F474831

General Info

Members Datasets Scaffolds Average Seq Length
681 379 1362 60

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10000178|Ga0111539_100001789
Length 60
Sequence MAASGSNLTKETKNMSIQSHLAELERRHRALEDEITDALAHPSTDDLTARLKHAASQTVH

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
209 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
219 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
233 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
234 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
235 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
236 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
237 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
238 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
242 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
243 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
244 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
245 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
248 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
249 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
250 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
251 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
252 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
253 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
254 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
255 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
269 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
270 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
275 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
276 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
277 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
297 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
308 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
329 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
332 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
333 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
345 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
355 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
358 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
362 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
363 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
364 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
367 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
372 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
373 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
374 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
375 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
376 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.73
Nodule 0
Rhizoplane 3.82
Rhizosphere 87.96
Stem 0
Stem Tuber 0
Unclassified 14.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10000178 3300009094 Bacteria 73928
2 JGI24749J21850_1044325 3300002076 Bacteria 655
3 JGI24744J21845_10068035 3300002077 Bacteria 650
4 JGI24742J22300_10025865 3300002244 Bacteria 1015
5 JGI24742J22300_10091439 3300002244 Unclassified 582
6 JGI25406J46586_10210951 3300003203 Unclassified 568
7 Ga0065714_10216346 3300005288 Bacteria 852
8 Ga0065712_10026172 3300005290 Bacteria 1306
9 Ga0065712_10101266 3300005290 Bacteria 2039
10 Ga0065712_10831420 3300005290 Bacteria 503
11 Ga0065715_10254111 3300005293 Bacteria 1158
12 Ga0065707_10110102 3300005295 Bacteria 2444
13 Ga0070676_10080626 3300005328 Bacteria 1973
14 Ga0070690_100308495 3300005330 Bacteria 1137
15 Ga0070690_100634050 3300005330 Bacteria 814
16 Ga0070690_100930056 3300005330 Bacteria 681
17 Ga0070690_101234969 3300005330 Unclassified 597
18 Ga0070670_100381676 3300005331 Bacteria 1241
19 Ga0070670_100940574 3300005331 Bacteria 784
20 Ga0070670_101987990 3300005331 Unclassified 536
21 Ga0070677_10005109 3300005333 Bacteria 4313
22 Ga0070677_10462406 3300005333 Bacteria 681
23 Ga0068869_100518319 3300005334 Bacteria 997
24 Ga0070666_10196468 3300005335 Bacteria 1418
25 Ga0070666_10549028 3300005335 Bacteria 840
26 Ga0070680_100209953 3300005336 Unclassified 1643
27 Ga0070680_101258873 3300005336 Bacteria 640
28 Ga0070682_100324758 3300005337 Bacteria 1138
29 Ga0070682_100665282 3300005337 Unclassified 831
30 Ga0070682_101884010 3300005337 Unclassified 523
31 Ga0068868_100336028 3300005338 Bacteria 1290
32 Ga0068868_102258896 3300005338 Unclassified 519
33 Ga0070660_100768738 3300005339 Unclassified 809
34 Ga0070660_101179026 3300005339 Bacteria 649
35 Ga0070660_101462401 3300005339 Bacteria 581
36 Ga0070689_100024901 3300005340 Bacteria 4492
37 Ga0070689_100120445 3300005340 Bacteria 2095
38 Ga0070689_100746106 3300005340 Bacteria 858
39 Ga0070689_102088009 3300005340 Unclassified 519
40 Ga0070687_100524331 3300005343 Unclassified 802
41 Ga0070661_101813588 3300005344 Bacteria 518
42 Ga0070692_10313923 3300005345 Bacteria 961
43 Ga0070668_100381238 3300005347 Bacteria 1200
44 Ga0070668_100418957 3300005347 Bacteria 1146
45 Ga0070668_100532708 3300005347 Bacteria 1020
46 Ga0070669_100082172 3300005353 Bacteria 2401
47 Ga0070669_100936816 3300005353 Bacteria 741
48 Ga0070669_101874278 3300005353 Bacteria 523
49 Ga0070675_100078930 3300005354 Bacteria 2742
50 Ga0070675_100266386 3300005354 Bacteria 1502
51 Ga0070675_100913413 3300005354 Bacteria 805
52 Ga0070675_101302259 3300005354 Bacteria 669
53 Ga0070675_101836981 3300005354 Unclassified 559
54 Ga0070671_100019122 3300005355 Bacteria 5571
55 Ga0070671_100945940 3300005355 Bacteria 754
56 Ga0070674_100166398 3300005356 Bacteria 1677
57 Ga0070674_100892179 3300005356 Bacteria 774
58 Ga0070674_101414431 3300005356 Unclassified 623
59 Ga0070673_100282433 3300005364 Bacteria 1456
60 Ga0070673_101347279 3300005364 Bacteria 671
61 Ga0070688_100365027 3300005365 Bacteria 1060
62 Ga0070688_100798768 3300005365 Bacteria 738
63 Ga0070688_100842952 3300005365 Bacteria 719
64 Ga0070688_101384531 3300005365 Bacteria 570
65 Ga0070659_100363709 3300005366 Bacteria 1216
66 Ga0070667_100632205 3300005367 Bacteria 987
67 Ga0070709_10261840 3300005434 Bacteria 1250
68 Ga0070709_11258827 3300005434 Bacteria 596
69 Ga0070714_100037075 3300005435 Bacteria 4095
70 Ga0070714_100396990 3300005435 Bacteria 1303
71 Ga0070714_102105922 3300005435 Unclassified 550
72 Ga0070713_100078227 3300005436 Bacteria 2815
73 Ga0070713_101579665 3300005436 Unclassified 637
74 Ga0070710_10546723 3300005437 Bacteria 799
75 Ga0070711_100594158 3300005439 Bacteria 923
76 Ga0070705_100689996 3300005440 Bacteria 801
77 Ga0070705_101895522 3300005440 Unclassified 507
78 Ga0070700_100142458 3300005441 Bacteria 1631
79 Ga0070700_100860508 3300005441 Unclassified 735
