F474962

General Info

Members Datasets Scaffolds Average Seq Length
683 353 657 294

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100033763|Ga0068853_1000337633
Length 345
Sequence VRVVRGVSAPGFTGGTLDRADPLRSDVEKLAAAMADPRARLLRLVRLEPELGEDDRLIWDSLAAAPEGGELVLLGLDAEGVPHFAAANPEEAIVTGRAFTIFRILERLHPEDAAHFAAARSVVDWHMRHRFCAVCGARTEPFRAGWGRKCHNCSAEHFPRVDPVVIMLAEFGDKVLLGRGPGWPPGRYSALAGFLEPGESLEEAVARETFEEAGVRVRDVRYIASQPWPFPSSLMIAAIGVADDDTLVIDTNELEDAIWVTRDEVRAVMAGEPGPFLPPPPYAIAFTLLNAWAEESEDRLDAWYDGSAVCVIAAGRQGDPLDLGEHEVAAFVAKLQGALGEAERG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
4 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
5 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
6 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
7 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
8 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
9 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
10 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
11 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
12 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
13 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
14 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
15 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
16 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
17 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
18 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
19 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
20 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
21 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
22 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
23 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
24 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
25 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
26 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
27 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
28 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
29 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
30 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
31 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
34 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
35 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
36 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
37 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
38 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
55 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
56 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
57 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
58 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
59 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
67 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
68 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
69 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
76 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
101 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
119 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
132 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
193 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
199 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
200 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
222 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
223 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
224 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
229 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
230 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
231 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
234 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
235 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
246 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
254 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
255 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
303 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
304 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
305 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
306 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
311 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
312 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
313 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
314 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
315 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
316 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
317 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
318 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
319 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
320 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
321 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
322 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
323 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
329 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
330 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
335 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
336 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
337 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
338 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
339 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
342 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
343 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
347 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
348 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
349 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
350 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
351 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
352 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
353 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 0.15
Isolates 3.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.73
Bulb 0
Endosphere 12.74
Nodule 0
Rhizoplane 8.35
Rhizosphere 70.13
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1799459 2162886007 Bacteria 6890
2 JGI24736J21556_1000531 3300001904 Bacteria 7114
3 JGI24741J21665_1000370 3300001915 Bacteria 13453
4 JGI24752J21851_1000438 3300001976 Bacteria 5633
5 JGI24752J21851_1000853 3300001976 Bacteria 4135
6 JGI24740J21852_10001695 3300001979 Bacteria 10106
7 JGI24739J22299_10000305 3300001989 Bacteria 16682
8 JGI24737J22298_10000985 3300001990 Bacteria 10121
9 JGI24737J22298_10001644 3300001990 Bacteria 7972
10 JGI24735J21928_10000521 3300002067 Bacteria 13578
11 JGI24738J21930_10002288 3300002075 Bacteria 5065
12 JGI25150J39212_1000130 3300002774 Bacteria 42580
13 JGI25151J46595_10053766 3300003187 Bacteria 1342
14 JGI25153J46596_10000032 3300003215 Bacteria 196732
15 JGI25153J46596_10016824 3300003215 Bacteria 2910
16 Ga0055526_1013391 3300003771 Bacteria 3475
17 Ga0055537_1001101 3300003773 Bacteria 11722
18 Ga0055524_1000670 3300003775 Bacteria 24010
19 Ga0055536_1010462 3300003781 Bacteria 3676
20 Ga0055530_10001355 3300003791 Bacteria 18155
21 Ga0055540_1002776 3300003792 Bacteria 8966
22 Ga0055531_10000718 3300003794 Bacteria 28238
23 Ga0055531_10020966 3300003794 Bacteria 2558
24 Ga0065165_1002607 3300005262 Bacteria 14750
25 Ga0065165_1006173 3300005262 Bacteria 6396
26 Ga0065165_1010897 3300005262 Bacteria 3867
27 Ga0065704_10000204 3300005289 Bacteria 211587
28 Ga0065704_10000694 3300005289 Bacteria 17008
29 Ga0065704_10002707 3300005289 Bacteria 5842
30 Ga0065704_10025368 3300005289 Bacteria 1506
31 Ga0065707_10251029 3300005295 Bacteria 1125
32 Ga0070658_10027993 3300005327 Bacteria 4524
33 Ga0070658_10145696 3300005327 Bacteria 1980
34 Ga0070676_10050584 3300005328 Bacteria 2437
35 Ga0070676_10114900 3300005328 Bacteria 1681
36 Ga0070683_100003182 3300005329 Bacteria 13246
37 Ga0070683_100337479 3300005329 Bacteria 1435
38 Ga0070683_100435822 3300005329 Bacteria 1250
39 Ga0070690_100042531 3300005330 Bacteria 2878
40 Ga0070690_100082592 3300005330 Bacteria 2104
41 Ga0070670_100000068 3300005331 Bacteria 106494
42 Ga0070670_100012592 3300005331 Bacteria 7242
43 Ga0070670_100026108 3300005331 Bacteria 5028
44 Ga0070670_100058982 3300005331 Bacteria 3295
45 Ga0070670_100166003 3300005331 Bacteria 1914
46 Ga0068869_100091377 3300005334 Bacteria 2290
47 Ga0070666_10017078 3300005335 Bacteria 4649
48 Ga0070666_10018375 3300005335 Bacteria 4494
49 Ga0070666_10034605 3300005335 Bacteria 3348
50 Ga0070666_10093344 3300005335 Bacteria 2069
51 Ga0070682_100060602 3300005337 Bacteria 2393
52 Ga0068868_100224567 3300005338 Bacteria 1573
53 Ga0068868_100241644 3300005338 Bacteria 1517
54 Ga0070660_100415499 3300005339 Bacteria 1113
55 Ga0070689_100213177 3300005340 Bacteria 1581
56 Ga0070661_100004105 3300005344 Bacteria 10039
57 Ga0070661_100108963 3300005344 Bacteria 2067
58 Ga0070692_10014178 3300005345 Bacteria 3734
59 Ga0070668_100000132 3300005347 Bacteria 46719
60 Ga0070668_100006800 3300005347 Bacteria 8480
61 Ga0070668_100019204 3300005347 Bacteria 5142
62 Ga0070668_100029286 3300005347 Bacteria 4181
63 Ga0070668_100045423 3300005347 Bacteria 3370
64 Ga0070669_100000024 3300005353 Bacteria 173107
65 Ga0070669_100173795 3300005353 Bacteria 1681
66 Ga0070669_100245611 3300005353 Bacteria 1423
67 Ga0070675_100215934 3300005354 Bacteria 1669
68 Ga0070671_100000006 3300005355 Bacteria 250635
69 Ga0070671_100001115 3300005355 Bacteria 19917
70 Ga0070671_100002834 3300005355 Bacteria 13466
71 Ga0070671_100075569 3300005355 Bacteria 2814
72 Ga0070671_100266665 3300005355 Bacteria 1455
73 Ga0070673_100055087 3300005364 Bacteria 3132
74 Ga0070659_100006160 3300005366 Bacteria 8658
75 Ga0070667_100000003 3300005367 Bacteria 447715
76 Ga0070667_100001642 3300005367 Bacteria 19990
77 Ga0070667_100003291 3300005367 Bacteria 13805
78 Ga0070709_10007175 3300005434 Bacteria 6103
79 Ga0070701_10036058 3300005438 Bacteria 2489
80 Ga0070705_100263003 3300005440 Bacteria 1218
81 Ga0070708_100095776 3300005445 Bacteria 2710
82 Ga0070663_100001832 3300005455 Bacteria 11841
83 Ga0070663_100320368 3300005455 Bacteria 1246
84 Ga0068867_100086669 3300005459 Bacteria 2369
85 Ga0070679_100216191 3300005530 Bacteria 1879
86 Ga0070684_100240461 3300005535 Bacteria 1654
87 Ga0068853_100033763 3300005539 Bacteria 4340
88 Ga0070695_100334289 3300005545 Bacteria 1130
89 Ga0070665_100000043 3300005548 Bacteria 279774
90 Ga0070665_100011783 3300005548 Bacteria 8831
91 Ga0070665_100106578 3300005548 Bacteria 2805
92 Ga0070665_100385597 3300005548 Bacteria 1409
93 Ga0068855_100252785 3300005563 Bacteria 1965
94 Ga0070664_100010420 3300005564 Bacteria 7537
95 Ga0070664_100027700 3300005564 Bacteria 4710
96 Ga0068857_100209967 3300005577 Bacteria 1776
97 Ga0068854_100151319 3300005578 Bacteria 1790
98 Ga0068854_100334814 3300005578 Bacteria 1234
99 Ga0068856_100110616 3300005614 Bacteria 2744
100 Ga0070702_100071142 3300005615 Bacteria 2055
101 Ga0068852_100218800 3300005616 Bacteria 1810
102 Ga0068852_100408889 3300005616 Bacteria 1336
103 Ga0068852_100656051 3300005616 Bacteria 1057
104 Ga0068859_100003041 3300005617 Bacteria 17013
105 Ga0068859_100100298 3300005617 Bacteria 2951
106 Ga0068859_100126893 3300005617 Bacteria 2621
107 Ga0068859_100356477 3300005617 Bacteria 1557
108 Ga0068864_100000019 3300005618 Bacteria 271650
109 Ga0068864_100004226 3300005618 Bacteria 11819
110 Ga0068864_100016069 3300005618 Bacteria 6228
111 Ga0068864_100095921 3300005618 Bacteria 2624
112 Ga0068864_100178539 3300005618 Bacteria 1940
113 Ga0068864_100199022 3300005618 Bacteria 1839
114 Ga0068866_10025330 3300005718 Bacteria 2787
115 Ga0068861_100036893 3300005719 Bacteria 3631
116 Ga0068861_100084181 3300005719 Bacteria 2497
117 Ga0068863_100000015 3300005841 Bacteria 214824
118 Ga0068863_100019866 3300005841 Bacteria 6426
119 Ga0068863_100072483 3300005841 Bacteria 3258
120 Ga0068858_100000093 3300005842 Bacteria 93236
121 Ga0068858_100000278 3300005842 Bacteria 55142
122 Ga0068858_100007175 3300005842 Bacteria 10809
123 Ga0068858_100201589 3300005842 Bacteria 1882
124 Ga0068860_100000045 3300005843 Bacteria 223252
125 Ga0068860_100053602 3300005843 Bacteria 3835
126 Ga0068860_100149110 3300005843 Bacteria 2251
127 Ga0068862_100000094 3300005844 Bacteria 106159
128 Ga0068862_100000307 3300005844 Bacteria 53788
129 Ga0068862_100001480 3300005844 Bacteria 21523
130 Ga0068862_100074743 3300005844 Bacteria 2930
131 Ga0081539_10092149 3300005985 Bacteria 1563
132 Ga0075368_10005408 3300006042 Bacteria 4389
133 Ga0075363_100025008 3300006048 Bacteria 3041
