | Bacteria | 2177 |
| 434 | Ga0495617_013296 | 3300046452 | Bacteria | 2800 |
| 435 | Ga0495627_000139 | 3300046453 | Bacteria | 86240 |
| 436 | Ga0495627_000456 | 3300046453 | Bacteria | 35514 |
| 437 | Ga0495627_064373 | 3300046453 | Bacteria | 1079 |
| 438 | Ga0495629_0009434 | 3300046459 | Bacteria | 7137 |
| 439 | Ga0495638_0000365 | 3300046460 | Bacteria | 56011 |
| 440 | Ga0495650_0052117 | 3300046471 | Bacteria | 1681 |
| 441 | Ga0495584_0006076 | 3300046491 | Bacteria | 6357 |
| 442 | Ga0495585_0077912 | 3300046492 | Bacteria | 1799 |
| 443 | Ga0495594_0008293 | 3300046499 | Bacteria | 5349 |
| 444 | Ga0495596_0005305 | 3300046500 | Bacteria | 6109 |
| 445 | Ga0495583_0000138 | 3300046506 | Bacteria | 123486 |
| 446 | Ga0495583_0016933 | 3300046506 | Bacteria | 3892 |
| 447 | Ga0495606_0002185 | 3300046507 | Bacteria | 23483 |
| 448 | Ga0495606_0035649 | 3300046507 | Bacteria | 3398 |
| 449 | Ga0495610_0000166 | 3300046512 | Bacteria | 73463 |
| 450 | Ga0495616_0000208 | 3300046513 | Bacteria | 48701 |
| 451 | Ga0495632_0000149 | 3300046519 | Bacteria | 72208 |
| 452 | Ga0495637_0000292 | 3300046520 | Bacteria | 38995 |
| 453 | Ga0495643_0000046 | 3300046522 | Bacteria | 220912 |
| 454 | Ga0495643_0002201 | 3300046522 | Bacteria | 15911 |
| 455 | Ga0495643_0010440 | 3300046522 | Bacteria | 5715 |
| 456 | Ga0495643_0066020 | 3300046522 | Bacteria | 1909 |
| 457 | Ga0495648_0000323 | 3300046524 | Bacteria | 53106 |
| 458 | Ga0495648_0004739 | 3300046524 | Bacteria | 11521 |
| 459 | Ga0495648_0016092 | 3300046524 | Bacteria | 5398 |
| 460 | Ga0495648_0053969 | 3300046524 | Bacteria | 2431 |
| 461 | Ga0495663_0000027 | 3300046525 | Bacteria | 89947 |
| 462 | Ga0495663_0003300 | 3300046525 | Bacteria | 4673 |
| 463 | Ga0495663_0017765 | 3300046525 | Bacteria | 2021 |
| 464 | Ga0495663_0033315 | 3300046525 | Bacteria | 1538 |
| 465 | Ga0495663_0057944 | 3300046525 | Bacteria | 1213 |
| 466 | Ga0495642_0002732 | 3300046528 | Bacteria | 7079 |
| 467 | Ga0495633_0000054 | 3300046558 | Bacteria | 151646 |
| 468 | Ga0495633_0000494 | 3300046558 | Bacteria | 39797 |
| 469 | Ga0495633_0001284 | 3300046558 | Bacteria | 19912 |
| 470 | Ga0495668_0000059 | 3300046616 | Bacteria | 194951 |
| 471 | Ga0495668_0001884 | 3300046616 | Bacteria | 18804 |
| 472 | Ga0495668_0017273 | 3300046616 | Bacteria | 4188 |
| 473 | Ga0495625_0000309 | 3300046660 | Bacteria | 74356 |
| 474 | Ga0495625_0024399 | 3300046660 | Bacteria | 4603 |
| 475 | Ga0495625_0127490 | 3300046660 | Bacteria | 1726 |
| 476 | Ga0495625_0148704 | 3300046660 | Bacteria | 1576 |
| 477 | Ga0495661_0006154 | 3300046665 | Bacteria | 8444 |
| 478 | Ga0495661_0025887 | 3300046665 | Bacteria | 3784 |
| 479 | Ga0495669_0008783 | 3300046684 | Bacteria | 4256 |
| 480 | Ga0495670_0000023 | 3300046691 | Bacteria | 92374 |
| 481 | Ga0495670_0035367 | 3300046691 | Bacteria | 2490 |
| 482 | Ga0495670_0102004 | 3300046691 | Bacteria | 1478 |
| 483 | Ga0495671_0000029 | 3300046692 | Bacteria | 220912 |
| 484 | Ga0495677_0004082 | 3300047445 | Bacteria | 5637 |
| 485 | Ga0495681_0000056 | 3300047470 | Bacteria | 103692 |
| 486 | Ga0495681_0003895 | 3300047470 | Bacteria | 10288 |
| 487 | Ga0495681_0006476 | 3300047470 | Bacteria | 7690 |
| 488 | Ga0495681_0071832 | 3300047470 | Bacteria | 1566 |
| 489 | Ga0495686_0000209 | 3300047472 | Bacteria | 108972 |
| 490 | Ga0495686_0004235 | 3300047472 | Bacteria | 11894 |
| 491 | Ga0495686_0029903 | 3300047472 | Bacteria | 3540 |
| 492 | Ga0495686_0106385 | 3300047472 | Bacteria | 1687 |
| 493 | Ga0495686_0117898 | 3300047472 | Bacteria | 1585 |
| 494 | Ga0496100_0007768 | 3300048903 | Bacteria | 5944 |
| 495 | Ga0496101_0009676 | 3300048904 | Bacteria | 6342 |
| 496 | Ga0496101_0014857 | 3300048904 | Bacteria | 5240 |
| 497 | Ga0496101_0060782 | 3300048904 | Bacteria | 2742 |
| 498 | Ga0496102_0000120 | 3300048905 | Bacteria | 112432 |
| 499 | Ga0496102_0000184 | 3300048905 | Bacteria | 84568 |
| 500 | Ga0496102_0000445 | 3300048905 | Bacteria | 47017 |
| 501 | Ga0496102_0650751 | 3300048905 | Bacteria | 977 |
| 502 | Ga0496103_0000021 | 3300048906 | Bacteria | 229062 |
| 503 | Ga0496103_0000099 | 3300048906 | Bacteria | 94046 |
| 504 | Ga0496103_0000154 | 3300048906 | Bacteria | 72239 |
| 505 | Ga0496103_0014080 | 3300048906 | Bacteria | 4748 |
| 506 | Ga0496103_0053602 | 3300048906 | Bacteria | 2500 |
| 507 | Ga0496103_0083447 | 3300048906 | Bacteria | 2012 |
| 508 | Ga0496104_0000131 | 3300048907 | Bacteria | 69658 |
| 509 | Ga0496104_0109340 | 3300048907 | Bacteria | 2649 |
| 510 | Ga0496104_0115375 | 3300048907 | Bacteria | 2577 |
| 511 | Ga0496104_0218248 | 3300048907 | Bacteria | 1819 |
| 512 | Ga0496104_0682394 | 3300048907 | Bacteria | 935 |
| 513 | Ga0496105_0000589 | 3300048908 | Bacteria | 24200 |
| 514 | Ga0496105_0038710 | 3300048908 | Bacteria | 3928 |
| 515 | Ga0496106_0076676 | 3300048909 | Bacteria | 2563 |
| 516 | Ga0496107_0007799 | 3300048910 | Bacteria | 7389 |
| 517 | Ga0496107_0043498 | 3300048910 | Bacteria | 3227 |
| 518 | Ga0496108_0001130 | 3300048911 | Bacteria | 20859 |
| 519 | Ga0496108_0013979 | 3300048911 | Bacteria | 6548 |
| 520 | Ga0496108_0042420 | 3300048911 | Bacteria | 3798 |
| 521 | Ga0496108_0300070 | 3300048911 | Bacteria | 1399 |
| 522 | Ga0496108_0496393 | 3300048911 | Bacteria | 1066 |
| 523 | Ga0496109_0032632 | 3300048912 | Bacteria | 4681 |
| 524 | Ga0496109_0148176 | 3300048912 | Bacteria | 2196 |
| 525 | Ga0496109_0249737 | 3300048912 | Bacteria | 1670 |
| 526 | Ga0496109_0525858 | 3300048912 | Bacteria | 1116 |
| 527 | Ga0496109_0582886 | 3300048912 | Bacteria | 1054 |
| 528 | Ga0496109_0778952 | 3300048912 | Bacteria | 894 |
| 529 | Ga0496110_0005539 | 3300048913 | Bacteria | 9913 |
| 530 | Ga0496110_0160344 | 3300048913 | Bacteria | 2039 |
| 531 | Ga0496110_0196591 | 3300048913 | Bacteria | 1832 |
| 532 | Ga0496110_0206728 | 3300048913 | Bacteria | 1784 |
| 533 | Ga0496111_0159798 | 3300048914 | Bacteria | 1673 |
| 534 | Ga0496112_0007596 | 3300048915 | Bacteria | 9634 |
| 535 | Ga0496112_0008312 | 3300048915 | Bacteria | 9288 |
| 536 | Ga0496112_0013521 | 3300048915 | Bacteria | 7539 |
| 537 | Ga0496112_0022743 | 3300048915 | Bacteria | 5980 |
| 538 | Ga0496112_0048211 | 3300048915 | Bacteria | 4177 |
| 539 | Ga0496112_0050942 | 3300048915 | Bacteria | 4061 |
| 540 | Ga0496112_0065999 | 3300048915 | Bacteria | 3571 |
| 541 | Ga0496112_0150419 | 3300048915 | Bacteria | 2295 |
| 542 | Ga0496113_0009281 | 3300048916 | Bacteria | 6452 |
| 543 | Ga0496113_0011647 | 3300048916 | Bacteria | 5881 |
| 544 | Ga0496113_0051952 | 3300048916 | Bacteria | 3059 |
| 545 | Ga0496113_0107251 | 3300048916 | Bacteria | 2170 |
| 546 | Ga0496114_0002445 | 3300048917 | Bacteria | 14178 |
| 547 | Ga0496115_0000066 | 3300048918 | Bacteria | 95550 |
| 548 | Ga0496115_0000299 | 3300048918 | Bacteria | 42395 |
| 549 | Ga0496115_0302901 | 3300048918 | Bacteria | 1309 |
| 550 | Ga0496116_0001774 | 3300048919 | Bacteria | 23469 |
| 551 | Ga0496116_0003673 | 3300048919 | Bacteria | 15044 |
| 552 | Ga0496116_0146955 | 3300048919 | Bacteria | 1316 |
| 553 | Ga0496117_0000317 | 3300048920 | Bacteria | 84472 |
| 554 | Ga0496117_0001024 | 3300048920 | Bacteria | 42696 |
| 555 | Ga0496117_0011540 | 3300048920 | Bacteria | 7905 |
| 556 | Ga0496118_0000154 | 3300048921 | Bacteria | 122224 |
| 557 | Ga0496118_0000303 | 3300048921 | Bacteria | 85332 |
| 558 | Ga0496118_0005472 | 3300048921 | Bacteria | 14417 |
| 559 | Ga0496119_0000339 | 3300048922 | Bacteria | 65402 |
| 560 | Ga0496119_0006478 | 3300048922 | Bacteria | 10818 |
| 561 | Ga0496119_0140203 | 3300048922 | Bacteria | 1306 |
| 562 | Ga0496120_0008623 | 3300048923 | Bacteria | 7363 |
| 563 | Ga0496121_0000022 | 3300048924 | Bacteria | 472849 |
| 564 | Ga0496121_0000417 | 3300048924 | Bacteria | 84424 |
| 565 | Ga0496121_0000472 | 3300048924 | Bacteria | 78334 |
| 566 | Ga0496121_0086591 | 3300048924 | Bacteria | 2462 |
| 567 | Ga0496122_0011041 | 3300048925 | Bacteria | 9219 |
| 568 | Ga0496122_0020196 | 3300048925 | Bacteria | 6037 |
| 569 | Ga0496122_0097549 | 3300048925 | Bacteria | 1978 |
| 570 | Ga0496123_0012745 | 3300048926 | Bacteria | 7130 |