80 Ga0070694_100766410 3300005444 Bacteria 789
81 Ga0070708_100056781 3300005445 Bacteria 3483
82 Ga0070678_100027456 3300005456 Bacteria 3865
83 Ga0070678_100424252 3300005456 Bacteria 1160
84 Ga0070678_101066393 3300005456 Bacteria 745
85 Ga0070678_101234882 3300005456 Bacteria 694
86 Ga0070662_100032186 3300005457 Bacteria 3684
87 Ga0070662_100607732 3300005457 Bacteria 920
88 Ga0070662_101738702 3300005457 Bacteria 539
89 Ga0070681_10235723 3300005458 Bacteria 1744
90 Ga0070681_10746144 3300005458 Bacteria 895
91 Ga0068867_100491170 3300005459 Bacteria 1053
92 Ga0068867_100591321 3300005459 Bacteria 967
93 Ga0070685_10052634 3300005466 Bacteria 2356
94 Ga0070685_10132551 3300005466 Bacteria 1560
95 Ga0070685_10887963 3300005466 Bacteria 663
96 Ga0070706_100458123 3300005467 Bacteria 1187
97 Ga0070706_101010357 3300005467 Bacteria 767
98 Ga0070707_100398871 3300005468 Bacteria 1335
99 Ga0070707_101300479 3300005468 Bacteria 693
100 Ga0070698_100106483 3300005471 Bacteria 2773
101 Ga0070699_100003596 3300005518 Bacteria 13702
102 Ga0070699_100295617 3300005518 Bacteria 1452
103 Ga0070699_100409294 3300005518 Bacteria 1227
104 Ga0070679_100055816 3300005530 Bacteria 3934
105 Ga0070679_101585135 3300005530 Bacteria 602
106 Ga0070684_100592882 3300005535 Bacteria 1030
107 Ga0070684_102149846 3300005535 Bacteria 527
108 Ga0068853_100819814 3300005539 Bacteria 891
109 Ga0068853_101414851 3300005539 Bacteria 673
110 Ga0070672_100003608 3300005543 Bacteria 10034
111 Ga0070672_100247533 3300005543 Bacteria 1501
112 Ga0070672_100873095 3300005543 Bacteria 794
113 Ga0070672_100945535 3300005543 Bacteria 762
114 Ga0070686_100651495 3300005544 Bacteria 835
115 Ga0070686_100678423 3300005544 Bacteria 820
116 Ga0070696_100786342 3300005546 Bacteria 782
117 Ga0070693_100446731 3300005547 Bacteria 906
118 Ga0070693_100565330 3300005547 Bacteria 816
119 Ga0070665_100425834 3300005548 Bacteria 1336
120 Ga0070665_100573953 3300005548 Bacteria 1141
121 Ga0070665_102216797 3300005548 Unclassified 553
122 Ga0070704_100381961 3300005549 Bacteria 1197
123 Ga0070704_101281959 3300005549 Bacteria 670
124 Ga0070664_100023692 3300005564 Bacteria 5071
125 Ga0070664_100753958 3300005564 Bacteria 909
126 Ga0070664_101375584 3300005564 Unclassified 667
127 Ga0070664_102088485 3300005564 Bacteria 538
128 Ga0068857_100123895 3300005577 Bacteria 2328
129 Ga0068857_100270368 3300005577 Bacteria 1562
130 Ga0068857_100465412 3300005577 Bacteria 1183
131 Ga0068857_101725643 3300005577 Bacteria 612
132 Ga0068854_101499543 3300005578 Unclassified 612
133 Ga0068856_101116049 3300005614 Bacteria 806
134 Ga0068856_102107878 3300005614 Bacteria 573
135 Ga0070702_100056130 3300005615 Bacteria 2273
136 Ga0070702_100147085 3300005615 Bacteria 1508
137 Ga0068852_101706420 3300005616 Unclassified 652
138 Ga0068852_102149781 3300005616 Unclassified 580
139 Ga0068859_101003934 3300005617 Bacteria 916
140 Ga0068859_101474352 3300005617 Bacteria 751
141 Ga0068859_101783918 3300005617 Bacteria 680
142 Ga0068859_101926123 3300005617 Bacteria 653
143 Ga0068859_102038392 3300005617 Bacteria 633
144 Ga0068864_100994413 3300005618 Unclassified 832
145 Ga0068864_101279164 3300005618 Bacteria 733
146 Ga0068864_101712033 3300005618 Bacteria 633
147 Ga0068864_102026875 3300005618 Bacteria 582
148 Ga0068866_10111020 3300005718 Bacteria 1530
149 Ga0068861_100271393 3300005719 Bacteria 1457
150 Ga0068861_101639884 3300005719 Unclassified 635
151 Ga0068861_102346520 3300005719 Bacteria 536
152 Ga0068870_11279276 3300005840 Bacteria 534
153 Ga0068870_11472053 3300005840 Bacteria 501
154 Ga0068863_100455393 3300005841 Bacteria 1256
155 Ga0068863_100821220 3300005841 Bacteria 928
156 Ga0068858_101226256 3300005842 Bacteria 737
157 Ga0068858_101509410 3300005842 Bacteria 663
158 Ga0068858_101752263 3300005842 Bacteria 613
159 Ga0068860_100746812 3300005843 Bacteria 990
160 Ga0068860_102021817 3300005843 Bacteria 598
161 Ga0068860_102466764 3300005843 Bacteria 540
162 Ga0068862_100482588 3300005844 Bacteria 1173
163 Ga0068862_100776781 3300005844 Bacteria 934
164 Ga0068862_101002621 3300005844 Bacteria 826
165 Ga0081455_10060732 3300005937 Bacteria 3185
166 Ga0081455_10228486 3300005937 Bacteria 1375
167 Ga0081455_10715221 3300005937 Bacteria 637
168 Ga0081538_10122542 3300005981 Bacteria 1245
169 Ga0081540_1022126 3300005983 Bacteria 3759
170 Ga0081540_1150724 3300005983 Bacteria 918
171 Ga0081540_1332848 3300005983 Unclassified 520
172 Ga0081539_10030610 3300005985 Bacteria 3336
173 Ga0081539_10054949 3300005985 Bacteria 2219
174 Ga0081539_10063973 3300005985 Bacteria 2004
175 Ga0081539_10456225 3300005985 Unclassified 529
176 Ga0070717_10148757 3300006028 Bacteria 2025
177 Ga0070717_10350990 3300006028 Bacteria 1319
178 Ga0070717_10389445 3300006028 Bacteria 1251
179 Ga0070717_10788303 3300006028 Bacteria 864
180 Ga0070717_11884031 3300006028 Bacteria 540
181 Ga0075365_10187250 3300006038 Bacteria 1448
182 Ga0075365_10721827 3300006038 Unclassified 704
183 Ga0075368_10393526 3300006042 Bacteria 608
184 Ga0075363_100667890 3300006048 Bacteria 626
185 Ga0075363_100678975 3300006048 Unclassified 621
186 Ga0075432_10048296 3300006058 Bacteria 1497
187 Ga0070716_100550978 3300006173 Bacteria 860
188 Ga0070716_100751728 3300006173 Bacteria 750
189 Ga0070716_101192514 3300006173 Unclassified 611
190 Ga0070712_100001353 3300006175 Bacteria 14879
191 Ga0070712_100223527 3300006175 Bacteria 1492
192 Ga0070712_100919162 3300006175 Bacteria 755
193 Ga0070712_101853671 3300006175 Unclassified 528
194 Ga0075367_10183274 3300006178 Bacteria 1306
195 Ga0075369_10198505 3300006186 Bacteria 925
196 Ga0075366_10968091 3300006195 Unclassified 531
197 Ga0097621_100357779 3300006237 Bacteria 1300
198 Ga0075370_10155254 3300006353 Bacteria 1342
199 Ga0068871_102062673 3300006358 Bacteria 543
200 Ga0075428_100521690 3300006844 Bacteria 1271
201 Ga0075428_100595847 3300006844 Bacteria 1180
202 Ga0075430_100488947 3300006846 Bacteria 1015
203 Ga0075431_100560999 3300006847 Bacteria 1129
204 Ga0075431_100842402 3300006847 Bacteria 888
205 Ga0075431_101643507 3300006847 Unclassified 600
206 Ga0075431_101832020 3300006847 Unclassified 563
207 Ga0075433_10710817 3300006852 Unclassified 880
208 Ga0075434_100080095 3300006871 Bacteria 3262
209 Ga0075434_100154759 3300006871 Bacteria 2312
210 Ga0075434_101174059 3300006871 Unclassified 780
211 Ga0075429_100639886 3300006880 Bacteria 932
212 Ga0068865_100252539 3300006881 Bacteria 1392
213 Ga0068865_100579629 3300006881 Bacteria 946
214 Ga0075436_100258388 3300006914 Bacteria 1242
215 Ga0097620_101003947 3300006931 Bacteria 916
216 Ga0097620_101474334 3300006931 Bacteria 751