134 Ga0075364_10019953 3300006051 Bacteria 4212
135 Ga0070712_100094949 3300006175 Bacteria 2193
136 Ga0070712_100129457 3300006175 Bacteria 1911
137 Ga0075367_10000211 3300006178 Bacteria 19490
138 Ga0075366_10008576 3300006195 Bacteria 5689
139 Ga0097621_100109675 3300006237 Bacteria 2331
140 Ga0097621_100199589 3300006237 Bacteria 1736
141 Ga0075370_10026573 3300006353 Bacteria 3207
142 Ga0075370_10173966 3300006353 Bacteria 1266
143 Ga0097620_100003041 3300006931 Bacteria 17013
144 Ga0097620_100100297 3300006931 Bacteria 2951
145 Ga0097620_100126886 3300006931 Bacteria 2621
146 Ga0097620_100309546 3300006931 Bacteria 1673
147 Ga0097620_100356499 3300006931 Bacteria 1557
148 Ga0105251_10001041 3300009011 Bacteria 24304
149 Ga0105251_10066438 3300009011 Bacteria 1686
150 Ga0105240_10192390 3300009093 Bacteria 2398
151 Ga0111539_10223200 3300009094 Bacteria 2195
152 Ga0105245_10008819 3300009098 Bacteria 8798
153 Ga0105245_10048863 3300009098 Bacteria 3786
154 Ga0105245_10106792 3300009098 Bacteria 2598
155 Ga0105247_10002315 3300009101 Bacteria 13011
156 Ga0105247_10003045 3300009101 Bacteria 11097
157 Ga0105247_10013580 3300009101 Bacteria 4884
158 Ga0114129_10366816 3300009147 Bacteria 1904
159 Ga0105243_10070358 3300009148 Bacteria 2825
160 Ga0105243_10078071 3300009148 Bacteria 2695
161 Ga0105243_10420804 3300009148 Bacteria 1246
162 Ga0105241_10003279 3300009174 Bacteria 12044
163 Ga0105242_10075507 3300009176 Bacteria 2807
164 Ga0105242_10238274 3300009176 Bacteria 1634
165 Ga0105248_10000311 3300009177 Bacteria 57870
166 Ga0105248_10062566 3300009177 Bacteria 4178
167 Ga0105237_10019458 3300009545 Bacteria 7011
168 Ga0105237_10137121 3300009545 Bacteria 2441
169 Ga0105238_10031920 3300009551 Bacteria 5359
170 Ga0105238_10055572 3300009551 Bacteria 3973
171 Ga0105238_10184869 3300009551 Bacteria 2060
172 Ga0105238_10224721 3300009551 Bacteria 1854
173 Ga0105249_10001265 3300009553 Bacteria 22155
174 Ga0105249_10004653 3300009553 Bacteria 11849
175 Ga0105249_10018500 3300009553 Bacteria 6201
176 Ga0105249_10028001 3300009553 Bacteria 5086
177 Ga0105249_10315560 3300009553 Bacteria 1573
178 Ga0105148_100172 3300009978 Bacteria 9528
179 Ga0105147_102132 3300009982 Bacteria 1629
180 Ga0105246_10117781 3300011119 Bacteria 1963
181 Ga0105246_10289865 3300011119 Bacteria 1316
182 Ga0105246_10412612 3300011119 Bacteria 1124
183 Ga0157369_10292626 3300013105 Bacteria 1695
184 Ga0157378_10073368 3300013297 Bacteria 3077
185 Ga0157378_10477150 3300013297 Bacteria 1242
186 Ga0157378_10634727 3300013297 Bacteria 1082
187 Ga0163162_10030528 3300013306 Bacteria 5340
188 Ga0157372_10444925 3300013307 Bacteria 1510
189 Ga0157375_10052146 3300013308 Bacteria 4020
190 Ga0163163_10007130 3300014325 Bacteria 9828
191 Ga0163163_10016104 3300014325 Bacteria 6936
192 Ga0163163_10138005 3300014325 Bacteria 2480
193 Ga0157380_10031783 3300014326 Bacteria 4055
194 Ga0157379_10424013 3300014968 Bacteria 1225
195 Ga0157379_10450214 3300014968 Bacteria 1188
196 Ga0157379_10479202 3300014968 Bacteria 1151
197 Ga0206356_10366199 3300020070 Bacteria 1332
198 Ga0209147_103284 3300025229 Bacteria 3243
199 Ga0207425_1000025 3300025245 Bacteria 321872
200 Ga0207425_1005597 3300025245 Bacteria 3556
201 Ga0209129_1000887 3300025258 Bacteria 18393
202 Ga0209233_1000140 3300025261 Bacteria 193274
203 Ga0209565_1000029 3300025263 Bacteria 340335
204 Ga0209565_1000220 3300025263 Bacteria 64333
205 Ga0209455_1013632 3300025272 Bacteria 1877
206 Ga0209673_1000889 3300025273 Bacteria 38489
207 Ga0209673_1013952 3300025273 Bacteria 3138
208 Ga0209675_1016052 3300025291 Bacteria 2197
209 Ga0209676_1005827 3300025292 Bacteria 6300
210 Ga0209025_1000176 3300025294 Bacteria 158186
211 Ga0209564_1002011 3300025295 Bacteria 17752
212 Ga0209564_1023265 3300025295 Bacteria 2160
213 Ga0209758_1000002 3300025297 Bacteria 1400310
214 Ga0209758_1000108 3300025297 Bacteria 216541
215 Ga0209050_1000001 3300025298 Bacteria 3563507
216 Ga0209050_1000131 3300025298 Bacteria 186028
217 Ga0209050_1003561 3300025298 Bacteria 11337
218 Ga0209050_1014376 3300025298 Bacteria 3414
219 Ga0209256_1000008 3300025299 Bacteria 975723
220 Ga0209051_1000405 3300025303 Bacteria 59735
221 Ga0209257_1000028 3300025304 Bacteria 699493
222 Ga0209257_1003282 3300025304 Bacteria 14110
223 Ga0207697_10000244 3300025315 Bacteria 29795
224 Ga0207696_1001087 3300025711 Bacteria 16011
225 Ga0207713_1013836 3300025735 Bacteria 4225
226 Ga0207713_1051017 3300025735 Bacteria 1647
227 Ga0207710_10013220 3300025900 Bacteria 3478
228 Ga0207710_10021848 3300025900 Bacteria 2745
229 Ga0207710_10045602 3300025900 Bacteria 1955
230 Ga0207688_10020660 3300025901 Bacteria 3595
231 Ga0207680_10003253 3300025903 Bacteria 7649
232 Ga0207680_10006266 3300025903 Bacteria 5741
233 Ga0207680_10018640 3300025903 Bacteria 3694
234 Ga0207680_10136131 3300025903 Bacteria 1624
235 Ga0207647_10004140 3300025904 Bacteria 10765
236 Ga0207647_10020983 3300025904 Bacteria 4369
237 Ga0207705_10041001 3300025909 Bacteria 3321
238 Ga0207654_10051500 3300025911 Bacteria 2370
239 Ga0207695_10029867 3300025913 Bacteria 6014
240 Ga0207693_10046192 3300025915 Bacteria 3421
241 Ga0207693_10137441 3300025915 Bacteria 1922
242 Ga0207662_10015394 3300025918 Bacteria 4304
243 Ga0207657_10066783 3300025919 Bacteria 3060
244 Ga0207657_10100871 3300025919 Bacteria 2396
245 Ga0207657_10161010 3300025919 Bacteria 1823
246 Ga0207649_10006343 3300025920 Bacteria 6429
247 Ga0207649_10193273 3300025920 Bacteria 1433
248 Ga0207681_10000004 3300025923 Bacteria 559005
249 Ga0207681_10046875 3300025923 Bacteria 2908
250 Ga0207681_10159756 3300025923 Bacteria 1697
251 Ga0207681_10170243 3300025923 Bacteria 1650
252 Ga0207681_10196795 3300025923 Bacteria 1545
253 Ga0207694_10018242 3300025924 Bacteria 5303
254 Ga0207694_10066645 3300025924 Bacteria 2809
255 Ga0207650_10000054 3300025925 Bacteria 162602
256 Ga0207650_10002697 3300025925 Bacteria 12265
257 Ga0207650_10007038 3300025925 Bacteria 7672
258 Ga0207687_10023037 3300025927 Bacteria 4148
259 Ga0207687_10024261 3300025927 Bacteria 4049
260 Ga0207687_10051938 3300025927 Bacteria 2859
261 Ga0207644_10000009 3300025931 Bacteria 251643
262 Ga0207644_10000142 3300025931 Bacteria 51611
263 Ga0207644_10000294 3300025931 Bacteria 32960
264 Ga0207644_10004595 3300025931 Bacteria 8978
265 Ga0207644_10205848 3300025931 Bacteria 1554
266 Ga0207690_10004171 3300025932 Bacteria 8536
267 Ga0207706_10004203 3300025933 Bacteria 13558
268 Ga0207706_10016282 3300025933 Bacteria 6716
269 Ga0207706_10161644 3300025933 Bacteria 1968
270 Ga0207686_10284629 3300025934 Bacteria 1222
271 Ga0207709_10058780 3300025935 Bacteria 2391
272 Ga0207709_10163664 3300025935 Bacteria 1554
273 Ga0207709_10214487 3300025935 Bacteria 1384
274 Ga0207691_10003665 3300025940 Bacteria 14903
275 Ga0207711_10000017 3300025941 Bacteria 441730
276 Ga0207711_10249496 3300025941 Bacteria 1629
277 Ga0207711_10487689 3300025941 Bacteria 1148
278 Ga0207689_10044334 3300025942 Bacteria 3677
279 Ga0207661_10004832 3300025944 Bacteria 9441
280 Ga0207661_10125695 3300025944 Bacteria 2190
281 Ga0207679_10006239 3300025945 Bacteria 7523
282 Ga0207679_10137052 3300025945 Bacteria 1972
283 Ga0207667_10401687 3300025949 Bacteria 1395
284 Ga0207651_10408398 3300025960 Bacteria 1156
285 Ga0207712_10000113 3300025961 Bacteria 88030
286 Ga0207712_10009154 3300025961 Bacteria 6267
287 Ga0207712_10101081 3300025961 Bacteria 2144
288 Ga0207712_10142670 3300025961 Bacteria 1840
289 Ga0207712_10338067 3300025961 Bacteria 1248
290 Ga0207668_10000030 3300025972 Bacteria 122797
291 Ga0207668_10007606 3300025972 Bacteria 6449
292 Ga0207668_10045105 3300025972 Bacteria 3004
293 Ga0207668_10052652 3300025972 Bacteria 2817
294 Ga0207668_10176804 3300025972 Bacteria 1680
295 Ga0207640_10023212 3300025981 Bacteria 3725
296 Ga0207640_10143017 3300025981 Bacteria 1746
297 Ga0207640_10157678 3300025981 Bacteria 1675
298 Ga0207640_10254786 3300025981 Bacteria 1364
299 Ga0207658_10000002 3300025986 Bacteria 1364188
300 Ga0207658_10000223 3300025986 Bacteria 59510
301 Ga0207658_10002362 3300025986 Bacteria 13864
302 Ga0207658_10058638 3300025986 Bacteria 2865
303 Ga0207677_10073828 3300026023 Bacteria 2417
304 Ga0207677_10451856 3300026023 Bacteria 1101
305 Ga0207703_10000587 3300026035 Bacteria 37079
306 Ga0207703_10000784 3300026035 Bacteria 31249
307 Ga0207703_10013558 3300026035 Bacteria 6349
308 Ga0207703_10315470 3300026035 Bacteria 1430
309 Ga0207639_10008050 3300026041 Bacteria 7206
310 Ga0207678_10004677 3300026067 Bacteria 12295
311 Ga0207678_10109423 3300026067 Bacteria 2357
312 Ga0207702_10007166 3300026078 Bacteria 9544
313 Ga0207702_10020933 3300026078 Bacteria 5413
314 Ga0207702_10179298 3300026078 Bacteria 1950
315 Ga0207641_10000008 3300026088 Bacteria 424415
316 Ga0207641_10000199 3300026088 Bacteria 81050
317 Ga0207641_10004015 3300026088 Bacteria 12840
318 Ga0207641_10011086 3300026088 Bacteria 7393
319 Ga0207648_10041746 3300026089 Bacteria 4029
320 Ga0207676_10000019 3300026095 Bacteria 305653
321 Ga0207676_10001170 3300026095 Bacteria 19720
322 Ga0207676_10001996 3300026095 Bacteria 14859
323 Ga0207676_10154638 3300026095 Bacteria 1979
324 Ga0207676_10271014 3300026095 Bacteria 1537
325 Ga0207674_10010279 3300026116 Bacteria 10620
326 Ga0207674_10385163 3300026116 Bacteria 1356
327 Ga0207675_100000199 3300026118 Bacteria 55487
328 Ga0207675_100044123 3300026118 Bacteria 4165
329 Ga0207675_100049053 3300026118 Bacteria 3941
330 Ga0207675_100300961 3300026118 Bacteria 1562
331 Ga0207683_10000682 3300026121 Bacteria 31182
332 Ga0207698_10048304 3300026142 Bacteria 3230
333 Ga0207698_10093158 3300026142 Bacteria 2472
334 Ga0207698_10419826 3300026142 Bacteria 1283
335 Ga0209813_10000033 3300027866 Bacteria 61945
336 Ga0268266_10000002 3300028379 Bacteria 3059047
337 Ga0268266_10015858 3300028379 Bacteria 6449
338 Ga0268266_10038079 3300028379 Bacteria 4095
339 Ga0268266_10078423 3300028379 Bacteria 2874
340 Ga0268266_10090953 3300028379 Bacteria 2675
341 Ga0268265_10000011 3300028380 Bacteria 343832
342 Ga0268265_10000109 3300028380 Bacteria 104063
343 Ga0268265_10006925 3300028380 Bacteria 7668
344 Ga0268264_10000069 3300028381 Bacteria 270492
345 Ga0268264_10000101 3300028381 Bacteria 225109
346 Ga0268264_10016417 3300028381 Bacteria 6061
347 Ga0268264_10216521 3300028381 Bacteria 1761
348 Ga0307517_10007999 3300028786 Bacteria 15254
349 Ga0265338_10071540 3300028800 Bacteria 2966
350 Ga0265324_10002449 3300029957 Bacteria 9464
351 Ga0265328_10015231 3300031239 Bacteria 3016
352 Ga0265331_10000170 3300031250 Bacteria 80298
353 Ga0265331_10018640 3300031250 Bacteria 3594
354 Ga0265327_10086868 3300031251 Bacteria 1533
355 Ga0307513_10075477 3300031456 Bacteria 3500
356 Ga0307513_10161421 3300031456 Bacteria 2133
357 Ga0307408_100028851 3300031548 Bacteria 3838
358 Ga0307408_100151228 3300031548 Bacteria 1832
359 Ga0307408_100223808 3300031548 Bacteria 1537
360 Ga0307508_10005943 3300031616 Bacteria 11515
361 Ga0307405_10186124 3300031731 Bacteria 1495
362 Ga0307413_10070759 3300031824 Bacteria 2195
363 Ga0307410_10106345 3300031852 Bacteria 2022
364 Ga0307406_10022655 3300031901 Bacteria 3729
365 Ga0307407_10365861 3300031903 Bacteria 1025
366 Ga0307412_10012191 3300031911 Bacteria 4999
367 Ga0307412_10029017 3300031911 Bacteria 3468
368 Ga0307412_10031646 3300031911 Bacteria 3343
369 Ga0307416_100026279 3300032002 Bacteria 4287
370 Ga0307416_100063636 3300032002 Bacteria 3022
371 Ga0307416_100112519 3300032002 Bacteria 2402
372 Ga0307416_100230210 3300032002 Bacteria 1786
373 Ga0307414_10006195 3300032004 Bacteria 6650
374 Ga0307414_10030685 3300032004 Bacteria 3515
375 Ga0307414_10050750 3300032004 Bacteria 2875
376 Ga0307414_10128864 3300032004 Bacteria 1960
377 Ga0307414_10514055 3300032004 Bacteria 1062
378 Ga0307411_10108272 3300032005 Bacteria 1982
379 Ga0307415_100296324 3300032126 Bacteria 1338
380 Ga0395899_0033974 3300037312 Bacteria 3829
381 Ga0395899_0052958 3300037312 Bacteria 3006
382 Ga0395899_0063383 3300037312 Bacteria 2719
383 Ga0395899_0137013 3300037312 Bacteria 1744
384 Ga0395900_0010748 3300037418 Bacteria 9363
385 Ga0395900_0021596 3300037418 Bacteria 6581
386 Ga0395900_0029328 3300037418 Bacteria 5644
387 Ga0395900_0119526 3300037418 Bacteria 2704
388 Ga0395900_0239106 3300037418 Bacteria 1822
389 Ga0395898_0068362 3300037466 Bacteria 3437
390 Ga0395898_0262259 3300037466 Bacteria 1648
391 Ga0395898_0320133 3300037466 Bacteria 1479
392 Ga0395898_0521796 3300037466 Bacteria 1129
393 Ga0395905_0000743 3300037471 Bacteria 42932