| 571 | Ga0496123_0151617 | 3300048926 | Bacteria | 1250 |
| 572 | Ga0496124_0000214 | 3300048927 | Bacteria | 113007 |
| 573 | Ga0496124_0000291 | 3300048927 | Bacteria | 94493 |
| 574 | Ga0496124_0005716 | 3300048927 | Bacteria | 13859 |
| 575 | Ga0496124_0006240 | 3300048927 | Bacteria | 13059 |
| 576 | Ga0496124_0151865 | 3300048927 | Bacteria | 1816 |
| 577 | Ga0496125_0001248 | 3300048928 | Bacteria | 37996 |
| 578 | Ga0496125_0002118 | 3300048928 | Bacteria | 26680 |
| 579 | Ga0496125_0016918 | 3300048928 | Bacteria | 6978 |
| 580 | Ga0496125_0017281 | 3300048928 | Bacteria | 6888 |
| 581 | Ga0496125_0098026 | 3300048928 | Bacteria | 2170 |
| 582 | Ga0496125_0138856 | 3300048928 | Bacteria | 1694 |
| 583 | Ga0496126_0000367 | 3300048929 | Bacteria | 93102 |
| 584 | Ga0496126_0001079 | 3300048929 | Bacteria | 45863 |
| 585 | Ga0496126_0008754 | 3300048929 | Bacteria | 10864 |
| 586 | Ga0496126_0182421 | 3300048929 | Bacteria | 1782 |
| 587 | Ga0495678_005174 | 3300049459 | Bacteria | 7303 |
| 588 | Ga0501290_000344 | 3300049513 | Bacteria | 7622 |
| 589 | Ga0501292_000096 | 3300049515 | Bacteria | 15530 |
| 590 | Ga0501294_000264 | 3300049517 | Bacteria | 6475 |
| 591 | Ga0501300_006959 | 3300049523 | Bacteria | 1658 |
| 592 | Ga0501301_000295 | 3300049524 | Bacteria | 2934 |
| 593 | Ga0501034_0036229 | 3300049571 | Bacteria | 4998 |
| 594 | Ga0501038_0056925 | 3300049574 | Bacteria | 3358 |
| 595 | Ga0501069_0222786 | 3300049585 | Bacteria | 1097 |
| 596 | Ga0501211_001806 | 3300049658 | Bacteria | 2286 |
| 597 | Ga0501222_000612 | 3300049662 | Bacteria | 5238 |
| 598 | Ga0501223_000028 | 3300049663 | Bacteria | 53750 |
| 599 | Ga0501223_000771 | 3300049663 | Bacteria | 7611 |
| 600 | Ga0501223_001119 | 3300049663 | Bacteria | 6308 |
| 601 | Ga0501224_000008 | 3300049664 | Bacteria | 111708 |
| 602 | Ga0501233_000405 | 3300049668 | Bacteria | 6791 |
| 603 | Ga0501235_007597 | 3300049669 | Bacteria | 2362 |
| 604 | Ga0501235_008756 | 3300049669 | Bacteria | 2208 |
| 605 | Ga0501235_010625 | 3300049669 | Bacteria | 2012 |
| 606 | Ga0501246_006459 | 3300049676 | Bacteria | 1006 |
| 607 | Ga0501261_000197 | 3300049690 | Bacteria | 8620 |
| 608 | Ga0501225_0000067 | 3300049705 | Bacteria | 34242 |
| 609 | Ga0501225_0000073 | 3300049705 | Bacteria | 33154 |
| 610 | Ga0501225_0001910 | 3300049705 | Bacteria | 6535 |
| 611 | Ga0501225_0002096 | 3300049705 | Bacteria | 6202 |
| 612 | Ga0501279_000051 | 3300049775 | Bacteria | 22449 |
| 613 | Ga0501280_000167 | 3300049776 | Bacteria | 16933 |
| 614 | Ga0501281_00129 | 3300049777 | Bacteria | 9159 |
| 615 | Ga0501282_000161 | 3300049778 | Bacteria | 8038 |
| 616 | Ga0501226_000253 | 3300049853 | Bacteria | 8163 |
| 617 | nmdc:mga03n38_16925_c1 | 3300050490 | Bacteria | 2845 |
| 618 | nmdc:mga00v17_16355_c1 | 3300050491 | Bacteria | 4181 |
| 619 | nmdc:mga0k408_130136_c1 | 3300050493 | Bacteria | 1494 |
| 620 | nmdc:mga06z11_67_c1 | 3300050494 | Bacteria | 42818 |
| 621 | nmdc:mga04h51_55_c1 | 3300050495 | Bacteria | 36672 |
| 622 | nmdc:mga07m45_126696_c1 | 3300050496 | Bacteria | 1477 |
| 623 | nmdc:mga07m45_23256_c1 | 3300050496 | Bacteria | 3386 |
| 624 | nmdc:mga05p37_315121_c1 | 3300050507 | Bacteria | 1853 |
| 625 | nmdc:mga08y16_199341_c1 | 3300050511 | Bacteria | 2074 |
| 626 | Ga0500643_000762 | 3300053087 | Bacteria | 20999 |
| 627 | Ga0500643_001338 | 3300053087 | Bacteria | 14380 |
| 628 | Ga0500566_0001470 | 3300053094 | Bacteria | 13790 |
| 629 | Ga0500641_0023307 | 3300053096 | Bacteria | 2380 |
| 630 | Ga0500641_0051728 | 3300053096 | Bacteria | 1691 |
| 631 | Ga0500555_002967 | 3300053103 | Bacteria | 4855 |
| 632 | Ga0500555_012302 | 3300053103 | Bacteria | 2462 |
| 633 | Ga0500556_0019253 | 3300053104 | Bacteria | 2167 |
| 634 | Ga0500562_026682 | 3300053108 | Bacteria | 1515 |
| 635 | Ga0500592_019037 | 3300053116 | Bacteria | 1103 |
| 636 | Ga0500594_0005241 | 3300053118 | Bacteria | 2872 |
| 637 | Ga0500595_001625 | 3300053119 | Bacteria | 11813 |
| 638 | Ga0500607_000107 | 3300053121 | Bacteria | 64565 |
| 639 | Ga0500618_013525 | 3300053125 | Bacteria | 2104 |
| 640 | Ga0500658_0000412 | 3300053134 | Bacteria | 18530 |
| 641 | Ga0500658_0002799 | 3300053134 | Bacteria | 6696 |
| 642 | Ga0500559_0001127 | 3300053136 | Bacteria | 16082 |
| 643 | Ga0500559_0003970 | 3300053136 | Bacteria | 7126 |
| 644 | Ga0500559_0023273 | 3300053136 | Bacteria | 2630 |
| 645 | Ga0500568_0015865 | 3300053139 | Bacteria | 3362 |
| 646 | Ga0500568_0051411 | 3300053139 | Bacteria | 1621 |
| 647 | Ga0500573_0003254 | 3300053140 | Bacteria | 8368 |
| 648 | Ga0500573_0070635 | 3300053140 | Bacteria | 1992 |
| 649 | Ga0500590_001908 | 3300053148 | Bacteria | 8905 |
| 650 | Ga0500590_055279 | 3300053148 | Bacteria | 2008 |
| 651 | Ga0500604_0010062 | 3300053151 | Bacteria | 2525 |
| 652 | Ga0500616_0038718 | 3300053153 | Bacteria | 2574 |
| 653 | Ga0500627_0016641 | 3300053158 | Bacteria | 2873 |
| 654 | Ga0500637_0015759 | 3300053178 | Bacteria | 4016 |
| 655 | Ga0500645_004182 | 3300053730 | Bacteria | 5617 |
| 656 | Ga0500645_024806 | 3300053730 | Bacteria | 1831 |
| 657 | Ga0500661_001278 | 3300055283 | Bacteria | 4700 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0650751 | Ga0496102_0650751_247_966 | 228 |
| 2 | 3300049669 | Ga0501235_008756 | Ga0501235_008756_1449_2192 | 234 |
| 3 | 3300046453 | Ga0495627_064373 | Ga0495627_064373_261_1040 | 248 |
| 4 | 3300005617 | Ga0068859_100356477 | Ga0068859_1003564772 | 252 |
| 5 | 3300006931 | Ga0097620_100356499 | Ga0097620_1003564992 | 252 |
| 6 | 3300011119 | Ga0105246_10289865 | Ga0105246_102898652 | 254 |
| 7 | 3300013297 | Ga0157378_10634727 | Ga0157378_106347271 | 257 |
| 8 | 3300048915 | Ga0496112_0050942 | Ga0496112_0050942_34_813 | 258 |
| 9 | 3300006175 | Ga0070712_100129457 | Ga0070712_1001294572 | 265 |
| 10 | 3300025915 | Ga0207693_10137441 | Ga0207693_101374412 | 265 |
| 11 | 3300025972 | Ga0207668_10176804 | Ga0207668_101768042 | 265 |
| 12 | 3300005327 | Ga0070658_10027993 | Ga0070658_100279932 | 267 |
| 13 | 3300025909 | Ga0207705_10041001 | Ga0207705_100410012 | 267 |
| 14 | 3300046684 | Ga0495669_0008783 | Ga0495669_0008783_2330_3178 | 267 |
| 15 | 3300005616 | Ga0068852_100656051 | Ga0068852_1006560511 | 268 |
| 16 | 3300005618 | Ga0068864_100178539 | Ga0068864_1001785392 | 268 |
| 17 | 3300037418 | Ga0395900_0119526 | Ga0395900_0119526_610_1464 | 269 |
| 18 | 3300037466 | Ga0395898_0521796 | Ga0395898_0521796_212_1066 | 269 |
| 19 | 3300037471 | Ga0395905_0000743 | Ga0395905_0000743_30444_31298 | 269 |
| 20 | 3300048911 | Ga0496108_0300070 | Ga0496108_0300070_217_1104 | 269 |
| 21 | 3300048912 | Ga0496109_0778952 | Ga0496109_0778952_37_882 | 269 |
| 22 | 3300048916 | Ga0496113_0107251 | Ga0496113_0107251_1220_2107 | 269 |
| 23 | 3300044712 | Ga0453684_0097671 | Ga0453684_0097671_1172_2116 | 271 |
| 24 | 3300005338 | Ga0068868_100241644 | Ga0068868_1002416442 | 274 |
| 25 | 3300005340 | Ga0070689_100213177 | Ga0070689_1002131772 | 274 |
| 26 | 3300005545 | Ga0070695_100334289 | Ga0070695_1003342892 | 274 |
| 27 | 3300005616 | Ga0068852_100218800 | Ga0068852_1002188002 | 274 |
| 28 | 3300006175 | Ga0070712_100094949 | Ga0070712_1000949492 | 274 |
| 29 | 3300009553 | Ga0105249_10315560 | Ga0105249_103155602 | 274 |
| 30 | 3300025915 | Ga0207693_10046192 | Ga0207693_100461922 | 274 |
| 31 | 3300025933 | Ga0207706_10161644 | Ga0207706_101616442 | 274 |
| 32 | 3300025961 | Ga0207712_10338067 | Ga0207712_103380672 | 274 |
| 33 | 3300026023 | Ga0207677_10451856 | Ga0207677_104518561 | 274 |
| 34 | 3300026089 | Ga0207648_10041746 | Ga0207648_100417462 | 274 |
| 35 | 3300046453 | Ga0495627_000139 | Ga0495627_000139_14659_15597 | 274 |
| 36 | 3300046524 | Ga0495648_0004739 | Ga0495648_0004739_10142_11080 | 274 |
| 37 | 3300046525 | Ga0495663_0057944 | Ga0495663_0057944_224_1162 | 274 |
| 38 | 3300047470 | Ga0495681_0071832 | Ga0495681_0071832_177_1115 | 274 |
| 39 | 3300001990 | JGI24737J22298_10000985 | JGI24737J22298_100009852 | 275 |
| 40 | 3300005327 | Ga0070658_10145696 | Ga0070658_101456962 | 275 |
| 41 | 3300005328 | Ga0070676_10050584 | Ga0070676_100505844 | 275 |