217 Ga0097620_101783833 3300006931 Bacteria 680
218 Ga0097620_101926001 3300006931 Bacteria 653
219 Ga0097620_102038494 3300006931 Bacteria 633
220 Ga0075435_100064410 3300007076 Bacteria 2978
221 Ga0099795_10026061 3300007788 Bacteria 1966
222 Ga0111539_10158850 3300009094 Bacteria 2644
223 Ga0111539_10824628 3300009094 Bacteria 1079
224 Ga0111539_11855140 3300009094 Unclassified 699
225 Ga0111539_12292587 3300009094 Bacteria 626
226 Ga0105245_10226388 3300009098 Bacteria 1807
227 Ga0105245_10355548 3300009098 Bacteria 1452
228 Ga0105245_11320448 3300009098 Bacteria 770
229 Ga0105247_10028084 3300009101 Bacteria 3403
230 Ga0105247_11807273 3300009101 Unclassified 509
231 Ga0114129_10001129 3300009147 Bacteria 35251
232 Ga0114129_10028330 3300009147 Bacteria 7936
233 Ga0114129_10082203 3300009147 Bacteria 4476
234 Ga0114129_10181281 3300009147 Bacteria 2865
235 Ga0114129_10743832 3300009147 Bacteria 1256
236 Ga0105243_10097959 3300009148 Bacteria 2428
237 Ga0105243_10504236 3300009148 Bacteria 1147
238 Ga0105243_10913392 3300009148 Bacteria 874
239 Ga0105241_10604807 3300009174 Bacteria 991
240 Ga0105242_10659973 3300009176 Bacteria 1018
241 Ga0105242_10851523 3300009176 Bacteria 907
242 Ga0105242_12818241 3300009176 Bacteria 536
243 Ga0105242_12993108 3300009176 Unclassified 523
244 Ga0105248_10669799 3300009177 Bacteria 1171
245 Ga0105248_11356786 3300009177 Bacteria 804
246 Ga0105248_11409601 3300009177 Bacteria 788
247 Ga0105237_10089750 3300009545 Bacteria 3063
248 Ga0105238_10278116 3300009551 Bacteria 1655
249 Ga0105238_10495438 3300009551 Bacteria 1222
250 Ga0105249_10606969 3300009553 Bacteria 1149
251 Ga0105249_10865110 3300009553 Unclassified 970
252 Ga0105249_10919975 3300009553 Bacteria 942
253 Ga0099796_10069024 3300010159 Bacteria 1271
254 Ga0105239_11007386 3300010375 Bacteria 958
255 Ga0105239_13422128 3300010375 Bacteria 516
256 Ga0105246_10132617 3300011119 Bacteria 1863
257 Ga0105246_10163300 3300011119 Bacteria 1699
258 Ga0105246_11202563 3300011119 Bacteria 698
259 Ga0157373_11136300 3300013100 Bacteria 587
260 Ga0157370_10965493 3300013104 Bacteria 772
261 Ga0157374_10341098 3300013296 Bacteria 1487
262 Ga0157374_10652651 3300013296 Bacteria 1064
263 Ga0157374_11137936 3300013296 Bacteria 801
264 Ga0157378_10050415 3300013297 Bacteria 3705
265 Ga0157378_10206126 3300013297 Bacteria 1862
266 Ga0157378_11179141 3300013297 Bacteria 805
267 Ga0157378_11472156 3300013297 Unclassified 725
268 Ga0157378_11789258 3300013297 Unclassified 662
269 Ga0157378_12344321 3300013297 Unclassified 585
270 Ga0157378_12714854 3300013297 Unclassified 548
271 Ga0157378_13286091 3300013297 Unclassified 502
272 Ga0163162_11116881 3300013306 Bacteria 893
273 Ga0163162_11554783 3300013306 Unclassified 754
274 Ga0163162_11570305 3300013306 Unclassified 750
275 Ga0163162_11899424 3300013306 Bacteria 681
276 Ga0157372_10970608 3300013307 Bacteria 985
277 Ga0157372_11414335 3300013307 Unclassified 802
278 Ga0157372_12145279 3300013307 Unclassified 642
279 Ga0157372_12223163 3300013307 Bacteria 630
280 Ga0157375_10532144 3300013308 Bacteria 1338
281 Ga0157375_11822454 3300013308 Bacteria 722
282 Ga0163163_10923542 3300014325 Bacteria 936
283 Ga0163163_11511684 3300014325 Bacteria 733
284 Ga0163163_12038452 3300014325 Bacteria 633
285 Ga0157380_10106100 3300014326 Bacteria 2350
286 Ga0157380_10547680 3300014326 Bacteria 1134
287 Ga0157380_10598228 3300014326 Bacteria 1090
288 Ga0157380_10658617 3300014326 Bacteria 1046
289 Ga0157380_11441213 3300014326 Unclassified 740
290 Ga0157377_10298358 3300014745 Bacteria 1062
291 Ga0157379_10573605 3300014968 Bacteria 1051
292 Ga0157379_10683260 3300014968 Bacteria 963
293 Ga0157379_11031412 3300014968 Bacteria 785
294 Ga0157376_10097449 3300014969 Bacteria 2562
295 Ga0182006_1079560 3300015261 Bacteria 1198
296 Ga0182005_1004239 3300015265 Bacteria 4677
297 Ga0163161_10695545 3300017792 Bacteria 846
298 Ga0163161_11470151 3300017792 Bacteria 597
299 Ga0213874_10049084 3300021377 Bacteria 1289
300 Ga0209758_1000382 3300025297 Bacteria 76653
301 Ga0207426_1160178 3300025302 Bacteria 516
302 Ga0207697_10045782 3300025315 Bacteria 1801
303 Ga0207697_10404052 3300025315 Bacteria 607
304 Ga0207682_10004843 3300025893 Bacteria 5570
305 Ga0207642_10267514 3300025899 Bacteria 977
306 Ga0207642_11114348 3300025899 Unclassified 510
307 Ga0207710_10007613 3300025900 Bacteria 4582
308 Ga0207688_10023317 3300025901 Bacteria 3388
309 Ga0207688_10381030 3300025901 Bacteria 872
310 Ga0207688_10616201 3300025901 Unclassified 684
311 Ga0207680_10244148 3300025903 Bacteria 1238
312 Ga0207680_11008711 3300025903 Bacteria 596
313 Ga0207680_11214678 3300025903 Bacteria 537
314 Ga0207647_10228932 3300025904 Bacteria 1070
315 Ga0207647_10614620 3300025904 Bacteria 598
316 Ga0207699_10551163 3300025906 Bacteria 836
317 Ga0207645_10064936 3300025907 Bacteria 2332
318 Ga0207643_10078771 3300025908 Bacteria 1907
319 Ga0207684_10094933 3300025910 Bacteria 2544
320 Ga0207654_10319037 3300025911 Bacteria 1062
321 Ga0207654_10955606 3300025911 Unclassified 622
322 Ga0207707_10642985 3300025912 Bacteria 895
323 Ga0207695_10760504 3300025913 Bacteria 849
324 Ga0207671_10036904 3300025914 Bacteria 3624
325 Ga0207693_10018952 3300025915 Bacteria 5478
326 Ga0207693_10319099 3300025915 Bacteria 1216
327 Ga0207663_11091783 3300025916 Bacteria 641
328 Ga0207660_10159299 3300025917 Bacteria 1740
329 Ga0207660_11192203 3300025917 Unclassified 620
330 Ga0207662_10045898 3300025918 Bacteria 2583
331 Ga0207662_10141564 3300025918 Bacteria 1524
332 Ga0207662_10224299 3300025918 Bacteria 1225
333 Ga0207657_10660035 3300025919 Unclassified 814
334 Ga0207652_10047852 3300025921 Bacteria 3654
335 Ga0207681_10184595 3300025923 Bacteria 1591
336 Ga0207694_10427624 3300025924 Bacteria 1104
337 Ga0207694_10672278 3300025924 Bacteria 873
338 Ga0207650_10306444 3300025925 Bacteria 1298
339 Ga0207650_10816956 3300025925 Bacteria 790
340 Ga0207650_11055993 3300025925 Bacteria 691
341 Ga0207659_10058268 3300025926 Bacteria 2772
342 Ga0207659_10742665 3300025926 Bacteria 842
343 Ga0207659_11157649 3300025926 Unclassified 665
344 Ga0207659_11922646 3300025926 Unclassified 501
345 Ga0207687_10093748 3300025927 Bacteria 2196
346 Ga0207687_10328023 3300025927 Bacteria 1241
347 Ga0207700_10079752 3300025928 Bacteria 2550
348 Ga0207664_10031635 3300025929 Bacteria 4049
349 Ga0207664_10392020 3300025929 Bacteria 1234
350 Ga0207664_10825676 3300025929 Bacteria 833
351 Ga0207644_10087379 3300025931 Bacteria 2317
352 Ga0207644_11188926 3300025931 Bacteria 641
353 Ga0207690_10392299 3300025932 Bacteria 1105
354 Ga0207690_11278054 3300025932 Unclassified 613