394 Ga0395905_0002628 3300037471 Bacteria 19724
395 Ga0395905_0465062 3300037471 Bacteria 1163
396 Ga0395905_0470581 3300037471 Archaea 1155
397 Ga0395901_0020705 3300038443 Bacteria 6733
398 Ga0395901_0074493 3300038443 Bacteria 3541
399 Ga0395901_0091912 3300038443 Bacteria 3176
400 Ga0436365_1166901 3300039437 Bacteria 26292
401 Ga0436365_1348585 3300039437 Bacteria 1589
402 Ga0436363_1533522 3300039450 Bacteria 1661
403 Ga0439436_0041458 3300041404 Bacteria 1317
404 Ga0439439_0016324 3300041406 Bacteria 1817
405 Ga0439461_0000006 3300041410 Bacteria 28112
406 Ga0439466_0050944 3300041411 Bacteria 1357
407 Ga0439465_0000283 3300041413 Bacteria 14258
408 Ga0439465_0000716 3300041413 Bacteria 10217
409 Ga0439431_0002911 3300041997 Bacteria 3761
410 Ga0439431_0021263 3300041997 Bacteria 1556
411 Ga0439445_0001744 3300042004 Bacteria 4792
412 Ga0439445_0006815 3300042004 Bacteria 2634
413 Ga0439448_0007036 3300042005 Bacteria 3249
414 Ga0439432_000186 3300042006 Bacteria 22271
415 Ga0439452_019604 3300042010 Bacteria 1786
416 Ga0439455_0040511 3300042012 Bacteria 1191
417 Ga0439462_0000463 3300042015 Bacteria 7966
418 Ga0439462_0015779 3300042015 Bacteria 1949
419 Ga0439446_0039917 3300042156 Bacteria 1380
420 Ga0439458_0000535 3300042157 Bacteria 9746
421 Ga0439434_0000590 3300042435 Bacteria 10478
422 Ga0466966_0005088 3300044684 Bacteria 8641
423 Ga0466961_0003783 3300044693 Bacteria 9467
424 Ga0466963_0018812 3300044694 Bacteria 4325
425 Ga0466963_0053043 3300044694 Bacteria 2692
426 Ga0466963_0068857 3300044694 Bacteria 2378
427 Ga0453684_0097671 3300044712 Bacteria 3604
428 Ga0466970_0005231 3300044765 Bacteria 6422
429 Ga0466960_0047775 3300044901 Bacteria 2054
430 Ga0451576_0000023 3300045051 Bacteria 477965
431 Ga0466967_0014661 3300045976 Bacteria 6117
432 Ga0466967_0130403 3300045976 Bacteria 2333
433 Ga0466967_0150187 3300045976 Bacteria 2177
434 Ga0495617_013296 3300046452 Bacteria 2800
435 Ga0495627_000139 3300046453 Bacteria 86240
436 Ga0495627_000456 3300046453 Bacteria 35514
437 Ga0495627_064373 3300046453 Bacteria 1079
438 Ga0495629_0009434 3300046459 Bacteria 7137
439 Ga0495638_0000365 3300046460 Bacteria 56011
440 Ga0495650_0052117 3300046471 Bacteria 1681
441 Ga0495584_0006076 3300046491 Bacteria 6357
442 Ga0495585_0077912 3300046492 Bacteria 1799
443 Ga0495594_0008293 3300046499 Bacteria 5349
444 Ga0495596_0005305 3300046500 Bacteria 6109
445 Ga0495583_0000138 3300046506 Bacteria 123486
446 Ga0495583_0016933 3300046506 Bacteria 3892
447 Ga0495606_0002185 3300046507 Bacteria 23483
448 Ga0495606_0035649 3300046507 Bacteria 3398
449 Ga0495610_0000166 3300046512 Bacteria 73463
450 Ga0495616_0000208 3300046513 Bacteria 48701
451 Ga0495632_0000149 3300046519 Bacteria 72208
452 Ga0495637_0000292 3300046520 Bacteria 38995
453 Ga0495643_0000046 3300046522 Bacteria 220912
454 Ga0495643_0002201 3300046522 Bacteria 15911
455 Ga0495643_0010440 3300046522 Bacteria 5715
456 Ga0495643_0066020 3300046522 Bacteria 1909
457 Ga0495648_0000323 3300046524 Bacteria 53106
458 Ga0495648_0004739 3300046524 Bacteria 11521
459 Ga0495648_0016092 3300046524 Bacteria 5398
460 Ga0495648_0053969 3300046524 Bacteria 2431
461 Ga0495663_0000027 3300046525 Bacteria 89947
462 Ga0495663_0003300 3300046525 Bacteria 4673
463 Ga0495663_0017765 3300046525 Bacteria 2021
464 Ga0495663_0033315 3300046525 Bacteria 1538
465 Ga0495663_0057944 3300046525 Bacteria 1213
466 Ga0495642_0002732 3300046528 Bacteria 7079
467 Ga0495633_0000054 3300046558 Bacteria 151646
468 Ga0495633_0000494 3300046558 Bacteria 39797
469 Ga0495633_0001284 3300046558 Bacteria 19912
470 Ga0495668_0000059 3300046616 Bacteria 194951
471 Ga0495668_0001884 3300046616 Bacteria 18804
472 Ga0495668_0017273 3300046616 Bacteria 4188
473 Ga0495625_0000309 3300046660 Bacteria 74356
474 Ga0495625_0024399 3300046660 Bacteria 4603
475 Ga0495625_0127490 3300046660 Bacteria 1726
476 Ga0495625_0148704 3300046660 Bacteria 1576
477 Ga0495661_0006154 3300046665 Bacteria 8444
478 Ga0495661_0025887 3300046665 Bacteria 3784
479 Ga0495669_0008783 3300046684 Bacteria 4256
480 Ga0495670_0000023 3300046691 Bacteria 92374
481 Ga0495670_0035367 3300046691 Bacteria 2490
482 Ga0495670_0102004 3300046691 Bacteria 1478
483 Ga0495671_0000029 3300046692 Bacteria 220912
484 Ga0495677_0004082 3300047445 Bacteria 5637
485 Ga0495681_0000056 3300047470 Bacteria 103692
486 Ga0495681_0003895 3300047470 Bacteria 10288
487 Ga0495681_0006476 3300047470 Bacteria 7690
488 Ga0495681_0071832 3300047470 Bacteria 1566
489 Ga0495686_0000209 3300047472 Bacteria 108972
490 Ga0495686_0004235 3300047472 Bacteria 11894
491 Ga0495686_0029903 3300047472 Bacteria 3540
492 Ga0495686_0106385 3300047472 Bacteria 1687
493 Ga0495686_0117898 3300047472 Bacteria 1585
494 Ga0496100_0007768 3300048903 Bacteria 5944
495 Ga0496101_0009676 3300048904 Bacteria 6342
496 Ga0496101_0014857 3300048904 Bacteria 5240
497 Ga0496101_0060782 3300048904 Bacteria 2742
498 Ga0496102_0000120 3300048905 Bacteria 112432
499 Ga0496102_0000184 3300048905 Bacteria 84568
500 Ga0496102_0000445 3300048905 Bacteria 47017
501 Ga0496102_0650751 3300048905 Bacteria 977
502 Ga0496103_0000021 3300048906 Bacteria 229062
503 Ga0496103_0000099 3300048906 Bacteria 94046
504 Ga0496103_0000154 3300048906 Bacteria 72239
505 Ga0496103_0014080 3300048906 Bacteria 4748
506 Ga0496103_0053602 3300048906 Bacteria 2500
507 Ga0496103_0083447 3300048906 Bacteria 2012
508 Ga0496104_0000131 3300048907 Bacteria 69658
509 Ga0496104_0109340 3300048907 Bacteria 2649
510 Ga0496104_0115375 3300048907 Bacteria 2577
511 Ga0496104_0218248 3300048907 Bacteria 1819
512 Ga0496104_0682394 3300048907 Bacteria 935
513 Ga0496105_0000589 3300048908 Bacteria 24200
514 Ga0496105_0038710 3300048908 Bacteria 3928
515 Ga0496106_0076676 3300048909 Bacteria 2563
516 Ga0496107_0007799 3300048910 Bacteria 7389
517 Ga0496107_0043498 3300048910 Bacteria 3227
518 Ga0496108_0001130 3300048911 Bacteria 20859
519 Ga0496108_0013979 3300048911 Bacteria 6548
520 Ga0496108_0042420 3300048911 Bacteria 3798
521 Ga0496108_0300070 3300048911 Bacteria 1399
522 Ga0496108_0496393 3300048911 Bacteria 1066
523 Ga0496109_0032632 3300048912 Bacteria 4681
524 Ga0496109_0148176 3300048912 Bacteria 2196
525 Ga0496109_0249737 3300048912 Bacteria 1670
526 Ga0496109_0525858 3300048912 Bacteria 1116
527 Ga0496109_0582886 3300048912 Bacteria 1054
528 Ga0496109_0778952 3300048912 Bacteria 894
529 Ga0496110_0005539 3300048913 Bacteria 9913
530 Ga0496110_0160344 3300048913 Bacteria 2039
531 Ga0496110_0196591 3300048913 Bacteria 1832
532 Ga0496110_0206728 3300048913 Bacteria 1784
533 Ga0496111_0159798 3300048914 Bacteria 1673
534 Ga0496112_0007596 3300048915 Bacteria 9634
535 Ga0496112_0008312 3300048915 Bacteria 9288
536 Ga0496112_0013521 3300048915 Bacteria 7539
537 Ga0496112_0022743 3300048915 Bacteria 5980
538 Ga0496112_0048211 3300048915 Bacteria 4177
539 Ga0496112_0050942 3300048915 Bacteria 4061
540 Ga0496112_0065999 3300048915 Bacteria 3571
541 Ga0496112_0150419 3300048915 Bacteria 2295
542 Ga0496113_0009281 3300048916 Bacteria 6452
543 Ga0496113_0011647 3300048916 Bacteria 5881
544 Ga0496113_0051952 3300048916 Bacteria 3059
545 Ga0496113_0107251 3300048916 Bacteria 2170
546 Ga0496114_0002445 3300048917 Bacteria 14178
547 Ga0496115_0000066 3300048918 Bacteria 95550
548 Ga0496115_0000299 3300048918 Bacteria 42395
549 Ga0496115_0302901 3300048918 Bacteria 1309
550 Ga0496116_0001774 3300048919 Bacteria 23469
551 Ga0496116_0003673 3300048919 Bacteria 15044
552 Ga0496116_0146955 3300048919 Bacteria 1316
553 Ga0496117_0000317 3300048920 Bacteria 84472
554 Ga0496117_0001024 3300048920 Bacteria 42696
555 Ga0496117_0011540 3300048920 Bacteria 7905
556 Ga0496118_0000154 3300048921 Bacteria 122224
557 Ga0496118_0000303 3300048921 Bacteria 85332
558 Ga0496118_0005472 3300048921 Bacteria 14417
559 Ga0496119_0000339 3300048922 Bacteria 65402
560 Ga0496119_0006478 3300048922 Bacteria 10818
561 Ga0496119_0140203 3300048922 Bacteria 1306
562 Ga0496120_0008623 3300048923 Bacteria 7363
563 Ga0496121_0000022 3300048924 Bacteria 472849
564 Ga0496121_0000417 3300048924 Bacteria 84424
565 Ga0496121_0000472 3300048924 Bacteria 78334
566 Ga0496121_0086591 3300048924 Bacteria 2462
567 Ga0496122_0011041 3300048925 Bacteria 9219
568 Ga0496122_0020196 3300048925 Bacteria 6037
569 Ga0496122_0097549 3300048925 Bacteria 1978
570 Ga0496123_0012745 3300048926 Bacteria 7130
571 Ga0496123_0151617 3300048926 Bacteria 1250
572 Ga0496124_0000214 3300048927 Bacteria 113007
573 Ga0496124_0000291 3300048927 Bacteria 94493
574 Ga0496124_0005716 3300048927 Bacteria 13859
575 Ga0496124_0006240 3300048927 Bacteria 13059
576 Ga0496124_0151865 3300048927 Bacteria 1816
577 Ga0496125_0001248 3300048928 Bacteria 37996
578 Ga0496125_0002118 3300048928 Bacteria 26680
579 Ga0496125_0016918 3300048928 Bacteria 6978
580 Ga0496125_0017281 3300048928 Bacteria 6888
581 Ga0496125_0098026 3300048928 Bacteria 2170
582 Ga0496125_0138856 3300048928 Bacteria 1694
583 Ga0496126_0000367 3300048929 Bacteria 93102
584 Ga0496126_0001079 3300048929 Bacteria 45863
585 Ga0496126_0008754 3300048929 Bacteria 10864
586 Ga0496126_0182421 3300048929 Bacteria 1782
587 Ga0495678_005174 3300049459 Bacteria 7303
588 Ga0501290_000344 3300049513 Bacteria 7622
589 Ga0501292_000096 3300049515 Bacteria 15530
590 Ga0501294_000264 3300049517 Bacteria 6475
591 Ga0501300_006959 3300049523 Bacteria 1658
592 Ga0501301_000295 3300049524 Bacteria 2934
593 Ga0501034_0036229 3300049571 Bacteria 4998
594 Ga0501038_0056925 3300049574 Bacteria 3358
595 Ga0501069_0222786 3300049585 Bacteria 1097
596 Ga0501211_001806 3300049658 Bacteria 2286
597 Ga0501222_000612 3300049662 Bacteria 5238
598 Ga0501223_000028 3300049663 Bacteria 53750
599 Ga0501223_000771 3300049663 Bacteria 7611
600 Ga0501223_001119 3300049663 Bacteria 6308
601 Ga0501224_000008 3300049664 Bacteria 111708
602 Ga0501233_000405 3300049668 Bacteria 6791
603 Ga0501235_007597 3300049669 Bacteria 2362
604 Ga0501235_008756 3300049669 Bacteria 2208
605 Ga0501235_010625 3300049669 Bacteria 2012
606 Ga0501246_006459 3300049676 Bacteria 1006
607 Ga0501261_000197 3300049690 Bacteria 8620
608 Ga0501225_0000067 3300049705 Bacteria 34242
609 Ga0501225_0000073 3300049705 Bacteria 33154
610 Ga0501225_0001910 3300049705 Bacteria 6535
611 Ga0501225_0002096 3300049705 Bacteria 6202
612 Ga0501279_000051 3300049775 Bacteria 22449
613 Ga0501280_000167 3300049776 Bacteria 16933
614 Ga0501281_00129 3300049777 Bacteria 9159
615 Ga0501282_000161 3300049778 Bacteria 8038
616 Ga0501226_000253 3300049853 Bacteria 8163
617 nmdc:mga03n38_16925_c1 3300050490 Bacteria 2845
618 nmdc:mga00v17_16355_c1 3300050491 Bacteria 4181
619 nmdc:mga0k408_130136_c1 3300050493 Bacteria 1494
620 nmdc:mga06z11_67_c1 3300050494 Bacteria 42818
621 nmdc:mga04h51_55_c1 3300050495 Bacteria 36672
622 nmdc:mga07m45_126696_c1 3300050496 Bacteria 1477
623 nmdc:mga07m45_23256_c1 3300050496 Bacteria 3386
624 nmdc:mga05p37_315121_c1 3300050507 Bacteria 1853
625 nmdc:mga08y16_199341_c1 3300050511 Bacteria 2074
626 Ga0500643_000762 3300053087 Bacteria 20999
627 Ga0500643_001338 3300053087 Bacteria 14380
628 Ga0500566_0001470 3300053094 Bacteria 13790
629 Ga0500641_0023307 3300053096 Bacteria 2380
630 Ga0500641_0051728 3300053096 Bacteria 1691
631 Ga0500555_002967 3300053103 Bacteria 4855
632 Ga0500555_012302 3300053103 Bacteria 2462
633 Ga0500556_0019253 3300053104 Bacteria 2167
634 Ga0500562_026682 3300053108 Bacteria 1515
635 Ga0500592_019037 3300053116 Bacteria 1103
636 Ga0500594_0005241 3300053118 Bacteria 2872
637 Ga0500595_001625 3300053119 Bacteria 11813
638 Ga0500607_000107 3300053121 Bacteria 64565
639 Ga0500618_013525 3300053125 Bacteria 2104
640 Ga0500658_0000412 3300053134 Bacteria 18530
641 Ga0500658_0002799 3300053134 Bacteria 6696
642 Ga0500559_0001127 3300053136 Bacteria 16082
643 Ga0500559_0003970 3300053136 Bacteria 7126
644 Ga0500559_0023273 3300053136 Bacteria 2630
645 Ga0500568_0015865 3300053139 Bacteria 3362
646 Ga0500568_0051411 3300053139 Bacteria 1621
647 Ga0500573_0003254 3300053140 Bacteria 8368
648 Ga0500573_0070635 3300053140 Bacteria 1992
649 Ga0500590_001908 3300053148 Bacteria 8905
650 Ga0500590_055279 3300053148 Bacteria 2008
651 Ga0500604_0010062 3300053151 Bacteria 2525
652 Ga0500616_0038718 3300053153 Bacteria 2574
653 Ga0500627_0016641 3300053158 Bacteria 2873
654 Ga0500637_0015759 3300053178 Bacteria 4016
655 Ga0500645_004182 3300053730 Bacteria 5617
656 Ga0500645_024806 3300053730 Bacteria 1831
657 Ga0500661_001278 3300055283 Bacteria 4700