| 42 | 3300005331 | Ga0070670_100026108 | Ga0070670_1000261084 | 275 |
| 43 | 3300005344 | Ga0070661_100004105 | Ga0070661_1000041056 | 275 |
| 44 | 3300005344 | Ga0070661_100108963 | Ga0070661_1001089632 | 275 |
| 45 | 3300005354 | Ga0070675_100215934 | Ga0070675_1002159342 | 275 |
| 46 | 3300005355 | Ga0070671_100075569 | Ga0070671_1000755694 | 275 |
| 47 | 3300005434 | Ga0070709_10007175 | Ga0070709_100071752 | 275 |
| 48 | 3300005455 | Ga0070663_100320368 | Ga0070663_1003203682 | 275 |
| 49 | 3300005548 | Ga0070665_100000043 | Ga0070665_100000043228 | 275 |
| 50 | 3300005548 | Ga0070665_100106578 | Ga0070665_1001065783 | 275 |
| 51 | 3300005548 | Ga0070665_100385597 | Ga0070665_1003855972 | 275 |
| 52 | 3300005564 | Ga0070664_100010420 | Ga0070664_1000104201 | 275 |
| 53 | 3300005564 | Ga0070664_100027700 | Ga0070664_1000277002 | 275 |
| 54 | 3300005577 | Ga0068857_100209967 | Ga0068857_1002099672 | 275 |
| 55 | 3300005841 | Ga0068863_100072483 | Ga0068863_1000724832 | 275 |
| 56 | 3300006237 | Ga0097621_100199589 | Ga0097621_1001995892 | 275 |
| 57 | 3300009093 | Ga0105240_10192390 | Ga0105240_101923903 | 275 |
| 58 | 3300009176 | Ga0105242_10238274 | Ga0105242_102382742 | 275 |
| 59 | 3300009177 | Ga0105248_10062566 | Ga0105248_100625662 | 275 |
| 60 | 3300009545 | Ga0105237_10137121 | Ga0105237_101371214 | 275 |
| 61 | 3300013307 | Ga0157372_10444925 | Ga0157372_104449251 | 275 |
| 62 | 3300014325 | Ga0163163_10016104 | Ga0163163_100161043 | 275 |
| 63 | 3300025904 | Ga0207647_10020983 | Ga0207647_100209832 | 275 |
| 64 | 3300025913 | Ga0207695_10029867 | Ga0207695_100298673 | 275 |
| 65 | 3300025919 | Ga0207657_10066783 | Ga0207657_100667833 | 275 |
| 66 | 3300025920 | Ga0207649_10006343 | Ga0207649_100063432 | 275 |
| 67 | 3300025924 | Ga0207694_10018242 | Ga0207694_100182426 | 275 |
| 68 | 3300025932 | Ga0207690_10004171 | Ga0207690_100041719 | 275 |
| 69 | 3300025945 | Ga0207679_10006239 | Ga0207679_100062392 | 275 |
| 70 | 3300025945 | Ga0207679_10137052 | Ga0207679_101370522 | 275 |
| 71 | 3300025981 | Ga0207640_10023212 | Ga0207640_100232122 | 275 |
| 72 | 3300026067 | Ga0207678_10109423 | Ga0207678_101094232 | 275 |
| 73 | 3300026078 | Ga0207702_10020933 | Ga0207702_100209332 | 275 |
| 74 | 3300026116 | Ga0207674_10385163 | Ga0207674_103851632 | 275 |
| 75 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002363 | 275 |
| 76 | 3300028379 | Ga0268266_10015858 | Ga0268266_100158584 | 275 |
| 77 | 3300028379 | Ga0268266_10038079 | Ga0268266_100380794 | 275 |
| 78 | 3300037312 | Ga0395899_0033974 | Ga0395899_0033974_118_972 | 275 |
| 79 | 3300037312 | Ga0395899_0052958 | Ga0395899_0052958_620_1486 | 275 |
| 80 | 3300037312 | Ga0395899_0063383 | Ga0395899_0063383_817_1677 | 275 |
| 81 | 3300037312 | Ga0395899_0137013 | Ga0395899_0137013_53_919 | 275 |
| 82 | 3300037418 | Ga0395900_0010748 | Ga0395900_0010748_5381_6235 | 275 |
| 83 | 3300037418 | Ga0395900_0021596 | Ga0395900_0021596_5615_6460 | 275 |
| 84 | 3300037418 | Ga0395900_0029328 | Ga0395900_0029328_849_1715 | 275 |
| 85 | 3300037418 | Ga0395900_0239106 | Ga0395900_0239106_209_1075 | 275 |
| 86 | 3300037466 | Ga0395898_0068362 | Ga0395898_0068362_1432_2292 | 275 |
| 87 | 3300037466 | Ga0395898_0262259 | Ga0395898_0262259_389_1234 | 275 |
| 88 | 3300037466 | Ga0395898_0320133 | Ga0395898_0320133_405_1271 | 275 |
| 89 | 3300037471 | Ga0395905_0002628 | Ga0395905_0002628_2153_3007 | 275 |
| 90 | 3300037471 | Ga0395905_0465062 | Ga0395905_0465062_58_912 | 275 |
| 91 | 3300037471 | Ga0395905_0470581 | Ga0395905_0470581_98_964 | 275 |
| 92 | 3300038443 | Ga0395901_0020705 | Ga0395901_0020705_3199_4053 | 275 |
| 93 | 3300038443 | Ga0395901_0074493 | Ga0395901_0074493_1439_2305 | 275 |
| 94 | 3300038443 | Ga0395901_0091912 | Ga0395901_0091912_18_884 | 275 |
| 95 | 3300039450 | Ga0436363_1533522 | Ga0436363_1533522_317_1246 | 275 |
| 96 | 3300042005 | Ga0439448_0007036 | Ga0439448_0007036_1668_2522 | 275 |
| 97 | 3300042012 | Ga0439455_0040511 | Ga0439455_0040511_13_867 | 275 |
| 98 | 3300042157 | Ga0439458_0000535 | Ga0439458_0000535_5077_5931 | 275 |
| 99 | 3300044694 | Ga0466963_0018812 | Ga0466963_0018812_2457_3323 | 275 |
| 100 | 3300044694 | Ga0466963_0053043 | Ga0466963_0053043_938_1804 | 275 |
| 101 | 3300044694 | Ga0466963_0068857 | Ga0466963_0068857_566_1435 | 275 |
| 102 | 3300044765 | Ga0466970_0005231 | Ga0466970_0005231_2435_3289 | 275 |
| 103 | 3300044901 | Ga0466960_0047775 | Ga0466960_0047775_325_1221 | 275 |
| 104 | 3300045976 | Ga0466967_0014661 | Ga0466967_0014661_1020_1886 | 275 |
| 105 | 3300045976 | Ga0466967_0130403 | Ga0466967_0130403_958_1827 | 275 |
| 106 | 3300046459 | Ga0495629_0009434 | Ga0495629_0009434_6164_7069 | 275 |
| 107 | 3300046492 | Ga0495585_0077912 | Ga0495585_0077912_597_1469 | 275 |
| 108 | 3300046499 | Ga0495594_0008293 | Ga0495594_0008293_1333_2238 | 275 |
| 109 | 3300046506 | Ga0495583_0016933 | Ga0495583_0016933_778_1713 | 275 |
| 110 | 3300046507 | Ga0495606_0002185 | Ga0495606_0002185_14062_14934 | 275 |
| 111 | 3300046507 | Ga0495606_0035649 | Ga0495606_0035649_510_1445 | 275 |
| 112 | 3300046522 | Ga0495643_0002201 | Ga0495643_0002201_1969_2904 | 275 |
| 113 | 3300046522 | Ga0495643_0010440 | Ga0495643_0010440_836_1771 | 275 |
| 114 | 3300046522 | Ga0495643_0066020 | Ga0495643_0066020_57_929 | 275 |
| 115 | 3300046524 | Ga0495648_0000323 | Ga0495648_0000323_12584_13456 | 275 |
| 116 | 3300046528 | Ga0495642_0002732 | Ga0495642_0002732_219_1154 | 275 |
| 117 | 3300046616 | Ga0495668_0000059 | Ga0495668_0000059_132486_133358 | 275 |
| 118 | 3300046616 | Ga0495668_0017273 | Ga0495668_0017273_1913_2848 | 275 |
| 119 | 3300046660 | Ga0495625_0024399 | Ga0495625_0024399_2954_3826 | 275 |
| 120 | 3300046660 | Ga0495625_0127490 | Ga0495625_0127490_607_1479 | 275 |
| 121 | 3300047445 | Ga0495677_0004082 | Ga0495677_0004082_2077_2949 | 275 |
| 122 | 3300047470 | Ga0495681_0003895 | Ga0495681_0003895_1261_2133 | 275 |
| 123 | 3300047472 | Ga0495686_0106385 | Ga0495686_0106385_437_1309 | 275 |
| 124 | 3300048905 | Ga0496102_0000184 | Ga0496102_0000184_67553_68425 | 275 |
| 125 | 3300048906 | Ga0496103_0000099 | Ga0496103_0000099_15476_16348 | 275 |
| 126 | 3300048907 | Ga0496104_0109340 | Ga0496104_0109340_287_1159 | 275 |
| 127 | 3300048907 | Ga0496104_0682394 | Ga0496104_0682394_17_922 | 275 |
| 128 | 3300048908 | Ga0496105_0000589 | Ga0496105_0000589_7952_8824 | 275 |
| 129 | 3300048910 | Ga0496107_0043498 | Ga0496107_0043498_1929_2801 | 275 |
| 130 | 3300048911 | Ga0496108_0496393 | Ga0496108_0496393_189_1034 | 275 |
| 131 | 3300048912 | Ga0496109_0525858 | Ga0496109_0525858_189_1061 | 275 |
| 132 | 3300048912 | Ga0496109_0582886 | Ga0496109_0582886_173_1018 | 275 |
| 133 | 3300048913 | Ga0496110_0005539 | Ga0496110_0005539_1489_2361 | 275 |
| 134 | 3300048915 | Ga0496112_0008312 | Ga0496112_0008312_6133_6978 | 275 |
| 135 | 3300048915 | Ga0496112_0013521 | Ga0496112_0013521_4973_5878 | 275 |
| 136 | 3300048915 | Ga0496112_0022743 | Ga0496112_0022743_403_1308 | 275 |
| 137 | 3300048915 | Ga0496112_0065999 | Ga0496112_0065999_1782_2642 | 275 |
| 138 | 3300048917 | Ga0496114_0002445 | Ga0496114_0002445_237_1109 | 275 |
| 139 | 3300048918 | Ga0496115_0000066 | Ga0496115_0000066_77654_78526 | 275 |
| 140 | 3300048919 | Ga0496116_0003673 | Ga0496116_0003673_7961_8833 | 275 |
| 141 | 3300048920 | Ga0496117_0001024 | Ga0496117_0001024_15806_16678 | 275 |
| 142 | 3300048921 | Ga0496118_0000154 | Ga0496118_0000154_92365_93237 | 275 |
| 143 | 3300048922 | Ga0496119_0006478 | Ga0496119_0006478_6270_7142 | 275 |
| 144 | 3300048923 | Ga0496120_0008623 | Ga0496120_0008623_338_1210 | 275 |
| 145 | 3300048924 | Ga0496121_0000417 | Ga0496121_0000417_77461_78333 | 275 |
| 146 | 3300048925 | Ga0496122_0011041 | Ga0496122_0011041_1892_2764 | 275 |
| 147 | 3300048926 | Ga0496123_0012745 | Ga0496123_0012745_5890_6762 | 275 |
| 148 | 3300048927 | Ga0496124_0000291 | Ga0496124_0000291_77452_78324 | 275 |
| 149 | 3300048928 | Ga0496125_0001248 | Ga0496125_0001248_21391_22263 | 275 |
| 150 | 3300048929 | Ga0496126_0001079 | Ga0496126_0001079_28958_29830 | 275 |
| 151 | 3300050493 | nmdc:mga0k408_130136_c1 | nmdc:mga0k408_130136_c1_238_1110 | 275 |