355 Ga0207706_10011193 3300025933 Bacteria 8178
356 Ga0207706_10559973 3300025933 Bacteria 984
357 Ga0207706_11206613 3300025933 Bacteria 628
358 Ga0207706_11282877 3300025933 Bacteria 606
359 Ga0207686_10421424 3300025934 Bacteria 1021
360 Ga0207709_10565833 3300025935 Unclassified 896
361 Ga0207670_10091695 3300025936 Bacteria 2149
362 Ga0207670_10141990 3300025936 Bacteria 1772
363 Ga0207670_10893077 3300025936 Bacteria 744
364 Ga0207669_10015144 3300025937 Bacteria 3881
365 Ga0207669_10574377 3300025937 Bacteria 913
366 Ga0207669_11316505 3300025937 Unclassified 614
367 Ga0207704_10358943 3300025938 Bacteria 1137
368 Ga0207704_10942206 3300025938 Bacteria 728
369 Ga0207704_11861075 3300025938 Unclassified 518
370 Ga0207665_10264584 3300025939 Bacteria 1275
371 Ga0207665_10303027 3300025939 Bacteria 1195
372 Ga0207665_10333002 3300025939 Bacteria 1142
373 Ga0207691_10009530 3300025940 Bacteria 9321
374 Ga0207691_11272278 3300025940 Bacteria 608
375 Ga0207691_11748527 3300025940 Unclassified 502
376 Ga0207711_10352844 3300025941 Bacteria 1362
377 Ga0207711_10570743 3300025941 Bacteria 1055
378 Ga0207711_11331324 3300025941 Unclassified 660
379 Ga0207689_10019408 3300025942 Bacteria 5730
380 Ga0207689_10251071 3300025942 Bacteria 1463
381 Ga0207689_10874953 3300025942 Unclassified 758
382 Ga0207661_10100753 3300025944 Bacteria 2425
383 Ga0207679_10056453 3300025945 Bacteria 2899
384 Ga0207679_10283539 3300025945 Bacteria 1421
385 Ga0207651_10141953 3300025960 Bacteria 1856
386 Ga0207651_10395730 3300025960 Bacteria 1174
387 Ga0207712_10211899 3300025961 Bacteria 1543
388 Ga0207712_10305663 3300025961 Bacteria 1307
389 Ga0207712_10543907 3300025961 Bacteria 998
390 Ga0207668_10357495 3300025972 Bacteria 1223
391 Ga0207668_11426094 3300025972 Bacteria 624
392 Ga0207640_11426051 3300025981 Unclassified 621
393 Ga0207658_10879341 3300025986 Bacteria 815
394 Ga0207658_11614789 3300025986 Bacteria 593
395 Ga0207677_10092272 3300026023 Bacteria 2205
396 Ga0207677_10966239 3300026023 Unclassified 771
397 Ga0207677_11268993 3300026023 Bacteria 676
398 Ga0207677_11500252 3300026023 Bacteria 623
399 Ga0207703_10083020 3300026035 Bacteria 2676
400 Ga0207639_10389366 3300026041 Bacteria 1253
401 Ga0207639_12076037 3300026041 Unclassified 529
402 Ga0207678_11616370 3300026067 Unclassified 570
403 Ga0207708_10472265 3300026075 Bacteria 1048
404 Ga0207708_10679901 3300026075 Bacteria 878
405 Ga0207702_11152063 3300026078 Bacteria 769
406 Ga0207641_11185236 3300026088 Bacteria 763
407 Ga0207641_11308035 3300026088 Bacteria 725
408 Ga0207648_10274009 3300026089 Bacteria 1508
409 Ga0207648_10621165 3300026089 Bacteria 997
410 Ga0207648_11975813 3300026089 Bacteria 545
411 Ga0207648_12104874 3300026089 Unclassified 525
412 Ga0207648_12206058 3300026089 Unclassified 511
413 Ga0207676_10007072 3300026095 Bacteria 7955
414 Ga0207676_11437595 3300026095 Bacteria 686
415 Ga0207676_11503024 3300026095 Bacteria 670
416 Ga0207676_11574646 3300026095 Unclassified 655
417 Ga0207674_10582254 3300026116 Bacteria 1081
418 Ga0207674_11012996 3300026116 Bacteria 800
419 Ga0207675_100195519 3300026118 Bacteria 1941
420 Ga0207675_100352300 3300026118 Bacteria 1443
421 Ga0207675_102138529 3300026118 Bacteria 576
422 Ga0207683_10003726 3300026121 Bacteria 13222
423 Ga0207698_10543445 3300026142 Bacteria 1137
424 Ga0207698_11857386 3300026142 Bacteria 617
425 Ga0207698_12272958 3300026142 Unclassified 554
426 Ga0209179_1006395 3300027512 Bacteria 1897
427 Ga0207428_10174990 3300027907 Bacteria 1624
428 Ga0268266_10516851 3300028379 Bacteria 1141
429 Ga0268266_10731597 3300028379 Bacteria 954
430 Ga0268266_10787380 3300028379 Bacteria 918
431 Ga0268266_11323983 3300028379 Bacteria 696
432 Ga0268265_10339017 3300028380 Bacteria 1368
433 Ga0268265_11630160 3300028380 Bacteria 650
434 Ga0268264_11763516 3300028381 Bacteria 629
435 Ga0307515_10879543 3300028794 Bacteria 525
436 Ga0265338_10533486 3300028800 Bacteria 823
437 Ga0265762_1045285 3300030760 Bacteria 870
438 Ga0265760_10079917 3300031090 Bacteria 1012
439 Ga0265760_10175455 3300031090 Bacteria 713
440 Ga0265330_10173837 3300031235 Bacteria 913
441 Ga0265325_10000280 3300031241 Bacteria 36085
442 Ga0265325_10034628 3300031241 Bacteria 2686
443 Ga0265325_10182756 3300031241 Bacteria 976
444 Ga0265340_10051588 3300031247 Bacteria 1991
445 Ga0265340_10286765 3300031247 Bacteria 731
446 Ga0265339_10048676 3300031249 Bacteria 2324
447 Ga0265339_10218487 3300031249 Unclassified 933
448 Ga0265316_10106470 3300031344 Bacteria 2127
449 Ga0265316_10478889 3300031344 Unclassified 891
450 Ga0307513_10674036 3300031456 Bacteria 740
451 Ga0265313_10000577 3300031595 Bacteria 38251
452 Ga0265313_10029611 3300031595 Bacteria 2830
453 Ga0265313_10162110 3300031595 Unclassified 949
454 Ga0265342_10088463 3300031712 Bacteria 1778
455 Ga0307405_11243133 3300031731 Bacteria 646
456 Ga0307416_100971497 3300032002 Bacteria 952
457 Ga0307416_101718716 3300032002 Unclassified 732
458 Ga0307411_11872171 3300032005 Bacteria 558
459 Ga0307415_101280558 3300032126 Bacteria 694
460 Ga0373948_0119869 3300034817 Unclassified 635
461 Ga0373934_0020503 3300035086 Bacteria 2540
462 Ga0373923_0014916 3300035111 Bacteria 2926
463 Ga0373932_0091946 3300035112 Bacteria 975
464 Ga0373936_0078106 3300035113 Bacteria 1374
465 Ga0373936_0276524 3300035113 Unclassified 754
466 Ga0373941_0183299 3300035115 Bacteria 787
467 Ga0373941_0364496 3300035115 Bacteria 591
468 Ga0373953_0039291 3300035117 Bacteria 1875
469 Ga0373954_0009390 3300035118 Bacteria 4303
470 Ga0373946_0230058 3300035171 Bacteria 898
471 Ga0373961_0087934 3300035241 Bacteria 988
472 Ga0373924_0021218 3300035410 Bacteria 2533
473 Ga0373935_0067539 3300035692 Bacteria 2299
474 Ga0373927_0156953 3300035695 Bacteria 1490
475 Ga0373927_0524529 3300035695 Unclassified 783
476 Ga0373927_0724588 3300035695 Bacteria 657
477 Ga0373933_0051004 3300035724 Bacteria 2472
478 Ga0373947_0021654 3300035725 Bacteria 3722
479 Ga0373947_0614447 3300035725 Bacteria 741
480 Ga0373937_0000901 3300036401 Bacteria 25350
481 Ga0373937_0708644 3300036401 Bacteria 953
482 Ga0373925_0035552 3300037068 Bacteria 3676
483 Ga0395899_0671292 3300037312 Bacteria 653
484 Ga0395900_0618886 3300037418 Unclassified 1022
485 Ga0395898_0191417 3300037466 Bacteria 1954
486 Ga0436364_0152521 3300037853 Unclassified 697
487 Ga0436364_0398761 3300037853 Bacteria 761
488 Ga0436364_0742195 3300037853 Unclassified 529
489 Ga0395901_0137161 3300038443 Bacteria 2571
490 Ga0436365_0014209 3300039437 Unclassified 573
491 Ga0436365_0177825 3300039437 Bacteria 736
492 Ga0436365_1725208 3300039437 Bacteria 802