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0650751 Ga0496102_0650751_247_966 228
2 3300049669 Ga0501235_008756 Ga0501235_008756_1449_2192 234
3 3300046453 Ga0495627_064373 Ga0495627_064373_261_1040 248
4 3300005617 Ga0068859_100356477 Ga0068859_1003564772 252
5 3300006931 Ga0097620_100356499 Ga0097620_1003564992 252
6 3300011119 Ga0105246_10289865 Ga0105246_102898652 254
7 3300013297 Ga0157378_10634727 Ga0157378_106347271 257
8 3300048915 Ga0496112_0050942 Ga0496112_0050942_34_813 258
9 3300006175 Ga0070712_100129457 Ga0070712_1001294572 265
10 3300025915 Ga0207693_10137441 Ga0207693_101374412 265
11 3300025972 Ga0207668_10176804 Ga0207668_101768042 265
12 3300005327 Ga0070658_10027993 Ga0070658_100279932 267
13 3300025909 Ga0207705_10041001 Ga0207705_100410012 267
14 3300046684 Ga0495669_0008783 Ga0495669_0008783_2330_3178 267
15 3300005616 Ga0068852_100656051 Ga0068852_1006560511 268
16 3300005618 Ga0068864_100178539 Ga0068864_1001785392 268
17 3300037418 Ga0395900_0119526 Ga0395900_0119526_610_1464 269
18 3300037466 Ga0395898_0521796 Ga0395898_0521796_212_1066 269
19 3300037471 Ga0395905_0000743 Ga0395905_0000743_30444_31298 269
20 3300048911 Ga0496108_0300070 Ga0496108_0300070_217_1104 269
21 3300048912 Ga0496109_0778952 Ga0496109_0778952_37_882 269
22 3300048916 Ga0496113_0107251 Ga0496113_0107251_1220_2107 269
23 3300044712 Ga0453684_0097671 Ga0453684_0097671_1172_2116 271
24 3300005338 Ga0068868_100241644 Ga0068868_1002416442 274
25 3300005340 Ga0070689_100213177 Ga0070689_1002131772 274
26 3300005545 Ga0070695_100334289 Ga0070695_1003342892 274
27 3300005616 Ga0068852_100218800 Ga0068852_1002188002 274
28 3300006175 Ga0070712_100094949 Ga0070712_1000949492 274
29 3300009553 Ga0105249_10315560 Ga0105249_103155602 274
30 3300025915 Ga0207693_10046192 Ga0207693_100461922 274
31 3300025933 Ga0207706_10161644 Ga0207706_101616442 274
32 3300025961 Ga0207712_10338067 Ga0207712_103380672 274
33 3300026023 Ga0207677_10451856 Ga0207677_104518561 274
34 3300026089 Ga0207648_10041746 Ga0207648_100417462 274
35 3300046453 Ga0495627_000139 Ga0495627_000139_14659_15597 274
36 3300046524 Ga0495648_0004739 Ga0495648_0004739_10142_11080 274
37 3300046525 Ga0495663_0057944 Ga0495663_0057944_224_1162 274
38 3300047470 Ga0495681_0071832 Ga0495681_0071832_177_1115 274
39 3300001990 JGI24737J22298_10000985 JGI24737J22298_100009852 275
40 3300005327 Ga0070658_10145696 Ga0070658_101456962 275
41 3300005328 Ga0070676_10050584 Ga0070676_100505844 275
42 3300005331 Ga0070670_100026108 Ga0070670_1000261084 275
43 3300005344 Ga0070661_100004105 Ga0070661_1000041056 275
44 3300005344 Ga0070661_100108963 Ga0070661_1001089632 275
45 3300005354 Ga0070675_100215934 Ga0070675_1002159342 275
46 3300005355 Ga0070671_100075569 Ga0070671_1000755694 275
47 3300005434 Ga0070709_10007175 Ga0070709_100071752 275
48 3300005455 Ga0070663_100320368 Ga0070663_1003203682 275
49 3300005548 Ga0070665_100000043 Ga0070665_100000043228 275
50 3300005548 Ga0070665_100106578 Ga0070665_1001065783 275
51 3300005548 Ga0070665_100385597 Ga0070665_1003855972 275
52 3300005564 Ga0070664_100010420 Ga0070664_1000104201 275
53 3300005564 Ga0070664_100027700 Ga0070664_1000277002 275
54 3300005577 Ga0068857_100209967 Ga0068857_1002099672 275
55 3300005841 Ga0068863_100072483 Ga0068863_1000724832 275
56 3300006237 Ga0097621_100199589 Ga0097621_1001995892 275
57 3300009093 Ga0105240_10192390 Ga0105240_101923903 275
58 3300009176 Ga0105242_10238274 Ga0105242_102382742 275
59 3300009177 Ga0105248_10062566 Ga0105248_100625662 275
60 3300009545 Ga0105237_10137121 Ga0105237_101371214 275
61 3300013307 Ga0157372_10444925 Ga0157372_104449251 275
62 3300014325 Ga0163163_10016104 Ga0163163_100161043 275
63 3300025904 Ga0207647_10020983 Ga0207647_100209832 275
64 3300025913 Ga0207695_10029867 Ga0207695_100298673 275
65 3300025919 Ga0207657_10066783 Ga0207657_100667833 275
66 3300025920 Ga0207649_10006343 Ga0207649_100063432 275
67 3300025924 Ga0207694_10018242 Ga0207694_100182426 275
68 3300025932 Ga0207690_10004171 Ga0207690_100041719 275
69 3300025945 Ga0207679_10006239 Ga0207679_100062392 275
70 3300025945 Ga0207679_10137052 Ga0207679_101370522 275
71 3300025981 Ga0207640_10023212 Ga0207640_100232122 275
72 3300026067 Ga0207678_10109423 Ga0207678_101094232 275
73 3300026078 Ga0207702_10020933 Ga0207702_100209332 275
74 3300026116 Ga0207674_10385163 Ga0207674_103851632 275
75 3300028379 Ga0268266_10000002 Ga0268266_10000002363 275
76 3300028379 Ga0268266_10015858 Ga0268266_100158584 275
77 3300028379 Ga0268266_10038079 Ga0268266_100380794 275
78 3300037312 Ga0395899_0033974 Ga0395899_0033974_118_972 275
79 3300037312 Ga0395899_0052958 Ga0395899_0052958_620_1486 275
80 3300037312 Ga0395899_0063383 Ga0395899_0063383_817_1677 275
81 3300037312 Ga0395899_0137013 Ga0395899_0137013_53_919 275
82 3300037418 Ga0395900_0010748 Ga0395900_0010748_5381_6235 275
83 3300037418 Ga0395900_0021596 Ga0395900_0021596_5615_6460 275
84 3300037418 Ga0395900_0029328 Ga0395900_0029328_849_1715 275
85 3300037418 Ga0395900_0239106 Ga0395900_0239106_209_1075 275
86 3300037466 Ga0395898_0068362 Ga0395898_0068362_1432_2292 275
87 3300037466 Ga0395898_0262259 Ga0395898_0262259_389_1234 275
88 3300037466 Ga0395898_0320133 Ga0395898_0320133_405_1271 275
89 3300037471 Ga0395905_0002628 Ga0395905_0002628_2153_3007 275
90 3300037471 Ga0395905_0465062 Ga0395905_0465062_58_912 275
91 3300037471 Ga0395905_0470581 Ga0395905_0470581_98_964 275
92 3300038443 Ga0395901_0020705 Ga0395901_0020705_3199_4053 275
93 3300038443 Ga0395901_0074493 Ga0395901_0074493_1439_2305 275
94 3300038443 Ga0395901_0091912 Ga0395901_0091912_18_884 275
95 3300039450 Ga0436363_1533522 Ga0436363_1533522_317_1246 275
96 3300042005 Ga0439448_0007036 Ga0439448_0007036_1668_2522 275
97 3300042012 Ga0439455_0040511 Ga0439455_0040511_13_867 275
98 3300042157 Ga0439458_0000535 Ga0439458_0000535_5077_5931 275
99 3300044694 Ga0466963_0018812 Ga0466963_0018812_2457_3323 275
100 3300044694 Ga0466963_0053043 Ga0466963_0053043_938_1804 275
101 3300044694 Ga0466963_0068857 Ga0466963_0068857_566_1435 275
102 3300044765 Ga0466970_0005231 Ga0466970_0005231_2435_3289 275
103 3300044901 Ga0466960_0047775 Ga0466960_0047775_325_1221 275
104 3300045976 Ga0466967_0014661 Ga0466967_0014661_1020_1886 275
105 3300045976 Ga0466967_0130403 Ga0466967_0130403_958_1827 275
106 3300046459 Ga0495629_0009434 Ga0495629_0009434_6164_7069 275
107 3300046492 Ga0495585_0077912 Ga0495585_0077912_597_1469 275
108 3300046499 Ga0495594_0008293 Ga0495594_0008293_1333_2238 275
109 3300046506 Ga0495583_0016933 Ga0495583_0016933_778_1713 275
110 3300046507 Ga0495606_0002185 Ga0495606_0002185_14062_14934 275
111 3300046507 Ga0495606_0035649 Ga0495606_0035649_510_1445 275
112 3300046522 Ga0495643_0002201 Ga0495643_0002201_1969_2904 275
113 3300046522 Ga0495643_0010440 Ga0495643_0010440_836_1771 275
114 3300046522 Ga0495643_0066020 Ga0495643_0066020_57_929 275
115 3300046524 Ga0495648_0000323 Ga0495648_0000323_12584_13456 275
116 3300046528 Ga0495642_0002732 Ga0495642_0002732_219_1154 275
117 3300046616 Ga0495668_0000059 Ga0495668_0000059_132486_133358 275
118 3300046616 Ga0495668_0017273 Ga0495668_0017273_1913_2848 275
119 3300046660 Ga0495625_0024399 Ga0495625_0024399_2954_3826 275
120 3300046660 Ga0495625_0127490 Ga0495625_0127490_607_1479 275
121 3300047445 Ga0495677_0004082 Ga0495677_0004082_2077_2949 275
122 3300047470 Ga0495681_0003895 Ga0495681_0003895_1261_2133 275
123 3300047472 Ga0495686_0106385 Ga0495686_0106385_437_1309 275
124 3300048905 Ga0496102_0000184 Ga0496102_0000184_67553_68425 275
125 3300048906 Ga0496103_0000099 Ga0496103_0000099_15476_16348 275
126 3300048907 Ga0496104_0109340 Ga0496104_0109340_287_1159 275
127 3300048907 Ga0496104_0682394 Ga0496104_0682394_17_922 275
128 3300048908 Ga0496105_0000589 Ga0496105_0000589_7952_8824 275
129 3300048910 Ga0496107_0043498 Ga0496107_0043498_1929_2801 275
130 3300048911 Ga0496108_0496393 Ga0496108_0496393_189_1034 275
131 3300048912 Ga0496109_0525858 Ga0496109_0525858_189_1061 275
132 3300048912 Ga0496109_0582886 Ga0496109_0582886_173_1018 275
133 3300048913 Ga0496110_0005539 Ga0496110_0005539_1489_2361 275
134 3300048915 Ga0496112_0008312 Ga0496112_0008312_6133_6978 275
135 3300048915 Ga0496112_0013521 Ga0496112_0013521_4973_5878 275
136 3300048915 Ga0496112_0022743 Ga0496112_0022743_403_1308 275
137 3300048915 Ga0496112_0065999 Ga0496112_0065999_1782_2642 275
138 3300048917 Ga0496114_0002445 Ga0496114_0002445_237_1109 275
139 3300048918 Ga0496115_0000066 Ga0496115_0000066_77654_78526 275
140 3300048919 Ga0496116_0003673 Ga0496116_0003673_7961_8833 275
141 3300048920 Ga0496117_0001024 Ga0496117_0001024_15806_16678 275
142 3300048921 Ga0496118_0000154 Ga0496118_0000154_92365_93237 275
143 3300048922 Ga0496119_0006478 Ga0496119_0006478_6270_7142 275
144 3300048923 Ga0496120_0008623 Ga0496120_0008623_338_1210 275
145 3300048924 Ga0496121_0000417 Ga0496121_0000417_77461_78333 275
146 3300048925 Ga0496122_0011041 Ga0496122_0011041_1892_2764 275
147 3300048926 Ga0496123_0012745 Ga0496123_0012745_5890_6762 275
148 3300048927 Ga0496124_0000291 Ga0496124_0000291_77452_78324 275
149 3300048928 Ga0496125_0001248 Ga0496125_0001248_21391_22263 275
150 3300048929 Ga0496126_0001079 Ga0496126_0001079_28958_29830 275
151 3300050493 nmdc:mga0k408_130136_c1 nmdc:mga0k408_130136_c1_238_1110 275
152 iso_pu_bacteria 2990265787 2990268323 275
153 iso_pu_bacteria 2993693658 2993696645 275
154 3300005329 Ga0070683_100003182 Ga0070683_1000031826 276
155 3300005330 Ga0070690_100082592 Ga0070690_1000825921 276
156 3300005334 Ga0068869_100091377 Ga0068869_1000913773 276
157 3300005335 Ga0070666_10034605 Ga0070666_100346053 276
158 3300005338 Ga0068868_100224567 Ga0068868_1002245672 276
159 3300005355 Ga0070671_100266665 Ga0070671_1002666652 276
160 3300005364 Ga0070673_100055087 Ga0070673_1000550872 276
161 3300005578 Ga0068854_100151319 Ga0068854_1001513192 276
162 3300005718 Ga0068866_10025330 Ga0068866_100253302 276
163 3300006237 Ga0097621_100109675 Ga0097621_1001096753 276
164 3300009551 Ga0105238_10031920 Ga0105238_100319205 276
165 3300013297 Ga0157378_10477150 Ga0157378_104771502 276
166 3300013308 Ga0157375_10052146 Ga0157375_100521464 276
167 3300014325 Ga0163163_10138005 Ga0163163_101380052 276
168 3300014968 Ga0157379_10424013 Ga0157379_104240132 276
169 3300014968 Ga0157379_10450214 Ga0157379_104502142 276