| 152 | iso_pu_bacteria | 2990265787 | 2990268323 | 275 |
| 153 | iso_pu_bacteria | 2993693658 | 2993696645 | 275 |
| 154 | 3300005329 | Ga0070683_100003182 | Ga0070683_1000031826 | 276 |
| 155 | 3300005330 | Ga0070690_100082592 | Ga0070690_1000825921 | 276 |
| 156 | 3300005334 | Ga0068869_100091377 | Ga0068869_1000913773 | 276 |
| 157 | 3300005335 | Ga0070666_10034605 | Ga0070666_100346053 | 276 |
| 158 | 3300005338 | Ga0068868_100224567 | Ga0068868_1002245672 | 276 |
| 159 | 3300005355 | Ga0070671_100266665 | Ga0070671_1002666652 | 276 |
| 160 | 3300005364 | Ga0070673_100055087 | Ga0070673_1000550872 | 276 |
| 161 | 3300005578 | Ga0068854_100151319 | Ga0068854_1001513192 | 276 |
| 162 | 3300005718 | Ga0068866_10025330 | Ga0068866_100253302 | 276 |
| 163 | 3300006237 | Ga0097621_100109675 | Ga0097621_1001096753 | 276 |
| 164 | 3300009551 | Ga0105238_10031920 | Ga0105238_100319205 | 276 |
| 165 | 3300013297 | Ga0157378_10477150 | Ga0157378_104771502 | 276 |
| 166 | 3300013308 | Ga0157375_10052146 | Ga0157375_100521464 | 276 |
| 167 | 3300014325 | Ga0163163_10138005 | Ga0163163_101380052 | 276 |
| 168 | 3300014968 | Ga0157379_10424013 | Ga0157379_104240132 | 276 |
| 169 | 3300014968 | Ga0157379_10450214 | Ga0157379_104502142 | 276 |
| 170 | 3300025903 | Ga0207680_10018640 | Ga0207680_100186403 | 276 |
| 171 | 3300025919 | Ga0207657_10161010 | Ga0207657_101610102 | 276 |
| 172 | 3300025920 | Ga0207649_10193273 | Ga0207649_101932732 | 276 |
| 173 | 3300025931 | Ga0207644_10000142 | Ga0207644_1000014249 | 276 |
| 174 | 3300025933 | Ga0207706_10004203 | Ga0207706_100042036 | 276 |
| 175 | 3300025940 | Ga0207691_10003665 | Ga0207691_1000366511 | 276 |
| 176 | 3300025941 | Ga0207711_10487689 | Ga0207711_104876891 | 276 |
| 177 | 3300025960 | Ga0207651_10408398 | Ga0207651_104083982 | 276 |
| 178 | 3300026023 | Ga0207677_10073828 | Ga0207677_100738283 | 276 |
| 179 | 3300026078 | Ga0207702_10179298 | Ga0207702_101792983 | 276 |
| 180 | 3300026121 | Ga0207683_10000682 | Ga0207683_1000068227 | 276 |
| 181 | 3300031456 | Ga0307513_10075477 | Ga0307513_100754772 | 276 |
| 182 | 3300045976 | Ga0466967_0150187 | Ga0466967_0150187_1061_1945 | 276 |
| 183 | 3300046500 | Ga0495596_0005305 | Ga0495596_0005305_3941_4876 | 276 |
| 184 | 3300048904 | Ga0496101_0009676 | Ga0496101_0009676_4736_5584 | 276 |
| 185 | 3300048906 | Ga0496103_0014080 | Ga0496103_0014080_3694_4542 | 276 |
| 186 | 3300048907 | Ga0496104_0218248 | Ga0496104_0218248_773_1621 | 276 |
| 187 | 3300048910 | Ga0496107_0007799 | Ga0496107_0007799_4587_5435 | 276 |
| 188 | 3300048911 | Ga0496108_0013979 | Ga0496108_0013979_79_927 | 276 |
| 189 | 3300048912 | Ga0496109_0032632 | Ga0496109_0032632_3293_4141 | 276 |
| 190 | 3300048915 | Ga0496112_0007596 | Ga0496112_0007596_128_976 | 276 |
| 191 | 3300048916 | Ga0496113_0009281 | Ga0496113_0009281_4617_5465 | 276 |
| 192 | iso_pu_bacteria | 2928027323 | 2928030499 | 276 |
| 193 | iso_pu_bacteria | 2984555340 | 2984557281 | 276 |
| 194 | iso_pu_bacteria | 2984564862 | 2984568321 | 276 |
| 195 | iso_pu_bacteria | 2993356040 | 2993359403 | 276 |
| 196 | 3300005985 | Ga0081539_10092149 | Ga0081539_100921492 | 277 |
| 197 | 3300031903 | Ga0307407_10365861 | Ga0307407_103658612 | 277 |
| 198 | 3300032002 | Ga0307416_100063636 | Ga0307416_1000636364 | 277 |
| 199 | 3300032004 | Ga0307414_10030685 | Ga0307414_100306854 | 277 |
| 200 | 3300032126 | Ga0307415_100296324 | Ga0307415_1002963242 | 277 |
| 201 | 3300046525 | Ga0495663_0003300 | Ga0495663_0003300_1990_2925 | 277 |
| 202 | 3300046558 | Ga0495633_0000494 | Ga0495633_0000494_15300_16235 | 277 |
| 203 | 3300025944 | Ga0207661_10004832 | Ga0207661_100048324 | 279 |
| 204 | iso_pu_bacteria | 2885429604 | 2885430961 | 279 |
| 205 | 3300048926 | Ga0496123_0151617 | Ga0496123_0151617_355_1224 | 280 |
| 206 | 3300001976 | JGI24752J21851_1000853 | JGI24752J21851_10008534 | 281 |
| 207 | 3300005328 | Ga0070676_10114900 | Ga0070676_101149002 | 281 |
| 208 | 3300005329 | Ga0070683_100435822 | Ga0070683_1004358221 | 281 |
| 209 | 3300005330 | Ga0070690_100042531 | Ga0070690_1000425313 | 281 |
| 210 | 3300005331 | Ga0070670_100000068 | Ga0070670_10000006857 | 281 |
| 211 | 3300005337 | Ga0070682_100060602 | Ga0070682_1000606022 | 281 |
| 212 | 3300005339 | Ga0070660_100415499 | Ga0070660_1004154992 | 281 |
| 213 | 3300005345 | Ga0070692_10014178 | Ga0070692_100141784 | 281 |
| 214 | 3300005367 | Ga0070667_100001642 | Ga0070667_10000164217 | 281 |
| 215 | 3300005438 | Ga0070701_10036058 | Ga0070701_100360582 | 281 |
| 216 | 3300005440 | Ga0070705_100263003 | Ga0070705_1002630032 | 281 |
| 217 | 3300005459 | Ga0068867_100086669 | Ga0068867_1000866692 | 281 |
| 218 | 3300005578 | Ga0068854_100334814 | Ga0068854_1003348142 | 281 |
| 219 | 3300005615 | Ga0070702_100071142 | Ga0070702_1000711422 | 281 |
| 220 | 3300005616 | Ga0068852_100408889 | Ga0068852_1004088892 | 281 |
| 221 | 3300005617 | Ga0068859_100100298 | Ga0068859_1001002984 | 281 |
| 222 | 3300005618 | Ga0068864_100000019 | Ga0068864_10000001962 | 281 |
| 223 | 3300005618 | Ga0068864_100199022 | Ga0068864_1001990222 | 281 |
| 224 | 3300005719 | Ga0068861_100084181 | Ga0068861_1000841812 | 281 |
| 225 | 3300005841 | Ga0068863_100000015 | Ga0068863_10000001561 | 281 |
| 226 | 3300005842 | Ga0068858_100201589 | Ga0068858_1002015892 | 281 |
| 227 | 3300005843 | Ga0068860_100149110 | Ga0068860_1001491102 | 281 |
| 228 | 3300005844 | Ga0068862_100000094 | Ga0068862_10000009456 | 281 |
| 229 | 3300005844 | Ga0068862_100074743 | Ga0068862_1000747432 | 281 |
| 230 | 3300006931 | Ga0097620_100100297 | Ga0097620_1001002974 | 281 |
| 231 | 3300009011 | Ga0105251_10001041 | Ga0105251_100010418 | 281 |
| 232 | 3300009094 | Ga0111539_10223200 | Ga0111539_102232002 | 281 |
| 233 | 3300009098 | Ga0105245_10048863 | Ga0105245_100488632 | 281 |
| 234 | 3300009098 | Ga0105245_10106792 | Ga0105245_101067922 | 281 |
| 235 | 3300009101 | Ga0105247_10003045 | Ga0105247_100030458 | 281 |
| 236 | 3300009101 | Ga0105247_10013580 | Ga0105247_100135803 | 281 |
| 237 | 3300009148 | Ga0105243_10070358 | Ga0105243_100703582 | 281 |
| 238 | 3300009176 | Ga0105242_10075507 | Ga0105242_100755073 | 281 |
| 239 | 3300009177 | Ga0105248_10000311 | Ga0105248_1000031119 | 281 |
| 240 | 3300009551 | Ga0105238_10184869 | Ga0105238_101848692 | 281 |
| 241 | 3300009551 | Ga0105238_10224721 | Ga0105238_102247212 | 281 |
| 242 | 3300009553 | Ga0105249_10001265 | Ga0105249_100012656 | 281 |
| 243 | 3300009553 | Ga0105249_10018500 | Ga0105249_100185002 | 281 |
| 244 | 3300011119 | Ga0105246_10117781 | Ga0105246_101177812 | 281 |
| 245 | 3300011119 | Ga0105246_10412612 | Ga0105246_104126122 | 281 |
| 246 | 3300025735 | Ga0207713_1013836 | Ga0207713_10138362 | 281 |
| 247 | 3300025900 | Ga0207710_10013220 | Ga0207710_100132202 | 281 |
| 248 | 3300025900 | Ga0207710_10021848 | Ga0207710_100218482 | 281 |
| 249 | 3300025901 | Ga0207688_10020660 | Ga0207688_100206602 | 281 |
| 250 | 3300025918 | Ga0207662_10015394 | Ga0207662_100153944 | 281 |
| 251 | 3300025919 | Ga0207657_10100871 | Ga0207657_101008712 | 281 |
| 252 | 3300025925 | Ga0207650_10000054 | Ga0207650_1000005417 | 281 |
| 253 | 3300025927 | Ga0207687_10023037 | Ga0207687_100230373 | 281 |
| 254 | 3300025927 | Ga0207687_10024261 | Ga0207687_100242613 | 281 |
| 255 | 3300025931 | Ga0207644_10205848 | Ga0207644_102058482 | 281 |
| 256 | 3300025934 | Ga0207686_10284629 | Ga0207686_102846292 | 281 |
| 257 | 3300025935 | Ga0207709_10058780 | Ga0207709_100587802 | 281 |
| 258 | 3300025935 | Ga0207709_10163664 | Ga0207709_101636642 | 281 |
| 259 | 3300025941 | Ga0207711_10000017 | Ga0207711_1000001787 | 281 |
| 260 | 3300025942 | Ga0207689_10044334 | Ga0207689_100443343 | 281 |
| 261 | 3300025944 | Ga0207661_10125695 | Ga0207661_101256952 | 281 |
| 262 | 3300025961 | Ga0207712_10000113 | Ga0207712_1000011380 | 281 |
| 263 | 3300025961 | Ga0207712_10101081 | Ga0207712_101010812 | 281 |
| 264 | 3300025981 | Ga0207640_10143017 | Ga0207640_101430172 | 281 |
| 265 | 3300025981 | Ga0207640_10254786 | Ga0207640_102547862 | 281 |
| 266 | 3300025986 | Ga0207658_10000223 | Ga0207658_1000022317 | 281 |