493 Ga0436360_1105132 3300039438 Unclassified 584
494 Ga0436361_0596429 3300039447 Bacteria 690
495 Ga0436361_0963726 3300039447 Bacteria 553
496 Ga0436363_0309884 3300039450 Bacteria 2117
497 Ga0436363_1069585 3300039450 Bacteria 996
498 Ga0436363_1456055 3300039450 Bacteria 1682
499 Ga0436363_1654571 3300039450 Bacteria 2675
500 Ga0439453_0009361 3300041408 Bacteria 1594
501 Ga0451789_1024604 3300041443 Bacteria 603
502 Ga0451791_1594538 3300041451 Bacteria 692
503 Ga0451793_1074372 3300041452 Unclassified 691
504 Ga0451843_1566498 3300041509 Bacteria 592
505 Ga0451853_3610269 3300041512 Unclassified 909
506 Ga0439437_017595 3300042000 Bacteria 850
507 Ga0439441_020201 3300042001 Bacteria 1218
508 Ga0439434_0077243 3300042435 Bacteria 1054
509 Ga0439435_0040509 3300042436 Bacteria 1301
510 Ga0439459_0033518 3300042438 Bacteria 1058
511 Ga0439464_0124016 3300042439 Bacteria 797
512 Ga0439460_0015229 3300042461 Bacteria 2033
513 Ga0439460_0096311 3300042461 Bacteria 946
514 Ga0439440_0072258 3300042993 Bacteria 900
515 Ga0466968_0272075 3300044735 Bacteria 809
516 Ga0451576_1171576 3300045051 Bacteria 803
517 Ga0466967_2206371 3300045976 Bacteria 547
518 Ga0466967_2263155 3300045976 Bacteria 539
519 Ga0495592_0056742 3300046454 Bacteria 2892
520 Ga0495629_0003741 3300046459 Bacteria 11460
521 Ga0495638_0184592 3300046460 Bacteria 1187
522 Ga0495651_0030149 3300046462 Bacteria 4229
523 Ga0495653_0010719 3300046463 Bacteria 7505
524 Ga0495605_0087665 3300046474 Bacteria 1447
525 Ga0495606_0565809 3300046507 Unclassified 563
526 Ga0495608_0007302 3300046511 Bacteria 7812
527 Ga0495618_0032039 3300046514 Bacteria 3292
528 Ga0495628_0154674 3300046516 Bacteria 1745
529 Ga0495630_0300753 3300046517 Bacteria 1226
530 Ga0495631_0165482 3300046518 Bacteria 949
531 Ga0495632_0273143 3300046519 Bacteria 754
532 Ga0495663_0072667 3300046525 Bacteria 1097
533 Ga0495666_0348224 3300046526 Unclassified 668
534 Ga0495652_0026791 3300046529 Bacteria 5087
535 Ga0495640_0015526 3300046533 Bacteria 5727
536 Ga0495587_0017301 3300046536 Bacteria 4480
537 Ga0495598_0014350 3300046537 Bacteria 1980
538 Ga0495598_0135514 3300046537 Bacteria 848
539 Ga0495621_0041406 3300046539 Bacteria 1617
540 Ga0495645_0552641 3300046543 Bacteria 713
541 Ga0495633_0124812 3300046558 Bacteria 1192
542 Ga0495667_0018750 3300046559 Bacteria 4670
543 Ga0495656_0010323 3300046615 Bacteria 3392
544 Ga0495668_0344476 3300046616 Bacteria 818
545 Ga0495634_0053497 3300046642 Bacteria 2704
546 Ga0495611_0497836 3300046648 Bacteria 554
547 Ga0495635_0008348 3300046663 Bacteria 7232
548 Ga0495657_0036684 3300046675 Bacteria 3386
549 Ga0495599_0137115 3300046678 Bacteria 1518
550 Ga0495623_0010533 3300046679 Bacteria 5981
551 Ga0495646_0015118 3300046680 Bacteria 4903
552 Ga0495658_0091053 3300046683 Bacteria 1806
553 Ga0495624_0025419 3300046690 Bacteria 3888
554 Ga0495670_0167985 3300046691 Bacteria 1155
555 Ga0495600_0074727 3300046809 Bacteria 2213
556 Ga0495581_0051202 3300047315 Bacteria 2385
557 Ga0495581_0878721 3300047315 Bacteria 512
558 Ga0495604_0001599 3300047317 Bacteria 18655
559 Ga0495674_0025244 3300047319 Bacteria 5451
560 Ga0495672_0314214 3300047320 Bacteria 738
561 Ga0495676_0015300 3300047321 Bacteria 6835
562 Ga0495680_0061998 3300047322 Bacteria 2875
563 Ga0495675_0010964 3300047444 Bacteria 5681
564 Ga0495677_0153429 3300047445 Bacteria 887
565 Ga0495684_0023561 3300047471 Bacteria 4733
566 Ga0495593_0057175 3300047673 Bacteria 2049
567 Ga0495602_0032519 3300048088 Bacteria 4909
568 Ga0495626_0384469 3300048091 Bacteria 544
569 Ga0496100_0019583 3300048903 Bacteria 4041
570 Ga0496100_0330361 3300048903 Bacteria 1147
571 Ga0496101_0005190 3300048904 Bacteria 8285
572 Ga0496102_0019521 3300048905 Bacteria 5970
573 Ga0496104_0272716 3300048907 Bacteria 1604
574 Ga0496105_0125581 3300048908 Bacteria 2115
575 Ga0496106_0024132 3300048909 Bacteria 4520
576 Ga0496106_0801065 3300048909 Unclassified 747
577 Ga0496107_0009728 3300048910 Bacteria 6667
578 Ga0496108_0352082 3300048911 Bacteria 1285
579 Ga0496109_0436802 3300048912 Bacteria 1236
580 Ga0496109_1491644 3300048912 Bacteria 611
581 Ga0496110_0315676 3300048913 Bacteria 1423
582 Ga0496110_0412987 3300048913 Bacteria 1230
583 Ga0496110_0728385 3300048913 Bacteria 894
584 Ga0496111_0019254 3300048914 Bacteria 4738
585 Ga0496111_0234238 3300048914 Bacteria 1364
586 Ga0496112_0081390 3300048915 Bacteria 3202
587 Ga0496112_0387056 3300048915 Bacteria 1339
588 Ga0496112_1391446 3300048915 Bacteria 616
589 Ga0496112_1606656 3300048915 Unclassified 563
590 Ga0496114_0381587 3300048917 Unclassified 1248
591 Ga0496115_0608291 3300048918 Bacteria 868
592 Ga0496124_0982137 3300048927 Bacteria 505
593 Ga0496126_0097680 3300048929 Bacteria 2574
594 Ga0501033_0198630 3300049570 Bacteria 1433
595 Ga0501034_0209404 3300049571 Bacteria 1905
596 Ga0501043_0121837 3300049579 Bacteria 2046
597 Ga0501047_0147984 3300049581 Bacteria 2225
598 Ga0501048_0791914 3300049582 Unclassified 681
599 Ga0501067_0122733 3300049583 Bacteria 1446
600 Ga0501067_0271564 3300049583 Unclassified 944
601 Ga0501068_0186041 3300049584 Bacteria 1314
602 Ga0501069_0014076 3300049585 Bacteria 4273
603 Ga0501069_0213123 3300049585 Unclassified 1121
604 Ga0501070_0303010 3300049586 Bacteria 1301
605 Ga0501072_0002854 3300049588 Bacteria 12975
606 Ga0501073_0071111 3300049589 Bacteria 2425
607 Ga0501074_0181262 3300049590 Bacteria 1502
608 Ga0501079_0147190 3300049741 Bacteria 1836
609 Ga0501079_0947651 3300049741 Bacteria 678
610 Ga0501080_0011965 3300049742 Bacteria 7948
611 Ga0501083_0042269 3300049744 Bacteria 3091
612 Ga0501083_0111907 3300049744 Bacteria 1794
613 Ga0501083_0185952 3300049744 Bacteria 1356
614 Ga0501083_0247219 3300049744 Bacteria 1161
615 Ga0501035_0251718 3300049822 Bacteria 1500
616 Ga0501044_0615008 3300049823 Bacteria 978
617 Ga0501044_1496158 3300049823 Bacteria 540
618 nmdc:mga0yw44_39829_c1 3300050492 Bacteria 2788
619 nmdc:mga0yw44_93834_c1 3300050492 Bacteria 1901
620 nmdc:mga0k408_536033_c1 3300050493 Bacteria 692
621 nmdc:mga0k408_538263_c1 3300050493 Unclassified 691
622 nmdc:mga06z11_178462_c1 3300050494 Bacteria 1223
623 nmdc:mga07m45_472048_c1 3300050496 Bacteria 727
624 nmdc:mga05p37_111208_c1 3300050507 Bacteria 3369
625 nmdc:mga05p37_1411474_c1 3300050507 Bacteria 700
626 nmdc:mga05p37_29701_c1 3300050507 Bacteria 6670
627 nmdc:mga05p37_743_c1 3300050507 Bacteria 36122
628 nmdc:mga09592_1700709_c1 3300050508 Unclassified 509
629 nmdc:mga09592_781_c1 3300050508 Bacteria 24612
630 nmdc:mga0qj67_154905_c1 3300050509 Bacteria 1859
631 nmdc:mga0qj67_72223_c1 3300050509 Bacteria 2755
632 nmdc:mga06r32_1356280_c1 3300050510 Bacteria 654