170 3300025903 Ga0207680_10018640 Ga0207680_100186403 276
171 3300025919 Ga0207657_10161010 Ga0207657_101610102 276
172 3300025920 Ga0207649_10193273 Ga0207649_101932732 276
173 3300025931 Ga0207644_10000142 Ga0207644_1000014249 276
174 3300025933 Ga0207706_10004203 Ga0207706_100042036 276
175 3300025940 Ga0207691_10003665 Ga0207691_1000366511 276
176 3300025941 Ga0207711_10487689 Ga0207711_104876891 276
177 3300025960 Ga0207651_10408398 Ga0207651_104083982 276
178 3300026023 Ga0207677_10073828 Ga0207677_100738283 276
179 3300026078 Ga0207702_10179298 Ga0207702_101792983 276
180 3300026121 Ga0207683_10000682 Ga0207683_1000068227 276
181 3300031456 Ga0307513_10075477 Ga0307513_100754772 276
182 3300045976 Ga0466967_0150187 Ga0466967_0150187_1061_1945 276
183 3300046500 Ga0495596_0005305 Ga0495596_0005305_3941_4876 276
184 3300048904 Ga0496101_0009676 Ga0496101_0009676_4736_5584 276
185 3300048906 Ga0496103_0014080 Ga0496103_0014080_3694_4542 276
186 3300048907 Ga0496104_0218248 Ga0496104_0218248_773_1621 276
187 3300048910 Ga0496107_0007799 Ga0496107_0007799_4587_5435 276
188 3300048911 Ga0496108_0013979 Ga0496108_0013979_79_927 276
189 3300048912 Ga0496109_0032632 Ga0496109_0032632_3293_4141 276
190 3300048915 Ga0496112_0007596 Ga0496112_0007596_128_976 276
191 3300048916 Ga0496113_0009281 Ga0496113_0009281_4617_5465 276
192 iso_pu_bacteria 2928027323 2928030499 276
193 iso_pu_bacteria 2984555340 2984557281 276
194 iso_pu_bacteria 2984564862 2984568321 276
195 iso_pu_bacteria 2993356040 2993359403 276
196 3300005985 Ga0081539_10092149 Ga0081539_100921492 277
197 3300031903 Ga0307407_10365861 Ga0307407_103658612 277
198 3300032002 Ga0307416_100063636 Ga0307416_1000636364 277
199 3300032004 Ga0307414_10030685 Ga0307414_100306854 277
200 3300032126 Ga0307415_100296324 Ga0307415_1002963242 277
201 3300046525 Ga0495663_0003300 Ga0495663_0003300_1990_2925 277
202 3300046558 Ga0495633_0000494 Ga0495633_0000494_15300_16235 277
203 3300025944 Ga0207661_10004832 Ga0207661_100048324 279
204 iso_pu_bacteria 2885429604 2885430961 279
205 3300048926 Ga0496123_0151617 Ga0496123_0151617_355_1224 280
206 3300001976 JGI24752J21851_1000853 JGI24752J21851_10008534 281
207 3300005328 Ga0070676_10114900 Ga0070676_101149002 281
208 3300005329 Ga0070683_100435822 Ga0070683_1004358221 281
209 3300005330 Ga0070690_100042531 Ga0070690_1000425313 281
210 3300005331 Ga0070670_100000068 Ga0070670_10000006857 281
211 3300005337 Ga0070682_100060602 Ga0070682_1000606022 281
212 3300005339 Ga0070660_100415499 Ga0070660_1004154992 281
213 3300005345 Ga0070692_10014178 Ga0070692_100141784 281
214 3300005367 Ga0070667_100001642 Ga0070667_10000164217 281
215 3300005438 Ga0070701_10036058 Ga0070701_100360582 281
216 3300005440 Ga0070705_100263003 Ga0070705_1002630032 281
217 3300005459 Ga0068867_100086669 Ga0068867_1000866692 281
218 3300005578 Ga0068854_100334814 Ga0068854_1003348142 281
219 3300005615 Ga0070702_100071142 Ga0070702_1000711422 281
220 3300005616 Ga0068852_100408889 Ga0068852_1004088892 281
221 3300005617 Ga0068859_100100298 Ga0068859_1001002984 281
222 3300005618 Ga0068864_100000019 Ga0068864_10000001962 281
223 3300005618 Ga0068864_100199022 Ga0068864_1001990222 281
224 3300005719 Ga0068861_100084181 Ga0068861_1000841812 281
225 3300005841 Ga0068863_100000015 Ga0068863_10000001561 281
226 3300005842 Ga0068858_100201589 Ga0068858_1002015892 281
227 3300005843 Ga0068860_100149110 Ga0068860_1001491102 281
228 3300005844 Ga0068862_100000094 Ga0068862_10000009456 281
229 3300005844 Ga0068862_100074743 Ga0068862_1000747432 281
230 3300006931 Ga0097620_100100297 Ga0097620_1001002974 281
231 3300009011 Ga0105251_10001041 Ga0105251_100010418 281
232 3300009094 Ga0111539_10223200 Ga0111539_102232002 281
233 3300009098 Ga0105245_10048863 Ga0105245_100488632 281
234 3300009098 Ga0105245_10106792 Ga0105245_101067922 281
235 3300009101 Ga0105247_10003045 Ga0105247_100030458 281
236 3300009101 Ga0105247_10013580 Ga0105247_100135803 281
237 3300009148 Ga0105243_10070358 Ga0105243_100703582 281
238 3300009176 Ga0105242_10075507 Ga0105242_100755073 281
239 3300009177 Ga0105248_10000311 Ga0105248_1000031119 281
240 3300009551 Ga0105238_10184869 Ga0105238_101848692 281
241 3300009551 Ga0105238_10224721 Ga0105238_102247212 281
242 3300009553 Ga0105249_10001265 Ga0105249_100012656 281
243 3300009553 Ga0105249_10018500 Ga0105249_100185002 281
244 3300011119 Ga0105246_10117781 Ga0105246_101177812 281
245 3300011119 Ga0105246_10412612 Ga0105246_104126122 281
246 3300025735 Ga0207713_1013836 Ga0207713_10138362 281
247 3300025900 Ga0207710_10013220 Ga0207710_100132202 281
248 3300025900 Ga0207710_10021848 Ga0207710_100218482 281
249 3300025901 Ga0207688_10020660 Ga0207688_100206602 281
250 3300025918 Ga0207662_10015394 Ga0207662_100153944 281
251 3300025919 Ga0207657_10100871 Ga0207657_101008712 281
252 3300025925 Ga0207650_10000054 Ga0207650_1000005417 281
253 3300025927 Ga0207687_10023037 Ga0207687_100230373 281
254 3300025927 Ga0207687_10024261 Ga0207687_100242613 281
255 3300025931 Ga0207644_10205848 Ga0207644_102058482 281
256 3300025934 Ga0207686_10284629 Ga0207686_102846292 281
257 3300025935 Ga0207709_10058780 Ga0207709_100587802 281
258 3300025935 Ga0207709_10163664 Ga0207709_101636642 281
259 3300025941 Ga0207711_10000017 Ga0207711_1000001787 281
260 3300025942 Ga0207689_10044334 Ga0207689_100443343 281
261 3300025944 Ga0207661_10125695 Ga0207661_101256952 281
262 3300025961 Ga0207712_10000113 Ga0207712_1000011380 281
263 3300025961 Ga0207712_10101081 Ga0207712_101010812 281
264 3300025981 Ga0207640_10143017 Ga0207640_101430172 281
265 3300025981 Ga0207640_10254786 Ga0207640_102547862 281
266 3300025986 Ga0207658_10000223 Ga0207658_1000022317 281
267 3300026035 Ga0207703_10315470 Ga0207703_103154702 281
268 3300026088 Ga0207641_10000008 Ga0207641_10000008172 281
269 3300026095 Ga0207676_10000019 Ga0207676_1000001956 281
270 3300026095 Ga0207676_10154638 Ga0207676_101546382 281
271 3300026118 Ga0207675_100044123 Ga0207675_1000441234 281
272 3300026118 Ga0207675_100049053 Ga0207675_1000490534 281
273 3300026142 Ga0207698_10093158 Ga0207698_100931582 281
274 3300026142 Ga0207698_10419826 Ga0207698_104198262 281
275 3300028380 Ga0268265_10000011 Ga0268265_10000011172 281
276 3300028381 Ga0268264_10216521 Ga0268264_102165212 281
277 3300028800 Ga0265338_10071540 Ga0265338_100715402 281
278 3300031731 Ga0307405_10186124 Ga0307405_101861242 281
279 3300032002 Ga0307416_100230210 Ga0307416_1002302102 281
280 3300032004 Ga0307414_10006195 Ga0307414_100061955 281
281 3300032005 Ga0307411_10108272 Ga0307411_101082723 281
282 3300039437 Ga0436365_1166901 Ga0436365_1166901_6204_7079 281
283 3300046506 Ga0495583_0000138 Ga0495583_0000138_27275_28153 281
284 3300046665 Ga0495661_0025887 Ga0495661_0025887_2877_3755 281
285 3300048904 Ga0496101_0014857 Ga0496101_0014857_2315_3196 281
286 3300048905 Ga0496102_0000120 Ga0496102_0000120_42011_42877 281
287 3300048906 Ga0496103_0000154 Ga0496103_0000154_35656_36522 281
288 3300048906 Ga0496103_0053602 Ga0496103_0053602_1129_2010 281
289 3300048906 Ga0496103_0083447 Ga0496103_0083447_1050_1937 281
290 3300048907 Ga0496104_0115375 Ga0496104_0115375_117_1004 281
291 3300048909 Ga0496106_0076676 Ga0496106_0076676_802_1689 281
292 3300048912 Ga0496109_0148176 Ga0496109_0148176_138_1025 281
293 3300048913 Ga0496110_0196591 Ga0496110_0196591_657_1544 281
294 3300048915 Ga0496112_0048211 Ga0496112_0048211_41_928 281
295 3300048915 Ga0496112_0150419 Ga0496112_0150419_1264_2151 281
296 3300048916 Ga0496113_0051952 Ga0496113_0051952_1301_2188 281
297 3300048919 Ga0496116_0001774 Ga0496116_0001774_446_1312 281
298 3300048920 Ga0496117_0000317 Ga0496117_0000317_41859_42725 281
299 3300048920 Ga0496117_0011540 Ga0496117_0011540_155_1036 281
300 3300048921 Ga0496118_0000303 Ga0496118_0000303_41863_42729 281
301 3300048921 Ga0496118_0005472 Ga0496118_0005472_5963_6844 281
302 3300048922 Ga0496119_0140203 Ga0496119_0140203_284_1150 281
303 3300048927 Ga0496124_0000214 Ga0496124_0000214_69556_70422 281
304 3300049571 Ga0501034_0036229 Ga0501034_0036229_78_953 281
305 3300049585 Ga0501069_0222786 Ga0501069_0222786_169_1053 281
306 3300049663 Ga0501223_000771 Ga0501223_000771_2144_3019 281
307 3300049664 Ga0501224_000008 Ga0501224_000008_70935_71810 281
308 3300049668 Ga0501233_000405 Ga0501233_000405_4882_5757 281
309 3300049669 Ga0501235_010625 Ga0501235_010625_752_1627 281
310 3300049705 Ga0501225_0000073 Ga0501225_0000073_1300_2175 281
311 3300049853 Ga0501226_000253 Ga0501226_000253_5104_5979 281
312 3300050511 nmdc:mga08y16_199341_c1 nmdc:mga08y16_199341_c1_111_998 281
313 3300053103 Ga0500555_002967 Ga0500555_002967_144_1022 281
314 iso_pu_bacteria 2599185354 2600203460 281
315 iso_pu_bacteria 2643221622 2644127519 281
316 iso_pu_bacteria 2751185897 2753765741 281
317 3300001904 JGI24736J21556_1000531 JGI24736J21556_10005316 282
318 3300001915 JGI24741J21665_1000370 JGI24741J21665_100037012 282
319 3300001976 JGI24752J21851_1000438 JGI24752J21851_10004385 282
320 3300001979 JGI24740J21852_10001695 JGI24740J21852_1000169514 282
321 3300001989 JGI24739J22299_10000305 JGI24739J22299_100003056 282
322 3300001990 JGI24737J22298_10001644 JGI24737J22298_1000164410 282
323 3300002067 JGI24735J21928_10000521 JGI24735J21928_1000052111 282
324 3300002075 JGI24738J21930_10002288 JGI24738J21930_100022887 282
325 3300005289 Ga0065704_10002707 Ga0065704_100027072 282
326 3300005289 Ga0065704_10025368 Ga0065704_100253681 282
327 3300005295 Ga0065707_10251029 Ga0065707_102510291 282
328 3300005329 Ga0070683_100337479 Ga0070683_1003374792 282
329 3300005331 Ga0070670_100012592 Ga0070670_1000125926 282
330 3300005331 Ga0070670_100166003 Ga0070670_1001660031 282
331 3300005335 Ga0070666_10017078 Ga0070666_100170784 282
332 3300005347 Ga0070668_100006800 Ga0070668_1000068002 282
333 3300005347 Ga0070668_100029286 Ga0070668_1000292862 282
334 3300005353 Ga0070669_100000024 Ga0070669_10000002494 282
335 3300005353 Ga0070669_100173795 Ga0070669_1001737952 282
336 3300005353 Ga0070669_100245611 Ga0070669_1002456112 282
337 3300005355 Ga0070671_100000006 Ga0070671_100000006160 282
338 3300005366 Ga0070659_100006160 Ga0070659_1000061603 282
339 3300005445 Ga0070708_100095776 Ga0070708_1000957762 282
340 3300005455 Ga0070663_100001832 Ga0070663_1000018322 282
341 3300005535 Ga0070684_100240461 Ga0070684_1002404612 282