| 267 | 3300026035 | Ga0207703_10315470 | Ga0207703_103154702 | 281 |
| 268 | 3300026088 | Ga0207641_10000008 | Ga0207641_10000008172 | 281 |
| 269 | 3300026095 | Ga0207676_10000019 | Ga0207676_1000001956 | 281 |
| 270 | 3300026095 | Ga0207676_10154638 | Ga0207676_101546382 | 281 |
| 271 | 3300026118 | Ga0207675_100044123 | Ga0207675_1000441234 | 281 |
| 272 | 3300026118 | Ga0207675_100049053 | Ga0207675_1000490534 | 281 |
| 273 | 3300026142 | Ga0207698_10093158 | Ga0207698_100931582 | 281 |
| 274 | 3300026142 | Ga0207698_10419826 | Ga0207698_104198262 | 281 |
| 275 | 3300028380 | Ga0268265_10000011 | Ga0268265_10000011172 | 281 |
| 276 | 3300028381 | Ga0268264_10216521 | Ga0268264_102165212 | 281 |
| 277 | 3300028800 | Ga0265338_10071540 | Ga0265338_100715402 | 281 |
| 278 | 3300031731 | Ga0307405_10186124 | Ga0307405_101861242 | 281 |
| 279 | 3300032002 | Ga0307416_100230210 | Ga0307416_1002302102 | 281 |
| 280 | 3300032004 | Ga0307414_10006195 | Ga0307414_100061955 | 281 |
| 281 | 3300032005 | Ga0307411_10108272 | Ga0307411_101082723 | 281 |
| 282 | 3300039437 | Ga0436365_1166901 | Ga0436365_1166901_6204_7079 | 281 |
| 283 | 3300046506 | Ga0495583_0000138 | Ga0495583_0000138_27275_28153 | 281 |
| 284 | 3300046665 | Ga0495661_0025887 | Ga0495661_0025887_2877_3755 | 281 |
| 285 | 3300048904 | Ga0496101_0014857 | Ga0496101_0014857_2315_3196 | 281 |
| 286 | 3300048905 | Ga0496102_0000120 | Ga0496102_0000120_42011_42877 | 281 |
| 287 | 3300048906 | Ga0496103_0000154 | Ga0496103_0000154_35656_36522 | 281 |
| 288 | 3300048906 | Ga0496103_0053602 | Ga0496103_0053602_1129_2010 | 281 |
| 289 | 3300048906 | Ga0496103_0083447 | Ga0496103_0083447_1050_1937 | 281 |
| 290 | 3300048907 | Ga0496104_0115375 | Ga0496104_0115375_117_1004 | 281 |
| 291 | 3300048909 | Ga0496106_0076676 | Ga0496106_0076676_802_1689 | 281 |
| 292 | 3300048912 | Ga0496109_0148176 | Ga0496109_0148176_138_1025 | 281 |
| 293 | 3300048913 | Ga0496110_0196591 | Ga0496110_0196591_657_1544 | 281 |
| 294 | 3300048915 | Ga0496112_0048211 | Ga0496112_0048211_41_928 | 281 |
| 295 | 3300048915 | Ga0496112_0150419 | Ga0496112_0150419_1264_2151 | 281 |
| 296 | 3300048916 | Ga0496113_0051952 | Ga0496113_0051952_1301_2188 | 281 |
| 297 | 3300048919 | Ga0496116_0001774 | Ga0496116_0001774_446_1312 | 281 |
| 298 | 3300048920 | Ga0496117_0000317 | Ga0496117_0000317_41859_42725 | 281 |
| 299 | 3300048920 | Ga0496117_0011540 | Ga0496117_0011540_155_1036 | 281 |
| 300 | 3300048921 | Ga0496118_0000303 | Ga0496118_0000303_41863_42729 | 281 |
| 301 | 3300048921 | Ga0496118_0005472 | Ga0496118_0005472_5963_6844 | 281 |
| 302 | 3300048922 | Ga0496119_0140203 | Ga0496119_0140203_284_1150 | 281 |
| 303 | 3300048927 | Ga0496124_0000214 | Ga0496124_0000214_69556_70422 | 281 |
| 304 | 3300049571 | Ga0501034_0036229 | Ga0501034_0036229_78_953 | 281 |
| 305 | 3300049585 | Ga0501069_0222786 | Ga0501069_0222786_169_1053 | 281 |
| 306 | 3300049663 | Ga0501223_000771 | Ga0501223_000771_2144_3019 | 281 |
| 307 | 3300049664 | Ga0501224_000008 | Ga0501224_000008_70935_71810 | 281 |
| 308 | 3300049668 | Ga0501233_000405 | Ga0501233_000405_4882_5757 | 281 |
| 309 | 3300049669 | Ga0501235_010625 | Ga0501235_010625_752_1627 | 281 |
| 310 | 3300049705 | Ga0501225_0000073 | Ga0501225_0000073_1300_2175 | 281 |
| 311 | 3300049853 | Ga0501226_000253 | Ga0501226_000253_5104_5979 | 281 |
| 312 | 3300050511 | nmdc:mga08y16_199341_c1 | nmdc:mga08y16_199341_c1_111_998 | 281 |
| 313 | 3300053103 | Ga0500555_002967 | Ga0500555_002967_144_1022 | 281 |
| 314 | iso_pu_bacteria | 2599185354 | 2600203460 | 281 |
| 315 | iso_pu_bacteria | 2643221622 | 2644127519 | 281 |
| 316 | iso_pu_bacteria | 2751185897 | 2753765741 | 281 |
| 317 | 3300001904 | JGI24736J21556_1000531 | JGI24736J21556_10005316 | 282 |
| 318 | 3300001915 | JGI24741J21665_1000370 | JGI24741J21665_100037012 | 282 |
| 319 | 3300001976 | JGI24752J21851_1000438 | JGI24752J21851_10004385 | 282 |
| 320 | 3300001979 | JGI24740J21852_10001695 | JGI24740J21852_1000169514 | 282 |
| 321 | 3300001989 | JGI24739J22299_10000305 | JGI24739J22299_100003056 | 282 |
| 322 | 3300001990 | JGI24737J22298_10001644 | JGI24737J22298_1000164410 | 282 |
| 323 | 3300002067 | JGI24735J21928_10000521 | JGI24735J21928_1000052111 | 282 |
| 324 | 3300002075 | JGI24738J21930_10002288 | JGI24738J21930_100022887 | 282 |
| 325 | 3300005289 | Ga0065704_10002707 | Ga0065704_100027072 | 282 |
| 326 | 3300005289 | Ga0065704_10025368 | Ga0065704_100253681 | 282 |
| 327 | 3300005295 | Ga0065707_10251029 | Ga0065707_102510291 | 282 |
| 328 | 3300005329 | Ga0070683_100337479 | Ga0070683_1003374792 | 282 |
| 329 | 3300005331 | Ga0070670_100012592 | Ga0070670_1000125926 | 282 |
| 330 | 3300005331 | Ga0070670_100166003 | Ga0070670_1001660031 | 282 |
| 331 | 3300005335 | Ga0070666_10017078 | Ga0070666_100170784 | 282 |
| 332 | 3300005347 | Ga0070668_100006800 | Ga0070668_1000068002 | 282 |
| 333 | 3300005347 | Ga0070668_100029286 | Ga0070668_1000292862 | 282 |
| 334 | 3300005353 | Ga0070669_100000024 | Ga0070669_10000002494 | 282 |
| 335 | 3300005353 | Ga0070669_100173795 | Ga0070669_1001737952 | 282 |
| 336 | 3300005353 | Ga0070669_100245611 | Ga0070669_1002456112 | 282 |
| 337 | 3300005355 | Ga0070671_100000006 | Ga0070671_100000006160 | 282 |
| 338 | 3300005366 | Ga0070659_100006160 | Ga0070659_1000061603 | 282 |
| 339 | 3300005445 | Ga0070708_100095776 | Ga0070708_1000957762 | 282 |
| 340 | 3300005455 | Ga0070663_100001832 | Ga0070663_1000018322 | 282 |
| 341 | 3300005535 | Ga0070684_100240461 | Ga0070684_1002404612 | 282 |
| 342 | 3300005548 | Ga0070665_100011783 | Ga0070665_1000117834 | 282 |
| 343 | 3300005563 | Ga0068855_100252785 | Ga0068855_1002527852 | 282 |
| 344 | 3300005614 | Ga0068856_100110616 | Ga0068856_1001106162 | 282 |
| 345 | 3300005617 | Ga0068859_100003041 | Ga0068859_10000304114 | 282 |
| 346 | 3300005618 | Ga0068864_100016069 | Ga0068864_1000160692 | 282 |
| 347 | 3300005618 | Ga0068864_100095921 | Ga0068864_1000959213 | 282 |
| 348 | 3300005719 | Ga0068861_100036893 | Ga0068861_1000368932 | 282 |
| 349 | 3300005842 | Ga0068858_100007175 | Ga0068858_10000717512 | 282 |
| 350 | 3300005844 | Ga0068862_100000307 | Ga0068862_10000030740 | 282 |
| 351 | 3300006042 | Ga0075368_10005408 | Ga0075368_100054086 | 282 |
| 352 | 3300006048 | Ga0075363_100025008 | Ga0075363_1000250083 | 282 |
| 353 | 3300006178 | Ga0075367_10000211 | Ga0075367_1000021112 | 282 |
| 354 | 3300006353 | Ga0075370_10026573 | Ga0075370_100265733 | 282 |
| 355 | 3300006931 | Ga0097620_100003041 | Ga0097620_10000304114 | 282 |
| 356 | 3300009011 | Ga0105251_10066438 | Ga0105251_100664382 | 282 |
| 357 | 3300009101 | Ga0105247_10002315 | Ga0105247_100023152 | 282 |
| 358 | 3300009147 | Ga0114129_10366816 | Ga0114129_103668162 | 282 |
| 359 | 3300009174 | Ga0105241_10003279 | Ga0105241_1000327915 | 282 |
| 360 | 3300009545 | Ga0105237_10019458 | Ga0105237_100194586 | 282 |
| 361 | 3300009553 | Ga0105249_10004653 | Ga0105249_100046537 | 282 |
| 362 | 3300009553 | Ga0105249_10028001 | Ga0105249_100280016 | 282 |
| 363 | 3300009978 | Ga0105148_100172 | Ga0105148_1001727 | 282 |
| 364 | 3300009982 | Ga0105147_102132 | Ga0105147_1021322 | 282 |
| 365 | 3300013105 | Ga0157369_10292626 | Ga0157369_102926262 | 282 |
| 366 | 3300013306 | Ga0163162_10030528 | Ga0163162_100305282 | 282 |
| 367 | 3300014325 | Ga0163163_10007130 | Ga0163163_100071306 | 282 |
| 368 | 3300014326 | Ga0157380_10031783 | Ga0157380_100317832 | 282 |
| 369 | 3300014968 | Ga0157379_10479202 | Ga0157379_104792021 | 282 |
| 370 | 3300020070 | Ga0206356_10366199 | Ga0206356_103661992 | 282 |
| 371 | 3300025315 | Ga0207697_10000244 | Ga0207697_1000024427 | 282 |
| 372 | 3300025735 | Ga0207713_1051017 | Ga0207713_10510172 | 282 |
| 373 | 3300025900 | Ga0207710_10045602 | Ga0207710_100456022 | 282 |
| 374 | 3300025903 | Ga0207680_10003253 | Ga0207680_100032533 | 282 |
| 375 | 3300025904 | Ga0207647_10004140 | Ga0207647_100041406 | 282 |
| 376 | 3300025911 | Ga0207654_10051500 | Ga0207654_100515002 | 282 |
| 377 | 3300025923 | Ga0207681_10000004 | Ga0207681_10000004269 | 282 |
| 378 | 3300025923 | Ga0207681_10159756 | Ga0207681_101597562 | 282 |