633 nmdc:mga06r32_1439194_c1 3300050510 Bacteria 630
634 nmdc:mga06r32_19037_c1 3300050510 Bacteria 6295
635 nmdc:mga08y16_1137901_c1 3300050511 Bacteria 754
636 nmdc:mga08y16_121_c1 3300050511 Bacteria 67325
637 nmdc:mga08y16_1396061_c1 3300050511 Unclassified 664
638 nmdc:mga08y16_1612085_c1 3300050511 Unclassified 606
639 nmdc:mga08y16_64145_c1 3300050511 Bacteria 3836
640 nmdc:mga0n895_1069463_c1 3300050512 Unclassified 785
641 nmdc:mga0n895_252933_c1 3300050512 Bacteria 1788
642 nmdc:mga0n895_41006_c1 3300050512 Bacteria 4499
643 nmdc:mga0rr50_538245_c1 3300050513 Bacteria 994
644 nmdc:mga0rr50_637900_c1 3300050513 Bacteria 909
645 nmdc:mga08x19_485917_c1 3300050514 Bacteria 871
646 nmdc:mga0a205_475487_c1 3300050515 Bacteria 1108
647 nmdc:mga0a205_770773_c1 3300050515 Bacteria 810
648 Ga0495601_0000582 3300053077 Bacteria 19416
649 Ga0495601_0021693 3300053077 Bacteria 3935
650 Ga0495612_0005167 3300053078 Bacteria 5394
651 Ga0495612_0087197 3300053078 Bacteria 1317
652 Ga0500610_0301181 3300053079 Bacteria 707
653 Ga0495595_0000566 3300053084 Bacteria 14169
654 Ga0495619_0041413 3300053085 Bacteria 3012
655 Ga0500578_0488075 3300053086 Bacteria 695
656 Ga0500644_0454708 3300053088 Bacteria 561
657 Ga0500651_0592951 3300053093 Bacteria 602
658 Ga0500641_0081507 3300053096 Bacteria 1373
659 Ga0500650_0223033 3300053098 Bacteria 852
660 Ga0500654_056395 3300053099 Bacteria 2058
661 Ga0500555_180345 3300053103 Unclassified 511
662 Ga0500562_026487 3300053108 Bacteria 1520
663 Ga0500594_0038583 3300053118 Bacteria 1295
664 Ga0500595_008211 3300053119 Bacteria 4282
665 Ga0500621_202874 3300053126 Bacteria 701
666 Ga0500642_0024256 3300053130 Bacteria 2448
667 Ga0500642_0450470 3300053130 Bacteria 552
668 Ga0500658_0060463 3300053134 Bacteria 1574
669 Ga0500568_0076490 3300053139 Bacteria 1275
670 Ga0500577_0311435 3300053142 Bacteria 687
671 Ga0500588_0109960 3300053146 Bacteria 960
672 Ga0500589_211292 3300053147 Bacteria 737
673 Ga0500604_0006108 3300053151 Bacteria 3179
674 Ga0500622_0409902 3300053156 Unclassified 548
675 Ga0500627_0325494 3300053158 Bacteria 667
676 Ga0501084_0434027 3300054114 Bacteria 1110
677 Ga0501084_0614727 3300054114 Bacteria 918
678 Ga0501084_0698959 3300054114 Bacteria 855
679 Ga0587076_207110 3300059645 Unclassified 507
680 Ga0501082_0000486 3300060353 Bacteria 35135
681 Ga0501082_1097562 3300060353 Bacteria 696
682 Ga0111539_10000178
683 JGI24749J21850_1044325
684 JGI24744J21845_10068035
685 JGI24742J22300_10025865
686 JGI24742J22300_10091439
687 JGI25406J46586_10210951
688 Ga0065714_10216346
689 Ga0065712_10026172
690 Ga0065712_10101266
691 Ga0065712_10831420
692 Ga0065715_10254111
693 Ga0065707_10110102
694 Ga0070676_10080626
695 Ga0070690_100308495
696 Ga0070690_100634050
697 Ga0070690_100930056
698 Ga0070690_101234969
699 Ga0070670_100381676
700 Ga0070670_100940574
701 Ga0070670_101987990
702 Ga0070677_10005109
703 Ga0070677_10462406
704 Ga0068869_100518319
705 Ga0070666_10196468
706 Ga0070666_10549028
707 Ga0070680_100209953
708 Ga0070680_101258873
709 Ga0070682_100324758
710 Ga0070682_100665282
711 Ga0070682_101884010
712 Ga0068868_100336028
713 Ga0068868_102258896
714 Ga0070660_100768738
715 Ga0070660_101179026
716 Ga0070660_101462401
717 Ga0070689_100024901
718 Ga0070689_100120445
719 Ga0070689_100746106
720 Ga0070689_102088009
721 Ga0070687_100524331
722 Ga0070661_101813588
723 Ga0070692_10313923
724 Ga0070668_100381238
725 Ga0070668_100418957
726 Ga0070668_100532708
727 Ga0070669_100082172
728 Ga0070669_100936816
729 Ga0070669_101874278
730 Ga0070675_100078930
731 Ga0070675_100266386
732 Ga0070675_100913413
733 Ga0070675_101302259
734 Ga0070675_101836981
735 Ga0070671_100019122
736 Ga0070671_100945940
737 Ga0070674_100166398
738 Ga0070674_100892179
739 Ga0070674_101414431
740 Ga0070673_100282433
741 Ga0070673_101347279
742 Ga0070688_100365027
743 Ga0070688_100798768
744 Ga0070688_100842952
745 Ga0070688_101384531
746 Ga0070659_100363709
747 Ga0070667_100632205
748 Ga0070709_10261840
749 Ga0070709_11258827
750 Ga0070714_100037075
751 Ga0070714_100396990
752 Ga0070714_102105922
753 Ga0070713_100078227
754 Ga0070713_101579665
755 Ga0070710_10546723
756 Ga0070711_100594158
757 Ga0070705_100689996
758 Ga0070705_101895522
759 Ga0070700_100142458
760 Ga0070700_100860508
761 Ga0070694_100766410
762 Ga0070708_100056781
763 Ga0070678_100027456
764 Ga0070678_100424252
765 Ga0070678_101066393
766 Ga0070678_101234882
767 Ga0070662_100032186
768 Ga0070662_100607732
769 Ga0070662_101738702
770 Ga0070681_10235723
771 Ga0070681_10746144
772 Ga0068867_100491170
773 Ga0068867_100591321
774 Ga0070685_10052634
775 Ga0070685_10132551
776 Ga0070685_10887963
777 Ga0070706_100458123
778 Ga0070706_101010357
779 Ga0070707_100398871
780 Ga0070707_101300479
781 Ga0070698_100106483
782 Ga0070699_100003596
783 Ga0070699_100295617
784 Ga0070699_100409294
785 Ga0070679_100055816
786 Ga0070679_101585135
787 Ga0070684_100592882
788 Ga0070684_102149846
789 Ga0068853_100819814
790 Ga0068853_101414851
791 Ga0070672_100003608
792 Ga0070672_100247533
793 Ga0070672_100873095
794 Ga0070672_100945535
795 Ga0070686_100651495
796 Ga0070686_100678423
797 Ga0070696_100786342
798 Ga0070693_100446731
799 Ga0070693_100565330
800 Ga0070665_100425834
801 Ga0070665_100573953
802 Ga0070665_102216797
803 Ga0070704_100381961
804 Ga0070704_101281959
805 Ga0070664_100023692
806 Ga0070664_100753958
807 Ga0070664_101375584
808 Ga0070664_102088485
809 Ga0068857_100123895
810 Ga0068857_100270368
811 Ga0068857_100465412
812 Ga0068857_101725643
813 Ga0068854_101499543
814 Ga0068856_101116049
815 Ga0068856_102107878
816 Ga0070702_100056130
817 Ga0070702_100147085
818 Ga0068852_101706420
819 Ga0068852_102149781
820 Ga0068859_101003934
821 Ga0068859_101474352
822 Ga0068859_101783918
823 Ga0068859_101926123
824 Ga0068859_102038392
825 Ga0068864_100994413
826 Ga0068864_101279164
827 Ga0068864_101712033
828 Ga0068864_102026875
829 Ga0068866_10111020
830 Ga0068861_100271393
831 Ga0068861_101639884
832 Ga0068861_102346520
833 Ga0068870_11279276
834 Ga0068870_11472053
835 Ga0068863_100455393
836 Ga0068863_100821220
837 Ga0068858_101226256
838 Ga0068858_101509410
839 Ga0068858_101752263
840 Ga0068860_100746812
841 Ga0068860_102021817
842 Ga0068860_102466764
843 Ga0068862_100482588
844 Ga0068862_100776781
845 Ga0068862_101002621
846 Ga0081455_10060732
847 Ga0081455_10228486
848 Ga0081455_10715221
849 Ga0081538_10122542
850 Ga0081540_1022126
851 Ga0081540_1150724
852 Ga0081540_1332848
853 Ga0081539_10030610
854 Ga0081539_10054949
855 Ga0081539_10063973
856 Ga0081539_10456225
857 Ga0070717_10148757
858 Ga0070717_10350990
859 Ga0070717_10389445
860 Ga0070717_10788303