342 3300005548 Ga0070665_100011783 Ga0070665_1000117834 282
343 3300005563 Ga0068855_100252785 Ga0068855_1002527852 282
344 3300005614 Ga0068856_100110616 Ga0068856_1001106162 282
345 3300005617 Ga0068859_100003041 Ga0068859_10000304114 282
346 3300005618 Ga0068864_100016069 Ga0068864_1000160692 282
347 3300005618 Ga0068864_100095921 Ga0068864_1000959213 282
348 3300005719 Ga0068861_100036893 Ga0068861_1000368932 282
349 3300005842 Ga0068858_100007175 Ga0068858_10000717512 282
350 3300005844 Ga0068862_100000307 Ga0068862_10000030740 282
351 3300006042 Ga0075368_10005408 Ga0075368_100054086 282
352 3300006048 Ga0075363_100025008 Ga0075363_1000250083 282
353 3300006178 Ga0075367_10000211 Ga0075367_1000021112 282
354 3300006353 Ga0075370_10026573 Ga0075370_100265733 282
355 3300006931 Ga0097620_100003041 Ga0097620_10000304114 282
356 3300009011 Ga0105251_10066438 Ga0105251_100664382 282
357 3300009101 Ga0105247_10002315 Ga0105247_100023152 282
358 3300009147 Ga0114129_10366816 Ga0114129_103668162 282
359 3300009174 Ga0105241_10003279 Ga0105241_1000327915 282
360 3300009545 Ga0105237_10019458 Ga0105237_100194586 282
361 3300009553 Ga0105249_10004653 Ga0105249_100046537 282
362 3300009553 Ga0105249_10028001 Ga0105249_100280016 282
363 3300009978 Ga0105148_100172 Ga0105148_1001727 282
364 3300009982 Ga0105147_102132 Ga0105147_1021322 282
365 3300013105 Ga0157369_10292626 Ga0157369_102926262 282
366 3300013306 Ga0163162_10030528 Ga0163162_100305282 282
367 3300014325 Ga0163163_10007130 Ga0163163_100071306 282
368 3300014326 Ga0157380_10031783 Ga0157380_100317832 282
369 3300014968 Ga0157379_10479202 Ga0157379_104792021 282
370 3300020070 Ga0206356_10366199 Ga0206356_103661992 282
371 3300025315 Ga0207697_10000244 Ga0207697_1000024427 282
372 3300025735 Ga0207713_1051017 Ga0207713_10510172 282
373 3300025900 Ga0207710_10045602 Ga0207710_100456022 282
374 3300025903 Ga0207680_10003253 Ga0207680_100032533 282
375 3300025904 Ga0207647_10004140 Ga0207647_100041406 282
376 3300025911 Ga0207654_10051500 Ga0207654_100515002 282
377 3300025923 Ga0207681_10000004 Ga0207681_10000004269 282
378 3300025923 Ga0207681_10159756 Ga0207681_101597562 282
379 3300025923 Ga0207681_10170243 Ga0207681_101702432 282
380 3300025923 Ga0207681_10196795 Ga0207681_101967952 282
381 3300025924 Ga0207694_10066645 Ga0207694_100666451 282
382 3300025925 Ga0207650_10007038 Ga0207650_100070383 282
383 3300025931 Ga0207644_10000009 Ga0207644_1000000991 282
384 3300025933 Ga0207706_10016282 Ga0207706_100162829 282
385 3300025941 Ga0207711_10249496 Ga0207711_102494962 282
386 3300025949 Ga0207667_10401687 Ga0207667_104016872 282
387 3300025961 Ga0207712_10009154 Ga0207712_100091546 282
388 3300025961 Ga0207712_10142670 Ga0207712_101426702 282
389 3300025972 Ga0207668_10007606 Ga0207668_100076063 282
390 3300025972 Ga0207668_10045105 Ga0207668_100451051 282
391 3300025981 Ga0207640_10157678 Ga0207640_101576781 282
392 3300025986 Ga0207658_10058638 Ga0207658_100586382 282
393 3300026035 Ga0207703_10013558 Ga0207703_100135585 282
394 3300026041 Ga0207639_10008050 Ga0207639_100080508 282
395 3300026067 Ga0207678_10004677 Ga0207678_1000467714 282
396 3300026078 Ga0207702_10007166 Ga0207702_100071666 282
397 3300026088 Ga0207641_10011086 Ga0207641_100110866 282
398 3300026095 Ga0207676_10001996 Ga0207676_100019968 282
399 3300026095 Ga0207676_10271014 Ga0207676_102710142 282
400 3300026116 Ga0207674_10010279 Ga0207674_100102796 282
401 3300026118 Ga0207675_100000199 Ga0207675_10000019910 282
402 3300026142 Ga0207698_10048304 Ga0207698_100483042 282
403 3300027866 Ga0209813_10000033 Ga0209813_1000003325 282
404 3300028379 Ga0268266_10078423 Ga0268266_100784232 282
405 3300028379 Ga0268266_10090953 Ga0268266_100909533 282
406 3300028380 Ga0268265_10000109 Ga0268265_1000010988 282
407 3300028381 Ga0268264_10000069 Ga0268264_10000069155 282
408 3300031548 Ga0307408_100151228 Ga0307408_1001512281 282
409 3300031824 Ga0307413_10070759 Ga0307413_100707592 282
410 3300031911 Ga0307412_10012191 Ga0307412_100121912 282
411 3300032002 Ga0307416_100112519 Ga0307416_1001125192 282
412 3300032004 Ga0307414_10050750 Ga0307414_100507501 282
413 3300032004 Ga0307414_10128864 Ga0307414_101288642 282
414 3300046452 Ga0495617_013296 Ga0495617_013296_40_957 282
415 3300046453 Ga0495627_000456 Ga0495627_000456_20695_21612 282
416 3300046491 Ga0495584_0006076 Ga0495584_0006076_1690_2619 282
417 3300046512 Ga0495610_0000166 Ga0495610_0000166_65909_66826 282
418 3300046519 Ga0495632_0000149 Ga0495632_0000149_2440_3369 282
419 3300046520 Ga0495637_0000292 Ga0495637_0000292_7823_8752 282
420 3300046522 Ga0495643_0000046 Ga0495643_0000046_7823_8752 282
421 3300046524 Ga0495648_0016092 Ga0495648_0016092_2081_2983 282
422 3300046525 Ga0495663_0000027 Ga0495663_0000027_2440_3369 282
423 3300046558 Ga0495633_0000054 Ga0495633_0000054_28486_29421 282
424 3300046558 Ga0495633_0001284 Ga0495633_0001284_2440_3369 282
425 3300046665 Ga0495661_0006154 Ga0495661_0006154_2306_3223 282
426 3300046691 Ga0495670_0035367 Ga0495670_0035367_933_1796 282
427 3300046692 Ga0495671_0000029 Ga0495671_0000029_212161_213090 282
428 3300047470 Ga0495681_0000056 Ga0495681_0000056_57529_58446 282
429 3300047470 Ga0495681_0006476 Ga0495681_0006476_3009_3938 282
430 3300047472 Ga0495686_0029903 Ga0495686_0029903_1787_2716 282
431 3300048911 Ga0496108_0001130 Ga0496108_0001130_13389_14354 282
432 3300048911 Ga0496108_0042420 Ga0496108_0042420_162_1064 282
433 3300048912 Ga0496109_0249737 Ga0496109_0249737_166_1068 282
434 3300048913 Ga0496110_0160344 Ga0496110_0160344_915_1880 282
435 3300048913 Ga0496110_0206728 Ga0496110_0206728_553_1455 282
436 3300048914 Ga0496111_0159798 Ga0496111_0159798_624_1526 282
437 3300048919 Ga0496116_0146955 Ga0496116_0146955_170_1135 282
438 3300048924 Ga0496121_0000472 Ga0496121_0000472_64127_65077 282
439 3300048924 Ga0496121_0086591 Ga0496121_0086591_165_1139 282
440 3300048925 Ga0496122_0020196 Ga0496122_0020196_4541_5515 282
441 3300048925 Ga0496122_0097549 Ga0496122_0097549_138_1067 282
442 3300048927 Ga0496124_0005716 Ga0496124_0005716_3017_3991 282
443 3300048927 Ga0496124_0151865 Ga0496124_0151865_295_1197 282
444 3300048928 Ga0496125_0016918 Ga0496125_0016918_2779_3744 282
445 3300048928 Ga0496125_0017281 Ga0496125_0017281_762_1706 282
446 3300048928 Ga0496125_0098026 Ga0496125_0098026_831_1733 282
447 3300048929 Ga0496126_0008754 Ga0496126_0008754_5091_6056 282
448 3300049459 Ga0495678_005174 Ga0495678_005174_4460_5377 282
449 3300049574 Ga0501038_0056925 Ga0501038_0056925_1667_2566 282
450 3300049658 Ga0501211_001806 Ga0501211_001806_84_992 282
451 3300049663 Ga0501223_000028 Ga0501223_000028_31551_32471 282
452 3300049676 Ga0501246_006459 Ga0501246_006459_30_950 282
453 3300049705 Ga0501225_0000067 Ga0501225_0000067_21368_22288 282
454 3300049705 Ga0501225_0001910 Ga0501225_0001910_1643_2545 282
455 3300050490 nmdc:mga03n38_16925_c1 nmdc:mga03n38_16925_c1_20_940 282
456 3300050494 nmdc:mga06z11_67_c1 nmdc:mga06z11_67_c1_20555_21475 282
457 3300050495 nmdc:mga04h51_55_c1 nmdc:mga04h51_55_c1_21327_22247 282
458 3300050496 nmdc:mga07m45_126696_c1 nmdc:mga07m45_126696_c1_422_1342 282
459 3300050507 nmdc:mga05p37_315121_c1 nmdc:mga05p37_315121_c1_625_1545 282
460 iso_pu_bacteria 2512564014 2512642262 282
461 iso_pu_bacteria 2775507255 2778125676 282
462 iso_pu_bacteria 2808606401 2809065311 282
463 iso_pu_bacteria 2808606404 2809081297 282
464 iso_pu_bacteria 2808606405 2809085662 282
465 iso_pu_bacteria 2830075706 2830078465 282
466 iso_pu_bacteria 2880518877 2880520845 282
467 iso_pu_bacteria 2919709256 2919711179 282
468 3300002774 JGI25150J39212_1000130 JGI25150J39212_100013030 283
469 3300003187 JGI25151J46595_10053766 JGI25151J46595_100537662 283
470 3300003215 JGI25153J46596_10000032 JGI25153J46596_1000003229 283
471 3300003215 JGI25153J46596_10016824 JGI25153J46596_100168243 283
472 3300003771 Ga0055526_1013391 Ga0055526_10133914 283
473 3300003773 Ga0055537_1001101 Ga0055537_10011016 283
474 3300003775 Ga0055524_1000670 Ga0055524_10006705 283
475 3300003781 Ga0055536_1010462 Ga0055536_10104625 283
476 3300003791 Ga0055530_10001355 Ga0055530_1000135511 283
477 3300003792 Ga0055540_1002776 Ga0055540_10027769 283
478 3300003794 Ga0055531_10000718 Ga0055531_100007188 283
479 3300003794 Ga0055531_10020966 Ga0055531_100209662 283
480 3300005262 Ga0065165_1002607 Ga0065165_10026079 283
481 3300005262 Ga0065165_1006173 Ga0065165_10061736 283
482 3300005262 Ga0065165_1010897 Ga0065165_10108972 283
483 3300005530 Ga0070679_100216191 Ga0070679_1002161912 283
484 3300005539 Ga0068853_100033763 Ga0068853_1000337633 283
485 3300005842 Ga0068858_100000093 Ga0068858_1000000936 283
486 3300009098 Ga0105245_10008819 Ga0105245_100088197 283
487 3300009148 Ga0105243_10078071 Ga0105243_100780712 283
488 3300009551 Ga0105238_10055572 Ga0105238_100555723 283
489 3300025229 Ga0209147_103284 Ga0209147_1032843 283
490 3300025245 Ga0207425_1000025 Ga0207425_1000025113 283
491 3300025245 Ga0207425_1005597 Ga0207425_10055972 283
492 3300025258 Ga0209129_1000887 Ga0209129_10008874 283
493 3300025261 Ga0209233_1000140 Ga0209233_1000140161 283
494 3300025263 Ga0209565_1000029 Ga0209565_1000029297 283
495 3300025263 Ga0209565_1000220 Ga0209565_100022027 283
496 3300025272 Ga0209455_1013632 Ga0209455_10136322 283
497 3300025273 Ga0209673_1000889 Ga0209673_100088910 283
498 3300025273 Ga0209673_1013952 Ga0209673_10139525 283
499 3300025291 Ga0209675_1016052 Ga0209675_10160522 283
500 3300025292 Ga0209676_1005827 Ga0209676_10058277 283
501 3300025294 Ga0209025_1000176 Ga0209025_1000176130 283
502 3300025295 Ga0209564_1002011 Ga0209564_10020113 283
503 3300025295 Ga0209564_1023265 Ga0209564_10232652 283
504 3300025297 Ga0209758_1000002 Ga0209758_1000002197 283
505 3300025297 Ga0209758_1000108 Ga0209758_100010820 283
506 3300025298 Ga0209050_1000001 Ga0209050_1000001109 283
507 3300025298 Ga0209050_1000131 Ga0209050_1000131157 283
508 3300025298 Ga0209050_1003561 Ga0209050_10035617 283
509 3300025298 Ga0209050_1014376 Ga0209050_10143763 283
510 3300025299 Ga0209256_1000008 Ga0209256_1000008905 283
511 3300025303 Ga0209051_1000405 Ga0209051_100040528 283
512 3300025304 Ga0209257_1000028 Ga0209257_1000028523 283
513 3300025304 Ga0209257_1003282 Ga0209257_10032827 283
514 3300025927 Ga0207687_10051938 Ga0207687_100519382 283
515 3300025935 Ga0207709_10214487 Ga0207709_102144872 283