| 379 | 3300025923 | Ga0207681_10170243 | Ga0207681_101702432 | 282 |
| 380 | 3300025923 | Ga0207681_10196795 | Ga0207681_101967952 | 282 |
| 381 | 3300025924 | Ga0207694_10066645 | Ga0207694_100666451 | 282 |
| 382 | 3300025925 | Ga0207650_10007038 | Ga0207650_100070383 | 282 |
| 383 | 3300025931 | Ga0207644_10000009 | Ga0207644_1000000991 | 282 |
| 384 | 3300025933 | Ga0207706_10016282 | Ga0207706_100162829 | 282 |
| 385 | 3300025941 | Ga0207711_10249496 | Ga0207711_102494962 | 282 |
| 386 | 3300025949 | Ga0207667_10401687 | Ga0207667_104016872 | 282 |
| 387 | 3300025961 | Ga0207712_10009154 | Ga0207712_100091546 | 282 |
| 388 | 3300025961 | Ga0207712_10142670 | Ga0207712_101426702 | 282 |
| 389 | 3300025972 | Ga0207668_10007606 | Ga0207668_100076063 | 282 |
| 390 | 3300025972 | Ga0207668_10045105 | Ga0207668_100451051 | 282 |
| 391 | 3300025981 | Ga0207640_10157678 | Ga0207640_101576781 | 282 |
| 392 | 3300025986 | Ga0207658_10058638 | Ga0207658_100586382 | 282 |
| 393 | 3300026035 | Ga0207703_10013558 | Ga0207703_100135585 | 282 |
| 394 | 3300026041 | Ga0207639_10008050 | Ga0207639_100080508 | 282 |
| 395 | 3300026067 | Ga0207678_10004677 | Ga0207678_1000467714 | 282 |
| 396 | 3300026078 | Ga0207702_10007166 | Ga0207702_100071666 | 282 |
| 397 | 3300026088 | Ga0207641_10011086 | Ga0207641_100110866 | 282 |
| 398 | 3300026095 | Ga0207676_10001996 | Ga0207676_100019968 | 282 |
| 399 | 3300026095 | Ga0207676_10271014 | Ga0207676_102710142 | 282 |
| 400 | 3300026116 | Ga0207674_10010279 | Ga0207674_100102796 | 282 |
| 401 | 3300026118 | Ga0207675_100000199 | Ga0207675_10000019910 | 282 |
| 402 | 3300026142 | Ga0207698_10048304 | Ga0207698_100483042 | 282 |
| 403 | 3300027866 | Ga0209813_10000033 | Ga0209813_1000003325 | 282 |
| 404 | 3300028379 | Ga0268266_10078423 | Ga0268266_100784232 | 282 |
| 405 | 3300028379 | Ga0268266_10090953 | Ga0268266_100909533 | 282 |
| 406 | 3300028380 | Ga0268265_10000109 | Ga0268265_1000010988 | 282 |
| 407 | 3300028381 | Ga0268264_10000069 | Ga0268264_10000069155 | 282 |
| 408 | 3300031548 | Ga0307408_100151228 | Ga0307408_1001512281 | 282 |
| 409 | 3300031824 | Ga0307413_10070759 | Ga0307413_100707592 | 282 |
| 410 | 3300031911 | Ga0307412_10012191 | Ga0307412_100121912 | 282 |
| 411 | 3300032002 | Ga0307416_100112519 | Ga0307416_1001125192 | 282 |
| 412 | 3300032004 | Ga0307414_10050750 | Ga0307414_100507501 | 282 |
| 413 | 3300032004 | Ga0307414_10128864 | Ga0307414_101288642 | 282 |
| 414 | 3300046452 | Ga0495617_013296 | Ga0495617_013296_40_957 | 282 |
| 415 | 3300046453 | Ga0495627_000456 | Ga0495627_000456_20695_21612 | 282 |
| 416 | 3300046491 | Ga0495584_0006076 | Ga0495584_0006076_1690_2619 | 282 |
| 417 | 3300046512 | Ga0495610_0000166 | Ga0495610_0000166_65909_66826 | 282 |
| 418 | 3300046519 | Ga0495632_0000149 | Ga0495632_0000149_2440_3369 | 282 |
| 419 | 3300046520 | Ga0495637_0000292 | Ga0495637_0000292_7823_8752 | 282 |
| 420 | 3300046522 | Ga0495643_0000046 | Ga0495643_0000046_7823_8752 | 282 |
| 421 | 3300046524 | Ga0495648_0016092 | Ga0495648_0016092_2081_2983 | 282 |
| 422 | 3300046525 | Ga0495663_0000027 | Ga0495663_0000027_2440_3369 | 282 |
| 423 | 3300046558 | Ga0495633_0000054 | Ga0495633_0000054_28486_29421 | 282 |
| 424 | 3300046558 | Ga0495633_0001284 | Ga0495633_0001284_2440_3369 | 282 |
| 425 | 3300046665 | Ga0495661_0006154 | Ga0495661_0006154_2306_3223 | 282 |
| 426 | 3300046691 | Ga0495670_0035367 | Ga0495670_0035367_933_1796 | 282 |
| 427 | 3300046692 | Ga0495671_0000029 | Ga0495671_0000029_212161_213090 | 282 |
| 428 | 3300047470 | Ga0495681_0000056 | Ga0495681_0000056_57529_58446 | 282 |
| 429 | 3300047470 | Ga0495681_0006476 | Ga0495681_0006476_3009_3938 | 282 |
| 430 | 3300047472 | Ga0495686_0029903 | Ga0495686_0029903_1787_2716 | 282 |
| 431 | 3300048911 | Ga0496108_0001130 | Ga0496108_0001130_13389_14354 | 282 |
| 432 | 3300048911 | Ga0496108_0042420 | Ga0496108_0042420_162_1064 | 282 |
| 433 | 3300048912 | Ga0496109_0249737 | Ga0496109_0249737_166_1068 | 282 |
| 434 | 3300048913 | Ga0496110_0160344 | Ga0496110_0160344_915_1880 | 282 |
| 435 | 3300048913 | Ga0496110_0206728 | Ga0496110_0206728_553_1455 | 282 |
| 436 | 3300048914 | Ga0496111_0159798 | Ga0496111_0159798_624_1526 | 282 |
| 437 | 3300048919 | Ga0496116_0146955 | Ga0496116_0146955_170_1135 | 282 |
| 438 | 3300048924 | Ga0496121_0000472 | Ga0496121_0000472_64127_65077 | 282 |
| 439 | 3300048924 | Ga0496121_0086591 | Ga0496121_0086591_165_1139 | 282 |
| 440 | 3300048925 | Ga0496122_0020196 | Ga0496122_0020196_4541_5515 | 282 |
| 441 | 3300048925 | Ga0496122_0097549 | Ga0496122_0097549_138_1067 | 282 |
| 442 | 3300048927 | Ga0496124_0005716 | Ga0496124_0005716_3017_3991 | 282 |
| 443 | 3300048927 | Ga0496124_0151865 | Ga0496124_0151865_295_1197 | 282 |
| 444 | 3300048928 | Ga0496125_0016918 | Ga0496125_0016918_2779_3744 | 282 |
| 445 | 3300048928 | Ga0496125_0017281 | Ga0496125_0017281_762_1706 | 282 |
| 446 | 3300048928 | Ga0496125_0098026 | Ga0496125_0098026_831_1733 | 282 |
| 447 | 3300048929 | Ga0496126_0008754 | Ga0496126_0008754_5091_6056 | 282 |
| 448 | 3300049459 | Ga0495678_005174 | Ga0495678_005174_4460_5377 | 282 |
| 449 | 3300049574 | Ga0501038_0056925 | Ga0501038_0056925_1667_2566 | 282 |
| 450 | 3300049658 | Ga0501211_001806 | Ga0501211_001806_84_992 | 282 |
| 451 | 3300049663 | Ga0501223_000028 | Ga0501223_000028_31551_32471 | 282 |
| 452 | 3300049676 | Ga0501246_006459 | Ga0501246_006459_30_950 | 282 |
| 453 | 3300049705 | Ga0501225_0000067 | Ga0501225_0000067_21368_22288 | 282 |
| 454 | 3300049705 | Ga0501225_0001910 | Ga0501225_0001910_1643_2545 | 282 |
| 455 | 3300050490 | nmdc:mga03n38_16925_c1 | nmdc:mga03n38_16925_c1_20_940 | 282 |
| 456 | 3300050494 | nmdc:mga06z11_67_c1 | nmdc:mga06z11_67_c1_20555_21475 | 282 |
| 457 | 3300050495 | nmdc:mga04h51_55_c1 | nmdc:mga04h51_55_c1_21327_22247 | 282 |
| 458 | 3300050496 | nmdc:mga07m45_126696_c1 | nmdc:mga07m45_126696_c1_422_1342 | 282 |
| 459 | 3300050507 | nmdc:mga05p37_315121_c1 | nmdc:mga05p37_315121_c1_625_1545 | 282 |
| 460 | iso_pu_bacteria | 2512564014 | 2512642262 | 282 |
| 461 | iso_pu_bacteria | 2775507255 | 2778125676 | 282 |
| 462 | iso_pu_bacteria | 2808606401 | 2809065311 | 282 |
| 463 | iso_pu_bacteria | 2808606404 | 2809081297 | 282 |
| 464 | iso_pu_bacteria | 2808606405 | 2809085662 | 282 |
| 465 | iso_pu_bacteria | 2830075706 | 2830078465 | 282 |
| 466 | iso_pu_bacteria | 2880518877 | 2880520845 | 282 |
| 467 | iso_pu_bacteria | 2919709256 | 2919711179 | 282 |
| 468 | 3300002774 | JGI25150J39212_1000130 | JGI25150J39212_100013030 | 283 |
| 469 | 3300003187 | JGI25151J46595_10053766 | JGI25151J46595_100537662 | 283 |
| 470 | 3300003215 | JGI25153J46596_10000032 | JGI25153J46596_1000003229 | 283 |
| 471 | 3300003215 | JGI25153J46596_10016824 | JGI25153J46596_100168243 | 283 |
| 472 | 3300003771 | Ga0055526_1013391 | Ga0055526_10133914 | 283 |
| 473 | 3300003773 | Ga0055537_1001101 | Ga0055537_10011016 | 283 |
| 474 | 3300003775 | Ga0055524_1000670 | Ga0055524_10006705 | 283 |
| 475 | 3300003781 | Ga0055536_1010462 | Ga0055536_10104625 | 283 |
| 476 | 3300003791 | Ga0055530_10001355 | Ga0055530_1000135511 | 283 |
| 477 | 3300003792 | Ga0055540_1002776 | Ga0055540_10027769 | 283 |
| 478 | 3300003794 | Ga0055531_10000718 | Ga0055531_100007188 | 283 |
| 479 | 3300003794 | Ga0055531_10020966 | Ga0055531_100209662 | 283 |
| 480 | 3300005262 | Ga0065165_1002607 | Ga0065165_10026079 | 283 |
| 481 | 3300005262 | Ga0065165_1006173 | Ga0065165_10061736 | 283 |
| 482 | 3300005262 | Ga0065165_1010897 | Ga0065165_10108972 | 283 |
| 483 | 3300005530 | Ga0070679_100216191 | Ga0070679_1002161912 | 283 |
| 484 | 3300005539 | Ga0068853_100033763 | Ga0068853_1000337633 | 283 |
| 485 | 3300005842 | Ga0068858_100000093 | Ga0068858_1000000936 | 283 |
| 486 | 3300009098 | Ga0105245_10008819 | Ga0105245_100088197 | 283 |
| 487 | 3300009148 | Ga0105243_10078071 | Ga0105243_100780712 | 283 |
| 488 | 3300009551 | Ga0105238_10055572 | Ga0105238_100555723 | 283 |
| 489 | 3300025229 | Ga0209147_103284 | Ga0209147_1032843 | 283 |
| 490 | 3300025245 | Ga0207425_1000025 | Ga0207425_1000025113 | 283 |