861 Ga0070717_11884031
862 Ga0075365_10187250
863 Ga0075365_10721827
864 Ga0075368_10393526
865 Ga0075363_100667890
866 Ga0075363_100678975
867 Ga0075432_10048296
868 Ga0070716_100550978
869 Ga0070716_100751728
870 Ga0070716_101192514
871 Ga0070712_100001353
872 Ga0070712_100223527
873 Ga0070712_100919162
874 Ga0070712_101853671
875 Ga0075367_10183274
876 Ga0075369_10198505
877 Ga0075366_10968091
878 Ga0097621_100357779
879 Ga0075370_10155254
880 Ga0068871_102062673
881 Ga0075428_100521690
882 Ga0075428_100595847
883 Ga0075430_100488947
884 Ga0075431_100560999
885 Ga0075431_100842402
886 Ga0075431_101643507
887 Ga0075431_101832020
888 Ga0075433_10710817
889 Ga0075434_100080095
890 Ga0075434_100154759
891 Ga0075434_101174059
892 Ga0075429_100639886
893 Ga0068865_100252539
894 Ga0068865_100579629
895 Ga0075436_100258388
896 Ga0097620_101003947
897 Ga0097620_101474334
898 Ga0097620_101783833
899 Ga0097620_101926001
900 Ga0097620_102038494
901 Ga0075435_100064410
902 Ga0099795_10026061
903 Ga0111539_10158850
904 Ga0111539_10824628
905 Ga0111539_11855140
906 Ga0111539_12292587
907 Ga0105245_10226388
908 Ga0105245_10355548
909 Ga0105245_11320448
910 Ga0105247_10028084
911 Ga0105247_11807273
912 Ga0114129_10001129
913 Ga0114129_10028330
914 Ga0114129_10082203
915 Ga0114129_10181281
916 Ga0114129_10743832
917 Ga0105243_10097959
918 Ga0105243_10504236
919 Ga0105243_10913392
920 Ga0105241_10604807
921 Ga0105242_10659973
922 Ga0105242_10851523
923 Ga0105242_12818241
924 Ga0105242_12993108
925 Ga0105248_10669799
926 Ga0105248_11356786
927 Ga0105248_11409601
928 Ga0105237_10089750
929 Ga0105238_10278116
930 Ga0105238_10495438
931 Ga0105249_10606969
932 Ga0105249_10865110
933 Ga0105249_10919975
934 Ga0099796_10069024
935 Ga0105239_11007386
936 Ga0105239_13422128
937 Ga0105246_10132617
938 Ga0105246_10163300
939 Ga0105246_11202563
940 Ga0157373_11136300
941 Ga0157370_10965493
942 Ga0157374_10341098
943 Ga0157374_10652651
944 Ga0157374_11137936
945 Ga0157378_10050415
946 Ga0157378_10206126
947 Ga0157378_11179141
948 Ga0157378_11472156
949 Ga0157378_11789258
950 Ga0157378_12344321
951 Ga0157378_12714854
952 Ga0157378_13286091
953 Ga0163162_11116881
954 Ga0163162_11554783
955 Ga0163162_11570305
956 Ga0163162_11899424
957 Ga0157372_10970608
958 Ga0157372_11414335
959 Ga0157372_12145279
960 Ga0157372_12223163
961 Ga0157375_10532144
962 Ga0157375_11822454
963 Ga0163163_10923542
964 Ga0163163_11511684
965 Ga0163163_12038452
966 Ga0157380_10106100
967 Ga0157380_10547680
968 Ga0157380_10598228
969 Ga0157380_10658617
970 Ga0157380_11441213
971 Ga0157377_10298358
972 Ga0157379_10573605
973 Ga0157379_10683260
974 Ga0157379_11031412
975 Ga0157376_10097449
976 Ga0182006_1079560
977 Ga0182005_1004239
978 Ga0163161_10695545
979 Ga0163161_11470151
980 Ga0213874_10049084
981 Ga0209758_1000382
982 Ga0207426_1160178
983 Ga0207697_10045782
984 Ga0207697_10404052
985 Ga0207682_10004843
986 Ga0207642_10267514
987 Ga0207642_11114348
988 Ga0207710_10007613
989 Ga0207688_10023317
990 Ga0207688_10381030
991 Ga0207688_10616201
992 Ga0207680_10244148
993 Ga0207680_11008711
994 Ga0207680_11214678
995 Ga0207647_10228932
996 Ga0207647_10614620
997 Ga0207699_10551163
998 Ga0207645_10064936
999 Ga0207643_10078771
1000 Ga0207684_10094933
1001 Ga0207654_10319037
1002 Ga0207654_10955606
1003 Ga0207707_10642985
1004 Ga0207695_10760504
1005 Ga0207671_10036904
1006 Ga0207693_10018952
1007 Ga0207693_10319099
1008 Ga0207663_11091783
1009 Ga0207660_10159299
1010 Ga0207660_11192203
1011 Ga0207662_10045898
1012 Ga0207662_10141564
1013 Ga0207662_10224299
1014 Ga0207657_10660035
1015 Ga0207652_10047852
1016 Ga0207681_10184595
1017 Ga0207694_10427624
1018 Ga0207694_10672278
1019 Ga0207650_10306444
1020 Ga0207650_10816956
1021 Ga0207650_11055993
1022 Ga0207659_10058268
1023 Ga0207659_10742665
1024 Ga0207659_11157649
1025 Ga0207659_11922646
1026 Ga0207687_10093748
1027 Ga0207687_10328023
1028 Ga0207700_10079752
1029 Ga0207664_10031635
1030 Ga0207664_10392020
1031 Ga0207664_10825676
1032 Ga0207644_10087379
1033 Ga0207644_11188926
1034 Ga0207690_10392299
1035 Ga0207690_11278054
1036 Ga0207706_10011193
1037 Ga0207706_10559973
1038 Ga0207706_11206613
1039 Ga0207706_11282877
1040 Ga0207686_10421424
1041 Ga0207709_10565833
1042 Ga0207670_10091695
1043 Ga0207670_10141990
1044 Ga0207670_10893077
1045 Ga0207669_10015144
1046 Ga0207669_10574377
1047 Ga0207669_11316505
1048 Ga0207704_10358943
1049 Ga0207704_10942206
1050 Ga0207704_11861075
1051 Ga0207665_10264584
1052 Ga0207665_10303027
1053 Ga0207665_10333002
1054 Ga0207691_10009530
1055 Ga0207691_11272278
1056 Ga0207691_11748527
1057 Ga0207711_10352844
1058 Ga0207711_10570743
1059 Ga0207711_11331324
1060 Ga0207689_10019408
1061 Ga0207689_10251071
1062 Ga0207689_10874953
1063 Ga0207661_10100753
1064 Ga0207679_10056453
1065 Ga0207679_10283539
1066 Ga0207651_10141953
1067 Ga0207651_10395730
1068 Ga0207712_10211899
1069 Ga0207712_10305663
1070 Ga0207712_10543907
1071 Ga0207668_10357495
1072 Ga0207668_11426094
1073 Ga0207640_11426051
1074 Ga0207658_10879341
1075 Ga0207658_11614789
1076 Ga0207677_10092272
1077 Ga0207677_10966239
1078 Ga0207677_11268993
1079 Ga0207677_11500252
1080 Ga0207703_10083020
1081 Ga0207639_10389366
1082 Ga0207639_12076037
1083 Ga0207678_11616370
1084 Ga0207708_10472265
1085 Ga0207708_10679901
1086 Ga0207702_11152063
1087 Ga0207641_11185236
1088 Ga0207641_11308035
1089 Ga0207648_10274009
1090 Ga0207648_10621165
1091 Ga0207648_11975813
1092 Ga0207648_12104874
1093 Ga0207648_12206058
1094 Ga0207676_10007072
1095 Ga0207676_11437595
1096 Ga0207676_11503024
1097 Ga0207676_11574646
1098 Ga0207674_10582254
1099 Ga0207674_11012996
1100 Ga0207675_100195519
1101 Ga0207675_100352300
1102 Ga0207675_102138529
1103 Ga0207683_10003726
1104 Ga0207698_10543445
1105 Ga0207698_11857386
1106 Ga0207698_12272958
1107 Ga0209179_1006395
1108 Ga0207428_10174990
1109 Ga0268266_10516851
1110 Ga0268266_10731597
1111 Ga0268266_10787380
1112 Ga0268266_11323983
1113 Ga0268265_10339017
1114 Ga0268265_11630160
1115 Ga0268264_11763516
1116 Ga0307515_10879543
1117 Ga0265338_10533486
1118 Ga0265762_1045285
1119 Ga0265760_10079917
1120 Ga0265760_10175455
1121 Ga0265330_10173837
1122 Ga0265325_10000280
1123 Ga0265325_10034628
1124 Ga0265325_10182756
1125 Ga0265340_10051588
1126 Ga0265340_10286765
1127 Ga0265339_10048676
1128 Ga0265339_10218487
1129 Ga0265316_10106470
1130 Ga0265316_10478889
1131 Ga0307513_10674036
1132 Ga0265313_10000577
1133 Ga0265313_10029611
1134 Ga0265313_10162110
1135 Ga0265342_10088463
1136 Ga0307405_11243133
1137 Ga0307416_100971497
1138 Ga0307416_101718716
1139 Ga0307411_11872171
1140 Ga0307415_101280558
1141 Ga0373948_0119869