516 3300026035 Ga0207703_10000784 Ga0207703_1000078424 283
517 3300031616 Ga0307508_10005943 Ga0307508_100059434 283
518 3300031911 Ga0307412_10031646 Ga0307412_100316462 283
519 3300041404 Ga0439436_0041458 Ga0439436_0041458_98_967 283
520 3300041406 Ga0439439_0016324 Ga0439439_0016324_221_1084 283
521 3300041410 Ga0439461_0000006 Ga0439461_0000006_20403_21272 283
522 3300041411 Ga0439466_0050944 Ga0439466_0050944_433_1302 283
523 3300041413 Ga0439465_0000283 Ga0439465_0000283_12790_13656 283
524 3300041413 Ga0439465_0000716 Ga0439465_0000716_4265_5134 283
525 3300041997 Ga0439431_0002911 Ga0439431_0002911_2039_2908 283
526 3300041997 Ga0439431_0021263 Ga0439431_0021263_222_1085 283
527 3300042004 Ga0439445_0001744 Ga0439445_0001744_2788_3657 283
528 3300042004 Ga0439445_0006815 Ga0439445_0006815_262_1125 283
529 3300042006 Ga0439432_000186 Ga0439432_000186_5651_6520 283
530 3300042010 Ga0439452_019604 Ga0439452_019604_104_967 283
531 3300042015 Ga0439462_0000463 Ga0439462_0000463_3366_4235 283
532 3300042015 Ga0439462_0015779 Ga0439462_0015779_618_1481 283
533 3300042156 Ga0439446_0039917 Ga0439446_0039917_467_1336 283
534 3300042435 Ga0439434_0000590 Ga0439434_0000590_4287_5156 283
535 3300046460 Ga0495638_0000365 Ga0495638_0000365_16197_17063 283
536 3300046513 Ga0495616_0000208 Ga0495616_0000208_40470_41357 283
537 3300046525 Ga0495663_0017765 Ga0495663_0017765_181_1047 283
538 3300046525 Ga0495663_0033315 Ga0495663_0033315_551_1417 283
539 3300046616 Ga0495668_0001884 Ga0495668_0001884_13146_14033 283
540 3300046660 Ga0495625_0000309 Ga0495625_0000309_67094_67960 283
541 3300046660 Ga0495625_0148704 Ga0495625_0148704_284_1150 283
542 3300046691 Ga0495670_0000023 Ga0495670_0000023_40735_41604 283
543 3300046691 Ga0495670_0102004 Ga0495670_0102004_97_960 283
544 3300047472 Ga0495686_0004235 Ga0495686_0004235_107_973 283
545 3300047472 Ga0495686_0117898 Ga0495686_0117898_149_1039 283
546 3300048918 Ga0496115_0000299 Ga0496115_0000299_29404_30282 283
547 3300053087 Ga0500643_001338 Ga0500643_001338_10703_11569 283
548 3300053094 Ga0500566_0001470 Ga0500566_0001470_5256_6125 283
549 3300053096 Ga0500641_0023307 Ga0500641_0023307_1325_2194 283
550 3300053096 Ga0500641_0051728 Ga0500641_0051728_229_1095 283
551 3300053103 Ga0500555_012302 Ga0500555_012302_489_1355 283
552 3300053104 Ga0500556_0019253 Ga0500556_0019253_416_1285 283
553 3300053119 Ga0500595_001625 Ga0500595_001625_2592_3461 283
554 3300053134 Ga0500658_0000412 Ga0500658_0000412_9104_9970 283
555 3300053134 Ga0500658_0002799 Ga0500658_0002799_4020_4883 283
556 3300053136 Ga0500559_0023273 Ga0500559_0023273_509_1393 283
557 3300053139 Ga0500568_0015865 Ga0500568_0015865_1070_1936 283
558 3300053139 Ga0500568_0051411 Ga0500568_0051411_578_1444 283
559 3300053140 Ga0500573_0003254 Ga0500573_0003254_5742_6614 283
560 3300053140 Ga0500573_0070635 Ga0500573_0070635_539_1408 283
561 3300053151 Ga0500604_0010062 Ga0500604_0010062_1050_1937 283
562 3300053153 Ga0500616_0038718 Ga0500616_0038718_1022_1888 283
563 3300053158 Ga0500627_0016641 Ga0500627_0016641_458_1345 283
564 3300053730 Ga0500645_004182 Ga0500645_004182_3708_4580 283
565 iso_pu_bacteria 2895880812 2895885979 283
566 3300009148 Ga0105243_10420804 Ga0105243_104208041 284
567 3300013297 Ga0157378_10073368 Ga0157378_100733683 284
568 3300028786 Ga0307517_10007999 Ga0307517_100079999 284
569 3300029957 Ga0265324_10002449 Ga0265324_100024498 284
570 3300031239 Ga0265328_10015231 Ga0265328_100152312 284
571 3300031250 Ga0265331_10000170 Ga0265331_100001709 284
572 3300031456 Ga0307513_10161421 Ga0307513_101614212 284
573 3300031548 Ga0307408_100028851 Ga0307408_1000288515 284
574 3300031852 Ga0307410_10106345 Ga0307410_101063452 284
575 3300031901 Ga0307406_10022655 Ga0307406_100226553 284
576 3300031911 Ga0307412_10029017 Ga0307412_100290173 284
577 3300032002 Ga0307416_100026279 Ga0307416_1000262792 284
578 3300039437 Ga0436365_1348585 Ga0436365_1348585_87_959 284
579 3300044684 Ga0466966_0005088 Ga0466966_0005088_1772_2692 284
580 3300044693 Ga0466961_0003783 Ga0466961_0003783_7430_8350 284
581 3300046471 Ga0495650_0052117 Ga0495650_0052117_445_1317 284
582 3300047472 Ga0495686_0000209 Ga0495686_0000209_5363_6238 284
583 3300053087 Ga0500643_000762 Ga0500643_000762_5494_6384 284
584 3300053136 Ga0500559_0003970 Ga0500559_0003970_1683_2573 284
585 3300055283 Ga0500661_001278 Ga0500661_001278_3365_4255 284
586 3300031250 Ga0265331_10018640 Ga0265331_100186402 285
587 3300048928 Ga0496125_0138856 Ga0496125_0138856_293_1168 285
588 3300049513 Ga0501290_000344 Ga0501290_000344_2214_3098 285
589 3300049515 Ga0501292_000096 Ga0501292_000096_10303_11187 285
590 3300049517 Ga0501294_000264 Ga0501294_000264_3775_4659 285
591 3300049523 Ga0501300_006959 Ga0501300_006959_114_998 285
592 3300049524 Ga0501301_000295 Ga0501301_000295_139_1023 285
593 3300049662 Ga0501222_000612 Ga0501222_000612_693_1577 285
594 3300049663 Ga0501223_001119 Ga0501223_001119_2644_3528 285
595 3300049669 Ga0501235_007597 Ga0501235_007597_1462_2346 285
596 3300049690 Ga0501261_000197 Ga0501261_000197_3468_4352 285
597 3300049705 Ga0501225_0002096 Ga0501225_0002096_4176_5060 285
598 3300049775 Ga0501279_000051 Ga0501279_000051_4251_5135 285
599 3300049776 Ga0501280_000167 Ga0501280_000167_11775_12659 285
600 3300049777 Ga0501281_00129 Ga0501281_00129_2832_3716 285
601 3300049778 Ga0501282_000161 Ga0501282_000161_4830_5714 285
602 3300053148 Ga0500590_001908 Ga0500590_001908_4369_5298 286
603 3300005331 Ga0070670_100058982 Ga0070670_1000589822 287
604 3300005335 Ga0070666_10018375 Ga0070666_100183752 287
605 3300005347 Ga0070668_100000132 Ga0070668_10000013216 287
606 3300005355 Ga0070671_100001115 Ga0070671_10000111511 287
607 3300005367 Ga0070667_100000003 Ga0070667_100000003371 287
608 3300005617 Ga0068859_100126893 Ga0068859_1001268932 287
609 3300005618 Ga0068864_100004226 Ga0068864_1000042264 287
610 3300005841 Ga0068863_100019866 Ga0068863_1000198667 287
611 3300005842 Ga0068858_100000278 Ga0068858_10000027835 287
612 3300005843 Ga0068860_100000045 Ga0068860_100000045140 287
613 3300005844 Ga0068862_100001480 Ga0068862_10000148016 287
614 3300006931 Ga0097620_100126886 Ga0097620_1001268862 287
615 3300025903 Ga0207680_10006266 Ga0207680_100062665 287
616 3300025923 Ga0207681_10046875 Ga0207681_100468752 287
617 3300025925 Ga0207650_10002697 Ga0207650_1000269713 287
618 3300025931 Ga0207644_10000294 Ga0207644_100002947 287
619 3300025972 Ga0207668_10000030 Ga0207668_1000003010 287
620 3300025986 Ga0207658_10000002 Ga0207658_100000021272 287
621 3300026035 Ga0207703_10000587 Ga0207703_100005872 287
622 3300026088 Ga0207641_10000199 Ga0207641_1000019959 287
623 3300026088 Ga0207641_10004015 Ga0207641_100040157 287
624 3300026095 Ga0207676_10001170 Ga0207676_100011705 287
625 3300026118 Ga0207675_100300961 Ga0207675_1003009611 287
626 3300028380 Ga0268265_10006925 Ga0268265_100069256 287
627 3300028381 Ga0268264_10000101 Ga0268264_10000101142 287
628 3300031548 Ga0307408_100223808 Ga0307408_1002238082 287
629 3300032004 Ga0307414_10514055 Ga0307414_105140551 287
630 3300045051 Ga0451576_0000023 Ga0451576_0000023_440188_441081 287
631 3300046524 Ga0495648_0053969 Ga0495648_0053969_1204_2088 287
632 3300048929 Ga0496126_0182421 Ga0496126_0182421_756_1640 287
633 3300053118 Ga0500594_0005241 Ga0500594_0005241_585_1469 287
634 3300048924 Ga0496121_0000022 Ga0496121_0000022_38479_39402 288
635 3300053125 Ga0500618_013525 Ga0500618_013525_1141_2043 288
636 3300006931 Ga0097620_100309546 Ga0097620_1003095462 289
637 3300005289 Ga0065704_10000694 Ga0065704_1000069410 290
638 3300005335 Ga0070666_10093344 Ga0070666_100933443 290
639 3300005347 Ga0070668_100019204 Ga0070668_1000192045 290
640 3300005347 Ga0070668_100045423 Ga0070668_1000454234 290
641 3300005355 Ga0070671_100002834 Ga0070671_10000283412 290
642 3300005367 Ga0070667_100003291 Ga0070667_1000032913 290
643 3300005843 Ga0068860_100053602 Ga0068860_1000536023 290
644 3300025711 Ga0207696_1001087 Ga0207696_10010877 290
645 3300025903 Ga0207680_10136131 Ga0207680_101361313 290
646 3300025931 Ga0207644_10004595 Ga0207644_100045957 290
647 3300025972 Ga0207668_10052652 Ga0207668_100526523 290
648 3300025986 Ga0207658_10002362 Ga0207658_100023623 290
649 3300028381 Ga0268264_10016417 Ga0268264_100164175 290
650 3300048903 Ga0496100_0007768 Ga0496100_0007768_4976_5899 290
651 3300048904 Ga0496101_0060782 Ga0496101_0060782_915_1838 290
652 3300048905 Ga0496102_0000445 Ga0496102_0000445_25208_26131 290
653 3300048906 Ga0496103_0000021 Ga0496103_0000021_56416_57339 290
654 3300048907 Ga0496104_0000131 Ga0496104_0000131_708_1631 290
655 3300048908 Ga0496105_0038710 Ga0496105_0038710_2308_3231 290
656 3300048916 Ga0496113_0011647 Ga0496113_0011647_3287_4210 290
657 3300048918 Ga0496115_0302901 Ga0496115_0302901_182_1105 290
658 3300048922 Ga0496119_0000339 Ga0496119_0000339_61758_62681 290
659 3300048927 Ga0496124_0006240 Ga0496124_0006240_11895_12818 290
660 3300048928 Ga0496125_0002118 Ga0496125_0002118_2708_3631 290
661 3300048929 Ga0496126_0000367 Ga0496126_0000367_25232_26155 290
662 iso_pu_bacteria 2738541275 2738711629 290
663 iso_pu_bacteria 2738541301 2738850054 290
664 iso_pu_bacteria 2738541304 2738865783 290
665 iso_pu_bacteria 2738543022 2739298301 290
666 iso_pu_bacteria 2738543033 2739359979 290
667 iso_pu_bacteria 2928100450 2928103782 290
668 iso_pu_bacteria 2928959182 2928961710 290
669 3300006051 Ga0075364_10019953 Ga0075364_100199535 291
670 3300006195 Ga0075366_10008576 Ga0075366_100085762 291
671 3300006353 Ga0075370_10173966 Ga0075370_101739661 291
672 3300031251 Ga0265327_10086868 Ga0265327_100868682 291
673 3300050491 nmdc:mga00v17_16355_c1 nmdc:mga00v17_16355_c1_3162_4052 291
674 3300050496 nmdc:mga07m45_23256_c1 nmdc:mga07m45_23256_c1_702_1601 292
675 3300053108 Ga0500562_026682 Ga0500562_026682_275_1174 292
676 3300053121 Ga0500607_000107 Ga0500607_000107_22058_22957 292
677 3300053136 Ga0500559_0001127 Ga0500559_0001127_5887_6786 292
678 3300053148 Ga0500590_055279 Ga0500590_055279_581_1480 292
679 3300053178 Ga0500637_0015759 Ga0500637_0015759_640_1539 292
680 3300053730 Ga0500645_024806 Ga0500645_024806_493_1392 292
681 3300053116 Ga0500592_019037 Ga0500592_019037_107_1003 293
682 2162886007 SwRhRL2b_contig_1799459 SwRhRL2b_0524.00003070 294
683 3300005289 Ga0065704_10000204 Ga0065704_10000204199 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09297