| 491 | 3300025245 | Ga0207425_1005597 | Ga0207425_10055972 | 283 |
| 492 | 3300025258 | Ga0209129_1000887 | Ga0209129_10008874 | 283 |
| 493 | 3300025261 | Ga0209233_1000140 | Ga0209233_1000140161 | 283 |
| 494 | 3300025263 | Ga0209565_1000029 | Ga0209565_1000029297 | 283 |
| 495 | 3300025263 | Ga0209565_1000220 | Ga0209565_100022027 | 283 |
| 496 | 3300025272 | Ga0209455_1013632 | Ga0209455_10136322 | 283 |
| 497 | 3300025273 | Ga0209673_1000889 | Ga0209673_100088910 | 283 |
| 498 | 3300025273 | Ga0209673_1013952 | Ga0209673_10139525 | 283 |
| 499 | 3300025291 | Ga0209675_1016052 | Ga0209675_10160522 | 283 |
| 500 | 3300025292 | Ga0209676_1005827 | Ga0209676_10058277 | 283 |
| 501 | 3300025294 | Ga0209025_1000176 | Ga0209025_1000176130 | 283 |
| 502 | 3300025295 | Ga0209564_1002011 | Ga0209564_10020113 | 283 |
| 503 | 3300025295 | Ga0209564_1023265 | Ga0209564_10232652 | 283 |
| 504 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002197 | 283 |
| 505 | 3300025297 | Ga0209758_1000108 | Ga0209758_100010820 | 283 |
| 506 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001109 | 283 |
| 507 | 3300025298 | Ga0209050_1000131 | Ga0209050_1000131157 | 283 |
| 508 | 3300025298 | Ga0209050_1003561 | Ga0209050_10035617 | 283 |
| 509 | 3300025298 | Ga0209050_1014376 | Ga0209050_10143763 | 283 |
| 510 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008905 | 283 |
| 511 | 3300025303 | Ga0209051_1000405 | Ga0209051_100040528 | 283 |
| 512 | 3300025304 | Ga0209257_1000028 | Ga0209257_1000028523 | 283 |
| 513 | 3300025304 | Ga0209257_1003282 | Ga0209257_10032827 | 283 |
| 514 | 3300025927 | Ga0207687_10051938 | Ga0207687_100519382 | 283 |
| 515 | 3300025935 | Ga0207709_10214487 | Ga0207709_102144872 | 283 |
| 516 | 3300026035 | Ga0207703_10000784 | Ga0207703_1000078424 | 283 |
| 517 | 3300031616 | Ga0307508_10005943 | Ga0307508_100059434 | 283 |
| 518 | 3300031911 | Ga0307412_10031646 | Ga0307412_100316462 | 283 |
| 519 | 3300041404 | Ga0439436_0041458 | Ga0439436_0041458_98_967 | 283 |
| 520 | 3300041406 | Ga0439439_0016324 | Ga0439439_0016324_221_1084 | 283 |
| 521 | 3300041410 | Ga0439461_0000006 | Ga0439461_0000006_20403_21272 | 283 |
| 522 | 3300041411 | Ga0439466_0050944 | Ga0439466_0050944_433_1302 | 283 |
| 523 | 3300041413 | Ga0439465_0000283 | Ga0439465_0000283_12790_13656 | 283 |
| 524 | 3300041413 | Ga0439465_0000716 | Ga0439465_0000716_4265_5134 | 283 |
| 525 | 3300041997 | Ga0439431_0002911 | Ga0439431_0002911_2039_2908 | 283 |
| 526 | 3300041997 | Ga0439431_0021263 | Ga0439431_0021263_222_1085 | 283 |
| 527 | 3300042004 | Ga0439445_0001744 | Ga0439445_0001744_2788_3657 | 283 |
| 528 | 3300042004 | Ga0439445_0006815 | Ga0439445_0006815_262_1125 | 283 |
| 529 | 3300042006 | Ga0439432_000186 | Ga0439432_000186_5651_6520 | 283 |
| 530 | 3300042010 | Ga0439452_019604 | Ga0439452_019604_104_967 | 283 |
| 531 | 3300042015 | Ga0439462_0000463 | Ga0439462_0000463_3366_4235 | 283 |
| 532 | 3300042015 | Ga0439462_0015779 | Ga0439462_0015779_618_1481 | 283 |
| 533 | 3300042156 | Ga0439446_0039917 | Ga0439446_0039917_467_1336 | 283 |
| 534 | 3300042435 | Ga0439434_0000590 | Ga0439434_0000590_4287_5156 | 283 |
| 535 | 3300046460 | Ga0495638_0000365 | Ga0495638_0000365_16197_17063 | 283 |
| 536 | 3300046513 | Ga0495616_0000208 | Ga0495616_0000208_40470_41357 | 283 |
| 537 | 3300046525 | Ga0495663_0017765 | Ga0495663_0017765_181_1047 | 283 |
| 538 | 3300046525 | Ga0495663_0033315 | Ga0495663_0033315_551_1417 | 283 |
| 539 | 3300046616 | Ga0495668_0001884 | Ga0495668_0001884_13146_14033 | 283 |
| 540 | 3300046660 | Ga0495625_0000309 | Ga0495625_0000309_67094_67960 | 283 |
| 541 | 3300046660 | Ga0495625_0148704 | Ga0495625_0148704_284_1150 | 283 |
| 542 | 3300046691 | Ga0495670_0000023 | Ga0495670_0000023_40735_41604 | 283 |
| 543 | 3300046691 | Ga0495670_0102004 | Ga0495670_0102004_97_960 | 283 |
| 544 | 3300047472 | Ga0495686_0004235 | Ga0495686_0004235_107_973 | 283 |
| 545 | 3300047472 | Ga0495686_0117898 | Ga0495686_0117898_149_1039 | 283 |
| 546 | 3300048918 | Ga0496115_0000299 | Ga0496115_0000299_29404_30282 | 283 |
| 547 | 3300053087 | Ga0500643_001338 | Ga0500643_001338_10703_11569 | 283 |
| 548 | 3300053094 | Ga0500566_0001470 | Ga0500566_0001470_5256_6125 | 283 |
| 549 | 3300053096 | Ga0500641_0023307 | Ga0500641_0023307_1325_2194 | 283 |
| 550 | 3300053096 | Ga0500641_0051728 | Ga0500641_0051728_229_1095 | 283 |
| 551 | 3300053103 | Ga0500555_012302 | Ga0500555_012302_489_1355 | 283 |
| 552 | 3300053104 | Ga0500556_0019253 | Ga0500556_0019253_416_1285 | 283 |
| 553 | 3300053119 | Ga0500595_001625 | Ga0500595_001625_2592_3461 | 283 |
| 554 | 3300053134 | Ga0500658_0000412 | Ga0500658_0000412_9104_9970 | 283 |
| 555 | 3300053134 | Ga0500658_0002799 | Ga0500658_0002799_4020_4883 | 283 |
| 556 | 3300053136 | Ga0500559_0023273 | Ga0500559_0023273_509_1393 | 283 |
| 557 | 3300053139 | Ga0500568_0015865 | Ga0500568_0015865_1070_1936 | 283 |
| 558 | 3300053139 | Ga0500568_0051411 | Ga0500568_0051411_578_1444 | 283 |
| 559 | 3300053140 | Ga0500573_0003254 | Ga0500573_0003254_5742_6614 | 283 |
| 560 | 3300053140 | Ga0500573_0070635 | Ga0500573_0070635_539_1408 | 283 |
| 561 | 3300053151 | Ga0500604_0010062 | Ga0500604_0010062_1050_1937 | 283 |
| 562 | 3300053153 | Ga0500616_0038718 | Ga0500616_0038718_1022_1888 | 283 |
| 563 | 3300053158 | Ga0500627_0016641 | Ga0500627_0016641_458_1345 | 283 |
| 564 | 3300053730 | Ga0500645_004182 | Ga0500645_004182_3708_4580 | 283 |
| 565 | iso_pu_bacteria | 2895880812 | 2895885979 | 283 |
| 566 | 3300009148 | Ga0105243_10420804 | Ga0105243_104208041 | 284 |
| 567 | 3300013297 | Ga0157378_10073368 | Ga0157378_100733683 | 284 |
| 568 | 3300028786 | Ga0307517_10007999 | Ga0307517_100079999 | 284 |
| 569 | 3300029957 | Ga0265324_10002449 | Ga0265324_100024498 | 284 |
| 570 | 3300031239 | Ga0265328_10015231 | Ga0265328_100152312 | 284 |
| 571 | 3300031250 | Ga0265331_10000170 | Ga0265331_100001709 | 284 |
| 572 | 3300031456 | Ga0307513_10161421 | Ga0307513_101614212 | 284 |
| 573 | 3300031548 | Ga0307408_100028851 | Ga0307408_1000288515 | 284 |
| 574 | 3300031852 | Ga0307410_10106345 | Ga0307410_101063452 | 284 |
| 575 | 3300031901 | Ga0307406_10022655 | Ga0307406_100226553 | 284 |
| 576 | 3300031911 | Ga0307412_10029017 | Ga0307412_100290173 | 284 |
| 577 | 3300032002 | Ga0307416_100026279 | Ga0307416_1000262792 | 284 |
| 578 | 3300039437 | Ga0436365_1348585 | Ga0436365_1348585_87_959 | 284 |
| 579 | 3300044684 | Ga0466966_0005088 | Ga0466966_0005088_1772_2692 | 284 |
| 580 | 3300044693 | Ga0466961_0003783 | Ga0466961_0003783_7430_8350 | 284 |
| 581 | 3300046471 | Ga0495650_0052117 | Ga0495650_0052117_445_1317 | 284 |
| 582 | 3300047472 | Ga0495686_0000209 | Ga0495686_0000209_5363_6238 | 284 |
| 583 | 3300053087 | Ga0500643_000762 | Ga0500643_000762_5494_6384 | 284 |
| 584 | 3300053136 | Ga0500559_0003970 | Ga0500559_0003970_1683_2573 | 284 |
| 585 | 3300055283 | Ga0500661_001278 | Ga0500661_001278_3365_4255 | 284 |
| 586 | 3300031250 | Ga0265331_10018640 | Ga0265331_100186402 | 285 |
| 587 | 3300048928 | Ga0496125_0138856 | Ga0496125_0138856_293_1168 | 285 |
| 588 | 3300049513 | Ga0501290_000344 | Ga0501290_000344_2214_3098 | 285 |
| 589 | 3300049515 | Ga0501292_000096 | Ga0501292_000096_10303_11187 | 285 |
| 590 | 3300049517 | Ga0501294_000264 | Ga0501294_000264_3775_4659 | 285 |
| 591 | 3300049523 | Ga0501300_006959 | Ga0501300_006959_114_998 | 285 |
| 592 | 3300049524 | Ga0501301_000295 | Ga0501301_000295_139_1023 | 285 |
| 593 | 3300049662 | Ga0501222_000612 | Ga0501222_000612_693_1577 | 285 |
| 594 | 3300049663 | Ga0501223_001119 | Ga0501223_001119_2644_3528 | 285 |
| 595 | 3300049669 | Ga0501235_007597 | Ga0501235_007597_1462_2346 | 285 |
| 596 | 3300049690 | Ga0501261_000197 | Ga0501261_000197_3468_4352 | 285 |
| 597 | 3300049705 | Ga0501225_0002096 | Ga0501225_0002096_4176_5060 | 285 |
| 598 | 3300049775 | Ga0501279_000051 | Ga0501279_000051_4251_5135 | 285 |
| 599 | 3300049776 | Ga0501280_000167 | Ga0501280_000167_11775_12659 | 285 |
| 600 | 3300049777 | Ga0501281_00129 | Ga0501281_00129_2832_3716 | 285 |
| 601 | 3300049778 | Ga0501282_000161 | Ga0501282_000161_4830_5714 | 285 |