1142 Ga0373934_0020503
1143 Ga0373923_0014916
1144 Ga0373932_0091946
1145 Ga0373936_0078106
1146 Ga0373936_0276524
1147 Ga0373941_0183299
1148 Ga0373941_0364496
1149 Ga0373953_0039291
1150 Ga0373954_0009390
1151 Ga0373946_0230058
1152 Ga0373961_0087934
1153 Ga0373924_0021218
1154 Ga0373935_0067539
1155 Ga0373927_0156953
1156 Ga0373927_0524529
1157 Ga0373927_0724588
1158 Ga0373933_0051004
1159 Ga0373947_0021654
1160 Ga0373947_0614447
1161 Ga0373937_0000901
1162 Ga0373937_0708644
1163 Ga0373925_0035552
1164 Ga0395899_0671292
1165 Ga0395900_0618886
1166 Ga0395898_0191417
1167 Ga0436364_0152521
1168 Ga0436364_0398761
1169 Ga0436364_0742195
1170 Ga0395901_0137161
1171 Ga0436365_0014209
1172 Ga0436365_0177825
1173 Ga0436365_1725208
1174 Ga0436360_1105132
1175 Ga0436361_0596429
1176 Ga0436361_0963726
1177 Ga0436363_0309884
1178 Ga0436363_1069585
1179 Ga0436363_1456055
1180 Ga0436363_1654571
1181 Ga0439453_0009361
1182 Ga0451789_1024604
1183 Ga0451791_1594538
1184 Ga0451793_1074372
1185 Ga0451843_1566498
1186 Ga0451853_3610269
1187 Ga0439437_017595
1188 Ga0439441_020201
1189 Ga0439434_0077243
1190 Ga0439435_0040509
1191 Ga0439459_0033518
1192 Ga0439464_0124016
1193 Ga0439460_0015229
1194 Ga0439460_0096311
1195 Ga0439440_0072258
1196 Ga0466968_0272075
1197 Ga0451576_1171576
1198 Ga0466967_2206371
1199 Ga0466967_2263155
1200 Ga0495592_0056742
1201 Ga0495629_0003741
1202 Ga0495638_0184592
1203 Ga0495651_0030149
1204 Ga0495653_0010719
1205 Ga0495605_0087665
1206 Ga0495606_0565809
1207 Ga0495608_0007302
1208 Ga0495618_0032039
1209 Ga0495628_0154674
1210 Ga0495630_0300753
1211 Ga0495631_0165482
1212 Ga0495632_0273143
1213 Ga0495663_0072667
1214 Ga0495666_0348224
1215 Ga0495652_0026791
1216 Ga0495640_0015526
1217 Ga0495587_0017301
1218 Ga0495598_0014350
1219 Ga0495598_0135514
1220 Ga0495621_0041406
1221 Ga0495645_0552641
1222 Ga0495633_0124812
1223 Ga0495667_0018750
1224 Ga0495656_0010323
1225 Ga0495668_0344476
1226 Ga0495634_0053497
1227 Ga0495611_0497836
1228 Ga0495635_0008348
1229 Ga0495657_0036684
1230 Ga0495599_0137115
1231 Ga0495623_0010533
1232 Ga0495646_0015118
1233 Ga0495658_0091053
1234 Ga0495624_0025419
1235 Ga0495670_0167985
1236 Ga0495600_0074727
1237 Ga0495581_0051202
1238 Ga0495581_0878721
1239 Ga0495604_0001599
1240 Ga0495674_0025244
1241 Ga0495672_0314214
1242 Ga0495676_0015300
1243 Ga0495680_0061998
1244 Ga0495675_0010964
1245 Ga0495677_0153429
1246 Ga0495684_0023561
1247 Ga0495593_0057175
1248 Ga0495602_0032519
1249 Ga0495626_0384469
1250 Ga0496100_0019583
1251 Ga0496100_0330361
1252 Ga0496101_0005190
1253 Ga0496102_0019521
1254 Ga0496104_0272716
1255 Ga0496105_0125581
1256 Ga0496106_0024132
1257 Ga0496106_0801065
1258 Ga0496107_0009728
1259 Ga0496108_0352082
1260 Ga0496109_0436802
1261 Ga0496109_1491644
1262 Ga0496110_0315676
1263 Ga0496110_0412987
1264 Ga0496110_0728385
1265 Ga0496111_0019254
1266 Ga0496111_0234238
1267 Ga0496112_0081390
1268 Ga0496112_0387056
1269 Ga0496112_1391446
1270 Ga0496112_1606656
1271 Ga0496114_0381587
1272 Ga0496115_0608291
1273 Ga0496124_0982137
1274 Ga0496126_0097680
1275 Ga0501033_0198630
1276 Ga0501034_0209404
1277 Ga0501043_0121837
1278 Ga0501047_0147984
1279 Ga0501048_0791914
1280 Ga0501067_0122733
1281 Ga0501067_0271564
1282 Ga0501068_0186041
1283 Ga0501069_0014076
1284 Ga0501069_0213123
1285 Ga0501070_0303010
1286 Ga0501072_0002854
1287 Ga0501073_0071111
1288 Ga0501074_0181262
1289 Ga0501079_0147190
1290 Ga0501079_0947651
1291 Ga0501080_0011965
1292 Ga0501083_0042269
1293 Ga0501083_0111907
1294 Ga0501083_0185952
1295 Ga0501083_0247219
1296 Ga0501035_0251718
1297 Ga0501044_0615008
1298 Ga0501044_1496158
1299 nmdc:mga0yw44_39829_c1
1300 nmdc:mga0yw44_93834_c1
1301 nmdc:mga0k408_536033_c1
1302 nmdc:mga0k408_538263_c1
1303 nmdc:mga06z11_178462_c1
1304 nmdc:mga07m45_472048_c1
1305 nmdc:mga05p37_111208_c1
1306 nmdc:mga05p37_1411474_c1
1307 nmdc:mga05p37_29701_c1
1308 nmdc:mga05p37_743_c1
1309 nmdc:mga09592_1700709_c1
1310 nmdc:mga09592_781_c1
1311 nmdc:mga0qj67_154905_c1
1312 nmdc:mga0qj67_72223_c1
1313 nmdc:mga06r32_1356280_c1
1314 nmdc:mga06r32_1439194_c1
1315 nmdc:mga06r32_19037_c1
1316 nmdc:mga08y16_1137901_c1
1317 nmdc:mga08y16_121_c1
1318 nmdc:mga08y16_1396061_c1
1319 nmdc:mga08y16_1612085_c1
1320 nmdc:mga08y16_64145_c1
1321 nmdc:mga0n895_1069463_c1
1322 nmdc:mga0n895_252933_c1
1323 nmdc:mga0n895_41006_c1
1324 nmdc:mga0rr50_538245_c1
1325 nmdc:mga0rr50_637900_c1
1326 nmdc:mga08x19_485917_c1
1327 nmdc:mga0a205_475487_c1
1328 nmdc:mga0a205_770773_c1
1329 Ga0495601_0000582
1330 Ga0495601_0021693
1331 Ga0495612_0005167
1332 Ga0495612_0087197
1333 Ga0500610_0301181
1334 Ga0495595_0000566
1335 Ga0495619_0041413
1336 Ga0500578_0488075
1337 Ga0500644_0454708
1338 Ga0500651_0592951
1339 Ga0500641_0081507
1340 Ga0500650_0223033
1341 Ga0500654_056395
1342 Ga0500555_180345
1343 Ga0500562_026487
1344 Ga0500594_0038583
1345 Ga0500595_008211
1346 Ga0500621_202874
1347 Ga0500642_0024256
1348 Ga0500642_0450470
1349 Ga0500658_0060463
1350 Ga0500568_0076490
1351 Ga0500577_0311435
1352 Ga0500588_0109960
1353 Ga0500589_211292
1354 Ga0500604_0006108
1355 Ga0500622_0409902
1356 Ga0500627_0325494
1357 Ga0501084_0434027
1358 Ga0501084_0614727
1359 Ga0501084_0698959
1360 Ga0587076_207110
1361 Ga0501082_0000486
1362 Ga0501082_1097562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04325

DUF465

Protein of unknown function (DUF465)

21

54

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j0k-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9559 3 60
7n6g-assembly1.cif.gz_3I c1 of central pair 0.9519 3 54
4f7r-assembly2.cif.gz_C crystal structure of 14-3-3 protein from giardia intestinalis 0.9384 7 55
5j0k-assembly1.cif.gz_A de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.936 3 60
2gd5-assembly1.cif.gz_A structural basis for budding by the escrtiii factor chmp3 0.9351 3 57
ID Description Score Start End Superfamily
af_G5EDP9_124_333_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9804 3 59 1.20.1270.60
af_Q84R10_15_144_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.9801 3 54 1.20.140.40
af_O13816_119_876_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9698 3 54 1.25.10.10
af_P48606_1_106_1.20.58.90 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.9509 3 55 1.20.58.90
af_P40541_155_1063_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9484 3 54 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A0S3KGX6-F1-model_v4 deleted 1.004 3 53
AF-A0A450VTP0-F1-model_v4 Uncharacterized protein 1.002 3 55
AF-C5I4C4-F1-model_v4 Pneumococcal surface protein A 1.001 3 55
AF-A0A3N9MTC8-F1-model_v4 Uncharacterized protein 1 3 59
AF-A0A1M6NBX3-F1-model_v4 Uncharacterized protein 0.9978 3 55

Map