zf-NADH-PPase

NADH pyrophosphatase zinc ribbon domain

128

158

0.99

PF00293

NUDIX

NUDIX domain

159

278

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ypf-assembly1.cif.gz_A nudix1 hydrolase from rosa x hybrida in complex with geranyl pyrophosphate 0.8838 155 255
3oga-assembly1.cif.gz_B 1.75 angstrom resolution crystal structure of a putative ntp pyrophosphohydrolase (yfao) from salmonella typhimurium lt2 0.8689 154 260
6scx-assembly2.cif.gz_C-2 crystal structure of the catalytic domain of human nudt12 in complex with 7-methyl-guanosine-5'-triphosphate 0.8626 2 293
6o3p-assembly1.cif.gz_A crystal structure of the catalytic domain of mouse nudt12 in complex with amp and 3 mg2+ ions 0.8583 7 292
5wy6-assembly1.cif.gz_A crystal structure of atnudx1 (e56a) 0.8578 154 255
ID Description Score Start End Superfamily
af_A0A0R4ISD4_291_431_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9523 154 292 3.90.79.10
af_I1MUA9_246_385_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9336 154 269 3.90.79.10
af_A4I7A0_174_307_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9281 154 291 3.90.79.10
af_Q19427_210_368_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9258 156 293 3.90.79.10
2gb5A02 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.925 154 293 3.90.79.10

Feature Viewer

pLDDT pTM Quality
93.09 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map