| 602 | 3300053148 | Ga0500590_001908 | Ga0500590_001908_4369_5298 | 286 |
| 603 | 3300005331 | Ga0070670_100058982 | Ga0070670_1000589822 | 287 |
| 604 | 3300005335 | Ga0070666_10018375 | Ga0070666_100183752 | 287 |
| 605 | 3300005347 | Ga0070668_100000132 | Ga0070668_10000013216 | 287 |
| 606 | 3300005355 | Ga0070671_100001115 | Ga0070671_10000111511 | 287 |
| 607 | 3300005367 | Ga0070667_100000003 | Ga0070667_100000003371 | 287 |
| 608 | 3300005617 | Ga0068859_100126893 | Ga0068859_1001268932 | 287 |
| 609 | 3300005618 | Ga0068864_100004226 | Ga0068864_1000042264 | 287 |
| 610 | 3300005841 | Ga0068863_100019866 | Ga0068863_1000198667 | 287 |
| 611 | 3300005842 | Ga0068858_100000278 | Ga0068858_10000027835 | 287 |
| 612 | 3300005843 | Ga0068860_100000045 | Ga0068860_100000045140 | 287 |
| 613 | 3300005844 | Ga0068862_100001480 | Ga0068862_10000148016 | 287 |
| 614 | 3300006931 | Ga0097620_100126886 | Ga0097620_1001268862 | 287 |
| 615 | 3300025903 | Ga0207680_10006266 | Ga0207680_100062665 | 287 |
| 616 | 3300025923 | Ga0207681_10046875 | Ga0207681_100468752 | 287 |
| 617 | 3300025925 | Ga0207650_10002697 | Ga0207650_1000269713 | 287 |
| 618 | 3300025931 | Ga0207644_10000294 | Ga0207644_100002947 | 287 |
| 619 | 3300025972 | Ga0207668_10000030 | Ga0207668_1000003010 | 287 |
| 620 | 3300025986 | Ga0207658_10000002 | Ga0207658_100000021272 | 287 |
| 621 | 3300026035 | Ga0207703_10000587 | Ga0207703_100005872 | 287 |
| 622 | 3300026088 | Ga0207641_10000199 | Ga0207641_1000019959 | 287 |
| 623 | 3300026088 | Ga0207641_10004015 | Ga0207641_100040157 | 287 |
| 624 | 3300026095 | Ga0207676_10001170 | Ga0207676_100011705 | 287 |
| 625 | 3300026118 | Ga0207675_100300961 | Ga0207675_1003009611 | 287 |
| 626 | 3300028380 | Ga0268265_10006925 | Ga0268265_100069256 | 287 |
| 627 | 3300028381 | Ga0268264_10000101 | Ga0268264_10000101142 | 287 |
| 628 | 3300031548 | Ga0307408_100223808 | Ga0307408_1002238082 | 287 |
| 629 | 3300032004 | Ga0307414_10514055 | Ga0307414_105140551 | 287 |
| 630 | 3300045051 | Ga0451576_0000023 | Ga0451576_0000023_440188_441081 | 287 |
| 631 | 3300046524 | Ga0495648_0053969 | Ga0495648_0053969_1204_2088 | 287 |
| 632 | 3300048929 | Ga0496126_0182421 | Ga0496126_0182421_756_1640 | 287 |
| 633 | 3300053118 | Ga0500594_0005241 | Ga0500594_0005241_585_1469 | 287 |
| 634 | 3300048924 | Ga0496121_0000022 | Ga0496121_0000022_38479_39402 | 288 |
| 635 | 3300053125 | Ga0500618_013525 | Ga0500618_013525_1141_2043 | 288 |
| 636 | 3300006931 | Ga0097620_100309546 | Ga0097620_1003095462 | 289 |
| 637 | 3300005289 | Ga0065704_10000694 | Ga0065704_1000069410 | 290 |
| 638 | 3300005335 | Ga0070666_10093344 | Ga0070666_100933443 | 290 |
| 639 | 3300005347 | Ga0070668_100019204 | Ga0070668_1000192045 | 290 |
| 640 | 3300005347 | Ga0070668_100045423 | Ga0070668_1000454234 | 290 |
| 641 | 3300005355 | Ga0070671_100002834 | Ga0070671_10000283412 | 290 |
| 642 | 3300005367 | Ga0070667_100003291 | Ga0070667_1000032913 | 290 |
| 643 | 3300005843 | Ga0068860_100053602 | Ga0068860_1000536023 | 290 |
| 644 | 3300025711 | Ga0207696_1001087 | Ga0207696_10010877 | 290 |
| 645 | 3300025903 | Ga0207680_10136131 | Ga0207680_101361313 | 290 |
| 646 | 3300025931 | Ga0207644_10004595 | Ga0207644_100045957 | 290 |
| 647 | 3300025972 | Ga0207668_10052652 | Ga0207668_100526523 | 290 |
| 648 | 3300025986 | Ga0207658_10002362 | Ga0207658_100023623 | 290 |
| 649 | 3300028381 | Ga0268264_10016417 | Ga0268264_100164175 | 290 |
| 650 | 3300048903 | Ga0496100_0007768 | Ga0496100_0007768_4976_5899 | 290 |
| 651 | 3300048904 | Ga0496101_0060782 | Ga0496101_0060782_915_1838 | 290 |
| 652 | 3300048905 | Ga0496102_0000445 | Ga0496102_0000445_25208_26131 | 290 |
| 653 | 3300048906 | Ga0496103_0000021 | Ga0496103_0000021_56416_57339 | 290 |
| 654 | 3300048907 | Ga0496104_0000131 | Ga0496104_0000131_708_1631 | 290 |
| 655 | 3300048908 | Ga0496105_0038710 | Ga0496105_0038710_2308_3231 | 290 |
| 656 | 3300048916 | Ga0496113_0011647 | Ga0496113_0011647_3287_4210 | 290 |
| 657 | 3300048918 | Ga0496115_0302901 | Ga0496115_0302901_182_1105 | 290 |
| 658 | 3300048922 | Ga0496119_0000339 | Ga0496119_0000339_61758_62681 | 290 |
| 659 | 3300048927 | Ga0496124_0006240 | Ga0496124_0006240_11895_12818 | 290 |
| 660 | 3300048928 | Ga0496125_0002118 | Ga0496125_0002118_2708_3631 | 290 |
| 661 | 3300048929 | Ga0496126_0000367 | Ga0496126_0000367_25232_26155 | 290 |
| 662 | iso_pu_bacteria | 2738541275 | 2738711629 | 290 |
| 663 | iso_pu_bacteria | 2738541301 | 2738850054 | 290 |
| 664 | iso_pu_bacteria | 2738541304 | 2738865783 | 290 |
| 665 | iso_pu_bacteria | 2738543022 | 2739298301 | 290 |
| 666 | iso_pu_bacteria | 2738543033 | 2739359979 | 290 |
| 667 | iso_pu_bacteria | 2928100450 | 2928103782 | 290 |
| 668 | iso_pu_bacteria | 2928959182 | 2928961710 | 290 |
| 669 | 3300006051 | Ga0075364_10019953 | Ga0075364_100199535 | 291 |
| 670 | 3300006195 | Ga0075366_10008576 | Ga0075366_100085762 | 291 |
| 671 | 3300006353 | Ga0075370_10173966 | Ga0075370_101739661 | 291 |
| 672 | 3300031251 | Ga0265327_10086868 | Ga0265327_100868682 | 291 |
| 673 | 3300050491 | nmdc:mga00v17_16355_c1 | nmdc:mga00v17_16355_c1_3162_4052 | 291 |
| 674 | 3300050496 | nmdc:mga07m45_23256_c1 | nmdc:mga07m45_23256_c1_702_1601 | 292 |
| 675 | 3300053108 | Ga0500562_026682 | Ga0500562_026682_275_1174 | 292 |
| 676 | 3300053121 | Ga0500607_000107 | Ga0500607_000107_22058_22957 | 292 |
| 677 | 3300053136 | Ga0500559_0001127 | Ga0500559_0001127_5887_6786 | 292 |
| 678 | 3300053148 | Ga0500590_055279 | Ga0500590_055279_581_1480 | 292 |
| 679 | 3300053178 | Ga0500637_0015759 | Ga0500637_0015759_640_1539 | 292 |
| 680 | 3300053730 | Ga0500645_024806 | Ga0500645_024806_493_1392 | 292 |
| 681 | 3300053116 | Ga0500592_019037 | Ga0500592_019037_107_1003 | 293 |
| 682 | 2162886007 | SwRhRL2b_contig_1799459 | SwRhRL2b_0524.00003070 | 294 |
| 683 | 3300005289 | Ga0065704_10000204 | Ga0065704_10000204199 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ypf-assembly1.cif.gz_A | nudix1 hydrolase from rosa x hybrida in complex with geranyl pyrophosphate | 0.8838 | 155 | 255 |
| 3oga-assembly1.cif.gz_B | 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 | 0.8689 | 154 | 260 |
| 6scx-assembly2.cif.gz_C-2 | crystal structure of the catalytic domain of human nudt12 in complex with 7-methyl-guanosine-5'-triphosphate | 0.8626 | 2 | 293 |
| 6o3p-assembly1.cif.gz_A | crystal structure of the catalytic domain of mouse nudt12 in complex with amp and 3 mg2+ ions | 0.8583 | 7 | 292 |
| 5wy6-assembly1.cif.gz_A | crystal structure of atnudx1 (e56a) | 0.8578 | 154 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4ISD4_291_431_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9523 | 154 | 292 | 3.90.79.10 |
| af_I1MUA9_246_385_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9336 | 154 | 269 | 3.90.79.10 |
| af_A4I7A0_174_307_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9281 | 154 | 291 | 3.90.79.10 |
| af_Q19427_210_368_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9258 | 156 | 293 | 3.90.79.10 |
| 2gb5A02 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.925 | 154 | 293 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519QTM4-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.9863 | 1 | 294 |
GO:0000210
GO:0005829 GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 GO:0110153 |
| AF-A0A519QTM4-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.983 | 1 | 294 |
GO:0000210
GO:0005829 GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 GO:0110153 |
| AF-A0A838MLF2-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.9733 | 1 | 294 |
GO:0005777
GO:0005829 GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 |
| AF-A0A537NUV8-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.9726 | 114 | 292 |
GO:0000210
GO:0005829 GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 GO:0110153 |
| AF-A0A5N9CJR5-F1-model_v4 | NAD(+) diphosphatase (EC 3.6.1.22) | 0.9671 | 135 | 294 |
GO:0000210
GO:0005777 GO:0005829 GO:0006734 GO:0006742 GO:0019677 GO:0035529 GO:0046872 GO:0110153 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar