F474824
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 681 | 267 | 681 | 286 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100306483|Ga0068855_1003064832 |
| Length | 303 |
| Sequence | MRIASCRTNRGDNPETPVKNYSIAIALFLAVLAGQAGAQQLQGTLKKIADTKTIRLGYLKEGVPFSFADVPGKPIGYSVDICQHIVTGIQRQLGLTQLDVKWVEVNTANRFDRVADGTIDMECGTSTITLARQKQVDFSLMTWVDGGTFLVKPEMPVKLLADLAGKRIAVIEGTTTDKALRDALAQRYINAQIVTVKEHLEGLNAVANGQADAYAGDQTVLIGLALAVGTQIQLQLAEGQFSFEPYGLAMRRNDPDFKLAVNTVLARLYRSAQIMEVYERWFGKFGKPSPSIIAVYMLNGVPE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 3 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 77 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 166 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 197 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 203 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 204 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 205 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 206 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 207 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 208 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 209 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 220 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 264 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 265 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 266 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.44 |
| Nodule | 0.29 |
| Rhizoplane | 0.88 |
| Rhizosphere | 98.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1476970 | 2162886006 | Bacteria | 1194 |
| 2 | Ga0055524_1000307 | 3300003775 | Bacteria | 46545 |
| 3 | JGI25405J52794_10003167 | 3300003911 | Bacteria | 2867 |
| 4 | Ga0065712_10000569 | 3300005290 | Bacteria | 16026 |
| 5 | Ga0065712_10068007 | 3300005290 | Bacteria | 17374 |
| 6 | Ga0065715_10000426 | 3300005293 | Bacteria | 19372 |
| 7 | Ga0065715_10009394 | 3300005293 | Bacteria | 5401 |
| 8 | Ga0065715_10114658 | 3300005293 | Bacteria | 2443 |
| 9 | Ga0065707_10003569 | 3300005295 | Bacteria | 5455 |
| 10 | Ga0065707_10010381 | 3300005295 | Bacteria | 2938 |
| 11 | Ga0065707_10013686 | 3300005295 | Bacteria | 2076 |
| 12 | Ga0065707_10033544 | 3300005295 | Bacteria | 1578 |
| 13 | Ga0065707_10098051 | 3300005295 | Bacteria | 3117 |
| 14 | Ga0070658_10202046 | 3300005327 | Unclassified | 1677 |
| 15 | Ga0070676_10006146 | 3300005328 | Bacteria | 6413 |
| 16 | Ga0070690_100001728 | 3300005330 | Bacteria | 11534 |
| 17 | Ga0070690_100007358 | 3300005330 | Bacteria | 6303 |
| 18 | Ga0070690_100195632 | 3300005330 | Bacteria | 1404 |
| 19 | Ga0070670_100000241 | 3300005331 | Bacteria | 49604 |
| 20 | Ga0070670_100011459 | 3300005331 | Bacteria | 7584 |
| 21 | Ga0068869_100012652 | 3300005334 | Bacteria | 5582 |
| 22 | Ga0068869_100050505 | 3300005334 | Bacteria | 3014 |
| 23 | Ga0068869_100087233 | 3300005334 | Bacteria | 2341 |
| 24 | Ga0068869_100310188 | 3300005334 | Bacteria | 1277 |
| 25 | Ga0070666_10023588 | 3300005335 | Bacteria | 4005 |
| 26 | Ga0070680_100001386 | 3300005336 | Bacteria | 17512 |
| 27 | Ga0070680_100017312 | 3300005336 | Bacteria | 5679 |
| 28 | Ga0070680_100022831 | 3300005336 | Bacteria | 4984 |
| 29 | Ga0070680_100055288 | 3300005336 | Bacteria | 3243 |
| 30 | Ga0070680_100160637 | 3300005336 | Bacteria | 1888 |
| 31 | Ga0070682_100000179 | 3300005337 | Bacteria | 47429 |
| 32 | Ga0070682_100027582 | 3300005337 | Bacteria | 3409 |
| 33 | Ga0068868_100029544 | 3300005338 | Bacteria | 4198 |
| 34 | Ga0070660_100009221 | 3300005339 | Bacteria | 6932 |
| 35 | Ga0070660_100136885 | 3300005339 | Bacteria | 1962 |
| 36 | Ga0070689_100015332 | 3300005340 | Bacteria | 5586 |
| 37 | Ga0070689_100041651 | 3300005340 | Bacteria | 3525 |
| 38 | Ga0070691_10002490 | 3300005341 | Bacteria | 8194 |
| 39 | Ga0070691_10003903 | 3300005341 | Bacteria | 6747 |
| 40 | Ga0070687_100029307 | 3300005343 | Bacteria | 2679 |
| 41 | Ga0070687_100071564 | 3300005343 | Bacteria | 1864 |
| 42 | Ga0070687_100154047 | 3300005343 | Bacteria | 1352 |
| 43 | Ga0070661_100001244 | 3300005344 | Bacteria | 17902 |
| 44 | Ga0070661_100064324 | 3300005344 | Bacteria | 2695 |
| 45 | Ga0070692_10004506 | 3300005345 | Bacteria | 5826 |
| 46 | Ga0070692_10005570 | 3300005345 | Bacteria | 5386 |
| 47 | Ga0070692_10037555 | 3300005345 | Bacteria | 2463 |
| 48 | Ga0070668_100167641 | 3300005347 | Bacteria | 1786 |
| 49 | Ga0070669_100062838 | 3300005353 | Bacteria | 2731 |
| 50 | Ga0070669_100067667 | 3300005353 | Bacteria | 2635 |
| 51 | Ga0070675_100015962 | 3300005354 | Bacteria | 5950 |
| 52 | Ga0070675_100047188 | 3300005354 | Bacteria | 3529 |
| 53 | Ga0070675_100405175 | 3300005354 | Bacteria | 1217 |
| 54 | Ga0070671_100123386 | 3300005355 | Bacteria | 2180 |
| 55 | Ga0070671_100155151 | 3300005355 | Bacteria | 1934 |
| 56 | Ga0070674_100171294 | 3300005356 | Bacteria | 1655 |
| 57 | Ga0070674_100171886 | 3300005356 | Bacteria | 1653 |
| 58 | Ga0070673_100009896 | 3300005364 | Bacteria | 6424 |
| 59 | Ga0070673_100150891 | 3300005364 | Bacteria | 1968 |
| 60 | Ga0070688_100200044 | 3300005365 | Bacteria | 1397 |
| 61 | Ga0070659_100000831 | 3300005366 | Bacteria | 22519 |
| 62 | Ga0070659_100070890 | 3300005366 | Bacteria | 2770 |
| 63 | Ga0070659_100103382 | 3300005366 | Bacteria | 2294 |
| 64 | Ga0070667_100009817 | 3300005367 | Bacteria | 7934 |
| 65 | Ga0070701_10014437 | 3300005438 | Bacteria | 3622 |
| 66 | Ga0070701_10025346 | 3300005438 | Bacteria | 2879 |
| 67 | Ga0070701_10028186 | 3300005438 | Bacteria | 2759 |
| 68 | Ga0070701_10111425 | 3300005438 | Bacteria | 1529 |
| 69 | Ga0070711_100053264 | 3300005439 | Bacteria | 2788 |
| 70 | Ga0070705_100001080 | 3300005440 | Bacteria | 15131 |
| 71 | Ga0070705_100034025 | 3300005440 | Bacteria | 2845 |
| 72 | Ga0070705_100205647 | 3300005440 | Bacteria | 1353 |
| 73 | Ga0070700_100014869 | 3300005441 | Bacteria | 4399 |
| 74 | Ga0070700_100093866 | 3300005441 | Bacteria | 1964 |
| 75 | Ga0070700_100188399 | 3300005441 | Bacteria | 1441 |
| 76 | Ga0070694_100000224 | 3300005444 | Bacteria | 29764 |
| 77 | Ga0070694_100003004 | 3300005444 | Bacteria | 10035 |
| 78 | Ga0070694_100008818 | 3300005444 | Bacteria | 6178 |
| 79 | Ga0070694_100017968 | 3300005444 | Bacteria | 4479 |
| 80 | Ga0070694_100018562 | 3300005444 | Bacteria | 4415 |
| 81 | Ga0070694_100023175 | 3300005444 | Bacteria | 3989 |
| 82 | Ga0070694_100038937 | 3300005444 | Bacteria | 3161 |
| 83 | Ga0070708_100028448 | 3300005445 | Bacteria | 4809 |
| 84 | Ga0070708_100457454 | 3300005445 | Bacteria | 1204 |
| 85 | Ga0070663_100050570 | 3300005455 | Bacteria | 2957 |
| 86 | Ga0070663_100096591 | 3300005455 | Bacteria | 2198 |
| 87 | Ga0070678_100046894 | 3300005456 | Bacteria | 3102 |
| 88 | Ga0070678_100061976 | 3300005456 | Bacteria | 2759 |
| 89 | Ga0070678_100219641 | 3300005456 | Bacteria | 1579 |
| 90 | Ga0070662_100015674 | 3300005457 | Bacteria | 5082 |
| 91 | Ga0070681_10019365 | 3300005458 | Bacteria | 6811 |
| 92 | Ga0070681_10026811 | 3300005458 | Bacteria | 5793 |
| 93 | Ga0068867_100007078 | 3300005459 | Bacteria | 7926 |
| 94 | Ga0070706_100221774 | 3300005467 | Bacteria | 1765 |
| 95 | Ga0070706_100340272 | 3300005467 | Bacteria | 1399 |
| 96 | Ga0070706_100384195 | 3300005467 | Bacteria | 1307 |
| 97 | Ga0070707_100011228 | 3300005468 | Bacteria | 8347 |
| 98 | Ga0070707_100018261 | 3300005468 | Bacteria | 6599 |
| 99 | Ga0070707_100025476 | 3300005468 | Bacteria | 5611 |
| 100 | Ga0070707_100164030 | 3300005468 | Bacteria | 2165 |
| 101 | Ga0070707_100233555 | 3300005468 | Bacteria | 1790 |
| 102 | Ga0070698_100028441 | 3300005471 | Bacteria | 5806 |
| 103 | Ga0070698_100366466 | 3300005471 | Bacteria | 1373 |
| 104 | Ga0070698_100571346 | 3300005471 | Bacteria | 1070 |
| 105 | Ga0070698_100693880 | 3300005471 | Unclassified | 960 |
| 106 | Ga0070699_100043701 | 3300005518 | Bacteria | 3878 |
| 107 | Ga0070699_100201344 | 3300005518 | Bacteria | 1771 |
| 108 | Ga0070699_100332078 | 3300005518 | Bacteria | 1368 |
| 109 | Ga0070699_100401869 | 3300005518 | Bacteria | 1239 |
| 110 | Ga0070699_100457426 | 3300005518 | Bacteria | 1157 |
| 111 | Ga0070699_100474058 | 3300005518 | Bacteria | 1136 |
| 112 | Ga0070679_100001386 | 3300005530 | Bacteria | 21340 |
| 113 | Ga0070679_100050772 | 3300005530 | Bacteria | 4131 |
| 114 | Ga0070679_100072710 | 3300005530 | Bacteria | 3430 |
| 115 | Ga0070684_100290083 | 3300005535 | Bacteria | 1500 |
| 116 | Ga0070697_100009161 | 3300005536 | Bacteria | 7733 |
| 117 | Ga0070697_100014184 | 3300005536 | Bacteria | 6258 |
| 118 | Ga0070697_100031141 | 3300005536 | Bacteria | 4289 |
| 119 | Ga0070697_100109797 | 3300005536 | Bacteria | 2297 |
| 120 | Ga0070697_100112358 | 3300005536 | Bacteria | 2272 |
| 121 | Ga0070697_100198555 | 3300005536 | Bacteria | 1705 |
| 122 | Ga0070697_100308162 | 3300005536 | Bacteria | 1362 |
| 123 | Ga0070697_100339168 | 3300005536 | Bacteria | 1297 |
| 124 | Ga0068853_100013726 | 3300005539 | Bacteria | 6618 |
| 125 | Ga0068853_100595176 | 3300005539 | Bacteria | 1050 |
| 126 | Ga0068853_100690159 | 3300005539 | Unclassified | 973 |
| 127 | Ga0068853_100695837 | 3300005539 | Bacteria | 969 |
| 128 | Ga0070672_100055242 | 3300005543 | Bacteria | 3110 |
| 129 | Ga0070686_100028942 | 3300005544 | Bacteria | 3364 |
| 130 | Ga0070686_100069349 | 3300005544 | Bacteria | 2303 |
| 131 | Ga0070695_100007445 | 3300005545 | Bacteria | 6489 |
| 132 | Ga0070695_100017441 | 3300005545 | Bacteria | 4353 |
| 133 | Ga0070695_100033167 | 3300005545 | Bacteria | 3230 |
| 134 | Ga0070695_100065518 | 3300005545 | Bacteria | 2366 |
| 135 | Ga0070695_100158984 | 3300005545 | Bacteria | 1584 |
| 136 | Ga0070696_100001530 | 3300005546 | Bacteria | 15168 |
| 137 | Ga0070696_100044218 | 3300005546 | Bacteria | 3083 |
| 138 | Ga0070696_100069326 | 3300005546 | Bacteria | 2477 |
| 139 | Ga0070696_100079092 | 3300005546 | Bacteria | 2326 |
| 140 | Ga0070693_100003136 | 3300005547 | Bacteria | 7676 |
| 141 | Ga0070693_100116275 | 3300005547 | Bacteria | 1653 |
| 142 | Ga0070665_100602142 | 3300005548 | Unclassified | 1112 |
| 143 | Ga0070704_100001927 | 3300005549 | Bacteria | 11464 |
| 144 | Ga0070704_100184482 | 3300005549 | Bacteria | 1672 |
| 145 | Ga0070704_100618756 | 3300005549 | Unclassified | 953 |
| 146 | Ga0068855_100004335 | 3300005563 | Bacteria | 17345 |
| 147 | Ga0068855_100306483 | 3300005563 | Bacteria | 1758 |
| 148 | Ga0070664_100001253 | 3300005564 | Bacteria | 20319 |
| 149 | Ga0070664_100009717 | 3300005564 | Bacteria | 7799 |
| 150 | Ga0068857_100014057 | 3300005577 | Bacteria | 6966 |
| 151 | Ga0068857_100583951 | 3300005577 | Bacteria | 1055 |
| 152 | Ga0068854_100027889 | 3300005578 | Bacteria | 3895 |
| 153 | Ga0068856_100007569 | 3300005614 | Bacteria | 10595 |
| 154 | Ga0068856_100012019 | 3300005614 | Bacteria | 8388 |
| 155 | Ga0070702_100017997 | 3300005615 | Bacteria | 3656 |
| 156 | Ga0070702_100133252 | 3300005615 | Bacteria | 1572 |
| 157 | Ga0070702_100133666 | 3300005615 | Bacteria | 1571 |
| 158 | Ga0068852_100019708 | 3300005616 | Bacteria | 5347 |
| 159 | Ga0068859_100010607 | 3300005617 | Bacteria | 9272 |
| 160 | Ga0068859_100125629 | 3300005617 | Plasmid | 2634 |
| 161 | Ga0068859_100203666 | 3300005617 | Bacteria | 2064 |
| 162 | Ga0068859_100264747 | 3300005617 | Bacteria | 1811 |
| 163 | Ga0068859_100745944 | 3300005617 | Unclassified | 1068 |
| 164 | Ga0068864_100002599 | 3300005618 | Bacteria | 14926 |
| 165 | Ga0068864_100261819 | 3300005618 | Unclassified | 1609 |
| 166 | Ga0068866_10000828 | 3300005718 | Bacteria | 13724 |
| 167 | Ga0068866_10083410 | 3300005718 | Bacteria | 1722 |
| 168 | Ga0068866_10211184 | 3300005718 | Bacteria | 1165 |
| 169 | Ga0068861_100054063 | 3300005719 | Bacteria | 3058 |
| 170 | Ga0068861_100134543 | 3300005719 | Bacteria | 2010 |
| 171 | Ga0068870_10013306 | 3300005840 | Bacteria | 3865 |
| 172 | Ga0068870_10031139 | 3300005840 | Bacteria | 2701 |
| 173 | Ga0068870_10098751 | 3300005840 | Bacteria | 1646 |
| 174 | Ga0068863_100009792 | 3300005841 | Bacteria | 9343 |
| 175 | Ga0068863_100117421 | 3300005841 | Bacteria | 2535 |
| 176 | Ga0068858_100035026 | 3300005842 | Bacteria | 4657 |
| 177 | Ga0068858_100086733 | 3300005842 | Bacteria | 2912 |
| 178 | Ga0068858_100101985 | 3300005842 | Bacteria | 2677 |
| 179 | Ga0068860_100035984 | 3300005843 | Bacteria | 4746 |
| 180 | Ga0068860_100061678 | 3300005843 | Bacteria | 3562 |
| 181 | Ga0068860_100078383 | 3300005843 | Bacteria | 3142 |
| 182 | Ga0068862_100005264 | 3300005844 | Bacteria | 10850 |
| 183 | Ga0068862_100063481 | 3300005844 | Bacteria | 3178 |
| 184 | Ga0068862_100133152 | 3300005844 | Bacteria | 2200 |
| 185 | Ga0068862_100226026 | 3300005844 | Bacteria | 1696 |
| 186 | Ga0068862_100232690 | 3300005844 | Unclassified | 1672 |
| 187 | Ga0081455_10000592 | 3300005937 | Bacteria | 46956 |
| 188 | Ga0081455_10000729 | 3300005937 | Bacteria | 42710 |
| 189 | Ga0081455_10061577 | 3300005937 | Bacteria | 3157 |
| 190 | Ga0081538_10002311 | 3300005981 | Bacteria | 18818 |
| 191 | Ga0081538_10003654 | 3300005981 | Bacteria | 14451 |
| 192 | Ga0081540_1001918 | 3300005983 | Bacteria | 17425 |
| 193 | Ga0075432_10017183 | 3300006058 | Bacteria | 2469 |
| 194 | Ga0070715_10074406 | 3300006163 | Bacteria | 1526 |
| 195 | Ga0070716_100009838 | 3300006173 | Bacteria | 4778 |
| 196 | Ga0070712_100153368 | 3300006175 | Bacteria | 1771 |
| 197 | Ga0070712_100282856 | 3300006175 | Bacteria | 1336 |
| 198 | Ga0097621_100043957 | 3300006237 | Bacteria | 3603 |
| 199 | Ga0097621_100241944 | 3300006237 | Bacteria | 1578 |
| 200 | Ga0068871_100087053 | 3300006358 | Bacteria | 2596 |
| 201 | Ga0068871_100090839 | 3300006358 | Bacteria | 2544 |
| 202 | Ga0075430_100113233 | 3300006846 | Bacteria | 2261 |
| 203 | Ga0075430_100141085 | 3300006846 | Bacteria | 2007 |
| 204 | Ga0075430_100162306 | 3300006846 | Bacteria | 1860 |
| 205 | Ga0075430_100243360 | 3300006846 | Bacteria | 1491 |
| 206 | Ga0075431_100000693 | 3300006847 | Bacteria | 28995 |
| 207 | Ga0075431_100013006 | 3300006847 | Bacteria | 8405 |
| 208 | Ga0075431_100029643 | 3300006847 | Bacteria | 5635 |
| 209 | Ga0075431_100145348 | 3300006847 | Bacteria | 2444 |
| 210 | Ga0075431_100197388 | 3300006847 | Bacteria | 2060 |
| 211 | Ga0075431_100309626 | 3300006847 | Bacteria | 1594 |
| 212 | Ga0075433_10002692 | 3300006852 | Bacteria | 13566 |
| 213 | Ga0075433_10005196 | 3300006852 | Bacteria | 10198 |
| 214 | Ga0075433_10038361 | 3300006852 | Bacteria | 4137 |
| 215 | Ga0075433_10048994 | 3300006852 | Bacteria | 3675 |
| 216 | Ga0075433_10052962 | 3300006852 | Bacteria | 3537 |
| 217 | Ga0075433_10099875 | 3300006852 | Bacteria | 2569 |
| 218 | Ga0075433_10132243 | 3300006852 | Bacteria | 2217 |
| 219 | Ga0075433_10156533 | 3300006852 | Bacteria | 2027 |
| 220 | Ga0075433_10336838 | 3300006852 | Bacteria | 1333 |
| 221 | Ga0075434_100000912 | 3300006871 | Bacteria | 23726 |
| 222 | Ga0075434_100003395 | 3300006871 | Bacteria | 14264 |
| 223 | Ga0075434_100007287 | 3300006871 | Bacteria | 10234 |
| 224 | Ga0075434_100043308 | 3300006871 | Bacteria | 4464 |
| 225 | Ga0075434_100050614 | 3300006871 | Bacteria | 4127 |
| 226 | Ga0075434_100051353 | 3300006871 | Bacteria | 4098 |
| 227 | Ga0075434_100053087 | 3300006871 | Bacteria | 4028 |
| 228 | Ga0075434_100090497 | 3300006871 | Bacteria | 3061 |
| 229 | Ga0075434_100379040 | 3300006871 | Unclassified | 1435 |
| 230 | Ga0075434_100664921 | 3300006871 | Bacteria | 1060 |
| 231 | Ga0075429_100268518 | 3300006880 | Bacteria | 1494 |
| 232 | Ga0075429_100594286 | 3300006880 | Unclassified | 970 |
| 233 | Ga0068865_100001220 | 3300006881 | Bacteria | 14953 |
| 234 | Ga0068865_100072944 | 3300006881 | Bacteria | 2440 |
| 235 | Ga0068865_100086951 | 3300006881 | Bacteria | 2258 |
| 236 | Ga0068865_100430228 | 3300006881 | Bacteria | 1087 |
| 237 | Ga0075436_100013488 | 3300006914 | Bacteria | 5595 |
| 238 | Ga0075436_100066888 | 3300006914 | Bacteria | 2484 |
| 239 | Ga0075436_100078664 | 3300006914 | Bacteria | 2284 |
| 240 | Ga0075436_100144203 | 3300006914 | Bacteria | 1674 |
| 241 | Ga0097620_100010607 | 3300006931 | Bacteria | 9272 |
| 242 | Ga0097620_100125627 | 3300006931 | Plasmid | 2634 |
| 243 | Ga0097620_100203657 | 3300006931 | Bacteria | 2064 |
| 244 | Ga0097620_100264735 | 3300006931 | Bacteria | 1811 |
| 245 | Ga0097620_100745912 | 3300006931 | Unclassified | 1068 |
| 246 | Ga0079104_1000009 | 3300006946 | Bacteria | 367015 |
| 247 | Ga0075435_100005380 | 3300007076 | Bacteria | 8929 |
| 248 | Ga0075435_100017406 | 3300007076 | Bacteria | 5441 |
| 249 | Ga0075435_100089479 | 3300007076 | Bacteria | 2538 |
| 250 | Ga0075435_100096467 | 3300007076 | Bacteria | 2446 |
| 251 | Ga0075435_100131920 | 3300007076 | Bacteria | 2091 |
| 252 | Ga0075435_100376734 | 3300007076 | Bacteria | 1219 |
| 253 | Ga0099794_10046632 | 3300007265 | Bacteria | 2076 |
| 254 | Ga0099794_10057056 | 3300007265 | Bacteria | 1891 |
| 255 | Ga0111539_10000535 | 3300009094 | Bacteria | 48283 |
| 256 | Ga0111539_10156466 | 3300009094 | Bacteria | 2667 |
| 257 | Ga0111539_10168183 | 3300009094 | Bacteria | 2562 |
| 258 | Ga0111539_10172094 | 3300009094 | Bacteria | 2530 |
| 259 | Ga0111539_10192855 | 3300009094 | Bacteria | 2377 |
| 260 | Ga0111539_10254829 | 3300009094 | Bacteria | 2043 |
| 261 | Ga0111539_10287538 | 3300009094 | Bacteria | 1913 |
| 262 | Ga0111539_10704697 | 3300009094 | Unclassified | 1175 |
| 263 | Ga0105245_10012460 | 3300009098 | Bacteria | 7399 |
| 264 | Ga0105245_10028254 | 3300009098 | Bacteria | 4945 |
| 265 | Ga0105245_10065664 | 3300009098 | Bacteria | 3282 |
| 266 | Ga0114129_10010794 | 3300009147 | Bacteria | 13013 |
| 267 | Ga0114129_10013685 | 3300009147 | Bacteria | 11559 |
| 268 | Ga0114129_10022306 | 3300009147 | Bacteria | 8989 |
| 269 | Ga0114129_10046422 | 3300009147 | Bacteria | 6104 |
| 270 | Ga0114129_10090914 | 3300009147 | Bacteria | 4230 |
| 271 | Ga0114129_10117245 | 3300009147 | Bacteria | 3669 |
| 272 | Ga0114129_10121943 | 3300009147 | Bacteria | 3587 |
| 273 | Ga0114129_10188584 | 3300009147 | Bacteria | 2801 |
| 274 | Ga0114129_10423867 | 3300009147 | Bacteria | 1750 |
| 275 | Ga0114129_10459872 | 3300009147 | Bacteria | 1668 |
| 276 | Ga0114129_10631420 | 3300009147 | Bacteria | 1384 |
| 277 | Ga0114129_10957149 | 3300009147 | Unclassified | 1081 |
| 278 | Ga0105243_10035210 | 3300009148 | Bacteria | 3881 |
| 279 | Ga0105243_10101342 | 3300009148 | Bacteria | 2391 |
| 280 | Ga0105243_10116181 | 3300009148 | Bacteria | 2247 |
| 281 | Ga0105243_10293324 | 3300009148 | Bacteria | 1470 |
| 282 | Ga0105241_10009789 | 3300009174 | Bacteria | 7044 |
| 283 | Ga0105241_10084670 | 3300009174 | Bacteria | 2490 |
| 284 | Ga0105242_10052063 | 3300009176 | Bacteria | 3339 |
| 285 | Ga0105242_10087728 | 3300009176 | Bacteria | 2612 |
| 286 | Ga0105242_10260422 | 3300009176 | Bacteria | 1566 |
| 287 | Ga0105242_10551050 | 3300009176 | Unclassified | 1105 |
| 288 | Ga0105242_10810151 | 3300009176 | Bacteria | 928 |
| 289 | Ga0105237_10039387 | 3300009545 | Bacteria | 4771 |
| 290 | Ga0105238_10105126 | 3300009551 | Bacteria | 2805 |
| 291 | Ga0105249_10061062 | 3300009553 | Bacteria | 3459 |
| 292 | Ga0105249_10065210 | 3300009553 | Bacteria | 3350 |
| 293 | Ga0105249_10106076 | 3300009553 | Bacteria | 2650 |
| 294 | Ga0105249_10871406 | 3300009553 | Bacteria | 967 |
| 295 | Ga0099796_10043333 | 3300010159 | Bacteria | 1532 |
| 296 | Ga0105239_10017697 | 3300010375 | Bacteria | 7885 |
| 297 | Ga0105239_10052692 | 3300010375 | Bacteria | 4462 |
| 298 | Ga0105239_10072593 | 3300010375 | Unclassified | 3784 |
| 299 | Ga0157373_10000388 | 3300013100 | Bacteria | 35150 |
| 300 | Ga0157373_10092948 | 3300013100 | Bacteria | 2124 |
| 301 | Ga0157371_10211777 | 3300013102 | Bacteria | 1391 |
| 302 | Ga0157378_10004523 | 3300013297 | Bacteria | 12201 |
| 303 | Ga0157378_10016364 | 3300013297 | Bacteria | 6493 |
| 304 | Ga0157378_10314440 | 3300013297 | Bacteria | 1520 |
| 305 | Ga0157378_10548293 | 3300013297 | Unclassified | 1161 |
| 306 | Ga0163162_10017943 | 3300013306 | Bacteria | 6925 |
| 307 | Ga0163162_10123958 | 3300013306 | Bacteria | 2689 |
| 308 | Ga0163162_10140706 | 3300013306 | Bacteria | 2526 |
| 309 | Ga0163162_10174875 | 3300013306 | Bacteria | 2272 |
| 310 | Ga0163162_10253513 | 3300013306 | Bacteria | 1891 |
| 311 | Ga0163162_10574437 | 3300013306 | Bacteria | 1255 |
| 312 | Ga0163162_10732775 | 3300013306 | Bacteria | 1109 |
| 313 | Ga0157372_10000105 | 3300013307 | Bacteria | 88007 |
| 314 | Ga0157372_10032766 | 3300013307 | Bacteria | 5701 |
| 315 | Ga0157372_10483572 | 3300013307 | Bacteria | 1443 |
| 316 | Ga0157375_10219956 | 3300013308 | Bacteria | 2057 |
| 317 | Ga0157375_10254687 | 3300013308 | Bacteria | 1917 |
| 318 | Ga0163163_10362778 | 3300014325 | Bacteria | 1505 |
| 319 | Ga0157380_10165439 | 3300014326 | Bacteria | 1927 |
| 320 | Ga0157380_10788747 | 3300014326 | Unclassified | 966 |
| 321 | Ga0157377_10076649 | 3300014745 | Bacteria | 1945 |
| 322 | Ga0157377_10167380 | 3300014745 | Bacteria | 1372 |
| 323 | Ga0157376_10010980 | 3300014969 | Bacteria | 6654 |
| 324 | Ga0163161_10261952 | 3300017792 | Bacteria | 1350 |
| 325 | Ga0209050_1012401 | 3300025298 | Bacteria | 3913 |
| 326 | Ga0209256_1000019 | 3300025299 | Bacteria | 558627 |
| 327 | Ga0207653_10011816 | 3300025885 | Bacteria | 2724 |
| 328 | Ga0207688_10014828 | 3300025901 | Bacteria | 4229 |
| 329 | Ga0207680_10316701 | 3300025903 | Bacteria | 1090 |
| 330 | Ga0207685_10046379 | 3300025905 | Bacteria | 1654 |
| 331 | Ga0207645_10009598 | 3300025907 | Bacteria | 6686 |
| 332 | Ga0207645_10020234 | 3300025907 | Bacteria | 4359 |
| 333 | Ga0207643_10000329 | 3300025908 | Bacteria | 32532 |
| 334 | Ga0207643_10019631 | 3300025908 | Bacteria | 3705 |
| 335 | Ga0207684_10012875 | 3300025910 | Bacteria | 7244 |
| 336 | Ga0207684_10046001 | 3300025910 | Bacteria | 3702 |
| 337 | Ga0207684_10085096 | 3300025910 | Bacteria | 2693 |
| 338 | Ga0207684_10314733 | 3300025910 | Bacteria | 1349 |
| 339 | Ga0207654_10014749 | 3300025911 | Bacteria | 4042 |
| 340 | Ga0207707_10000352 | 3300025912 | Bacteria | 48248 |
| 341 | Ga0207707_10009306 | 3300025912 | Bacteria | 8519 |
| 342 | Ga0207707_10032009 | 3300025912 | Bacteria | 4604 |
| 343 | Ga0207671_10068612 | 3300025914 | Bacteria | 2642 |
| 344 | Ga0207693_10066011 | 3300025915 | Bacteria | 2833 |
| 345 | Ga0207693_10154107 | 3300025915 | Bacteria | 1808 |
| 346 | Ga0207663_10067419 | 3300025916 | Bacteria | 2295 |
| 347 | Ga0207663_10078825 | 3300025916 | Bacteria | 2149 |
| 348 | Ga0207660_10000700 | 3300025917 | Bacteria | 22339 |
| 349 | Ga0207660_10009728 | 3300025917 | Bacteria | 6223 |
| 350 | Ga0207660_10025398 | 3300025917 | Bacteria | 4020 |
| 351 | Ga0207660_10053857 | 3300025917 | Bacteria | 2869 |
| 352 | Ga0207662_10014316 | 3300025918 | Bacteria | 4449 |
| 353 | Ga0207662_10072826 | 3300025918 | Bacteria | 2083 |
| 354 | Ga0207662_10287351 | 3300025918 | Bacteria | 1090 |
| 355 | Ga0207657_10002201 | 3300025919 | Bacteria | 21128 |
| 356 | Ga0207657_10002264 | 3300025919 | Bacteria | 20869 |
| 357 | Ga0207649_10006672 | 3300025920 | Bacteria | 6273 |
| 358 | Ga0207652_10002500 | 3300025921 | Bacteria | 15472 |
| 359 | Ga0207652_10118130 | 3300025921 | Unclassified | 2356 |
| 360 | Ga0207646_10000250 | 3300025922 | Bacteria | 73162 |
| 361 | Ga0207646_10020607 | 3300025922 | Bacteria | 6107 |
| 362 | Ga0207646_10022079 | 3300025922 | Bacteria | 5870 |
| 363 | Ga0207646_10044313 | 3300025922 | Bacteria | 3993 |
| 364 | Ga0207646_10177068 | 3300025922 | Unclassified | 1926 |
| 365 | Ga0207646_10537759 | 3300025922 | Bacteria | 1051 |
| 366 | Ga0207681_10042038 | 3300025923 | Bacteria | 3050 |
| 367 | Ga0207681_10114175 | 3300025923 | Bacteria | 1970 |
| 368 | Ga0207650_10001805 | 3300025925 | Bacteria | 15135 |
| 369 | Ga0207650_10190803 | 3300025925 | Bacteria | 1637 |
| 370 | Ga0207659_10067240 | 3300025926 | Bacteria | 2603 |
| 371 | Ga0207687_10134337 | 3300025927 | Bacteria | 1869 |
| 372 | Ga0207687_10169088 | 3300025927 | Bacteria | 1684 |
| 373 | Ga0207687_10241313 | 3300025927 | Bacteria | 1432 |
| 374 | Ga0207690_10003859 | 3300025932 | Bacteria | 8859 |
| 375 | Ga0207690_10012404 | 3300025932 | Bacteria | 5096 |
| 376 | Ga0207706_10002107 | 3300025933 | Bacteria | 19464 |
| 377 | Ga0207706_10025376 | 3300025933 | Bacteria | 5310 |
| 378 | Ga0207706_10241974 | 3300025933 | Bacteria | 1577 |
| 379 | Ga0207706_10292616 | 3300025933 | Bacteria | 1420 |
| 380 | Ga0207686_10000342 | 3300025934 | Bacteria | 33514 |
| 381 | Ga0207686_10135074 | 3300025934 | Bacteria | 1697 |
| 382 | Ga0207686_10416783 | 3300025934 | Unclassified | 1026 |
| 383 | Ga0207709_10004313 | 3300025935 | Bacteria | 8238 |
| 384 | Ga0207709_10190469 | 3300025935 | Bacteria | 1456 |
| 385 | Ga0207670_10014375 | 3300025936 | Bacteria | 4698 |
| 386 | Ga0207670_10041598 | 3300025936 | Bacteria | 3023 |
| 387 | Ga0207704_10211568 | 3300025938 | Bacteria | 1428 |
| 388 | Ga0207704_10325938 | 3300025938 | Bacteria | 1187 |
| 389 | Ga0207665_10005945 | 3300025939 | Bacteria | 8118 |
| 390 | Ga0207691_10008329 | 3300025940 | Bacteria | 9957 |
| 391 | Ga0207691_10433160 | 3300025940 | Bacteria | 1120 |
| 392 | Ga0207711_10113617 | 3300025941 | Bacteria | 2411 |
| 393 | Ga0207689_10002349 | 3300025942 | Bacteria | 17681 |
| 394 | Ga0207689_10014499 | 3300025942 | Bacteria | 6705 |
| 395 | Ga0207689_10048500 | 3300025942 | Bacteria | 3503 |
| 396 | Ga0207689_10056084 | 3300025942 | Bacteria | 3242 |
| 397 | Ga0207689_10098018 | 3300025942 | Bacteria | 2408 |
| 398 | Ga0207689_10242103 | 3300025942 | Bacteria | 1491 |
| 399 | Ga0207679_10002955 | 3300025945 | Bacteria | 10537 |
| 400 | Ga0207679_10016389 | 3300025945 | Bacteria | 4921 |
| 401 | Ga0207667_10000497 | 3300025949 | Bacteria | 51927 |
| 402 | Ga0207667_10376890 | 3300025949 | Bacteria | 1446 |
| 403 | Ga0207651_10198673 | 3300025960 | Bacteria | 1605 |
| 404 | Ga0207668_10233711 | 3300025972 | Bacteria | 1484 |
| 405 | Ga0207640_10002010 | 3300025981 | Bacteria | 10985 |
| 406 | Ga0207640_10045090 | 3300025981 | Bacteria | 2829 |
| 407 | Ga0207677_10011748 | 3300026023 | Bacteria | 5004 |
| 408 | Ga0207703_10027472 | 3300026035 | Bacteria | 4482 |
| 409 | Ga0207703_10040827 | 3300026035 | Bacteria | 3715 |
| 410 | Ga0207703_10472572 | 3300026035 | Bacteria | 1174 |
| 411 | Ga0207639_10006390 | 3300026041 | Bacteria | 8004 |
| 412 | Ga0207639_10557116 | 3300026041 | Bacteria | 1053 |
| 413 | Ga0207678_10003731 | 3300026067 | Bacteria | 13700 |
| 414 | Ga0207678_10006728 | 3300026067 | Bacteria | 10191 |
| 415 | Ga0207708_10013908 | 3300026075 | Bacteria | 6015 |
| 416 | Ga0207708_10027482 | 3300026075 | Bacteria | 4308 |
| 417 | Ga0207708_10055487 | 3300026075 | Bacteria | 3021 |
| 418 | Ga0207702_10019642 | 3300026078 | Bacteria | 5593 |
| 419 | Ga0207702_10082368 | 3300026078 | Bacteria | 2797 |
| 420 | Ga0207648_10001010 | 3300026089 | Bacteria | 31690 |
| 421 | Ga0207648_10247511 | 3300026089 | Bacteria | 1589 |
| 422 | Ga0207676_10025356 | 3300026095 | Bacteria | 4399 |
| 423 | Ga0207676_10113162 | 3300026095 | Bacteria | 2275 |
| 424 | Ga0207676_10218077 | 3300026095 | Unclassified | 1697 |
| 425 | Ga0207674_10000550 | 3300026116 | Bacteria | 49205 |
| 426 | Ga0207674_10017719 | 3300026116 | Bacteria | 7762 |
| 427 | Ga0207675_100000430 | 3300026118 | Bacteria | 40671 |
| 428 | Ga0207675_100013273 | 3300026118 | Bacteria | 7691 |
| 429 | Ga0207675_100170986 | 3300026118 | Bacteria | 2077 |
| 430 | Ga0207675_100244093 | 3300026118 | Bacteria | 1736 |
| 431 | Ga0207675_100634738 | 3300026118 | Bacteria | 1073 |
| 432 | Ga0207683_10001733 | 3300026121 | Bacteria | 19431 |
| 433 | Ga0207683_10072975 | 3300026121 | Bacteria | 3036 |
| 434 | Ga0207683_10127253 | 3300026121 | Bacteria | 2290 |
| 435 | Ga0209281_1000023 | 3300027111 | Bacteria | 519955 |
| 436 | Ga0209969_1012783 | 3300027360 | Bacteria | 1212 |
| 437 | Ga0209967_1019203 | 3300027364 | Bacteria | 993 |
| 438 | Ga0209981_1003252 | 3300027378 | Bacteria | 2105 |
| 439 | Ga0209984_1004176 | 3300027424 | Bacteria | 1691 |
| 440 | Ga0209984_1010539 | 3300027424 | Bacteria | 1187 |
| 441 | Ga0210000_1007514 | 3300027462 | Bacteria | 1594 |
| 442 | Ga0209968_1000952 | 3300027526 | Bacteria | 4472 |
| 443 | Ga0209999_1006579 | 3300027543 | Bacteria | 2087 |
| 444 | Ga0209982_1010152 | 3300027552 | Bacteria | 1394 |
| 445 | Ga0209970_1006809 | 3300027614 | Bacteria | 1877 |
| 446 | Ga0210002_1001446 | 3300027617 | Bacteria | 3348 |
| 447 | Ga0210002_1021014 | 3300027617 | Unclassified | 1053 |
| 448 | Ga0209983_1005789 | 3300027665 | Bacteria | 2552 |
| 449 | Ga0209983_1006509 | 3300027665 | Bacteria | 2397 |
| 450 | Ga0209588_1021428 | 3300027671 | Bacteria | 2031 |
| 451 | Ga0209971_1000028 | 3300027682 | Bacteria | 53458 |
| 452 | Ga0209971_1011248 | 3300027682 | Bacteria | 2120 |
| 453 | Ga0209971_1048046 | 3300027682 | Bacteria | 1030 |
| 454 | Ga0209966_1000073 | 3300027695 | Bacteria | 44067 |
| 455 | Ga0209998_10000001 | 3300027717 | Bacteria | 203589 |
| 456 | Ga0209998_10003754 | 3300027717 | Bacteria | 3287 |
| 457 | Ga0209974_10005514 | 3300027876 | Bacteria | 4448 |
| 458 | Ga0209974_10007787 | 3300027876 | Bacteria | 3682 |
| 459 | Ga0207428_10000394 | 3300027907 | Bacteria | 54660 |
| 460 | Ga0207428_10019791 | 3300027907 | Bacteria | 5733 |
| 461 | Ga0207428_10227041 | 3300027907 | Bacteria | 1398 |
| 462 | Ga0268265_10019548 | 3300028380 | Bacteria | 4711 |
| 463 | Ga0268265_10034377 | 3300028380 | Bacteria | 3694 |
| 464 | Ga0268265_10074481 | 3300028380 | Bacteria | 2656 |
| 465 | Ga0268265_10522212 | 3300028380 | Bacteria | 1122 |
| 466 | Ga0268264_10101537 | 3300028381 | Bacteria | 2501 |
| 467 | Ga0268264_10304018 | 3300028381 | Bacteria | 1502 |
| 468 | Ga0268264_10430533 | 3300028381 | Unclassified | 1274 |
| 469 | Ga0307408_100221434 | 3300031548 | Bacteria | 1544 |
| 470 | Ga0307408_100337599 | 3300031548 | Bacteria | 1274 |
| 471 | Ga0307405_10117364 | 3300031731 | Bacteria | 1814 |
| 472 | Ga0307405_10125823 | 3300031731 | Bacteria | 1762 |
| 473 | Ga0307413_10015212 | 3300031824 | Bacteria | 3936 |
| 474 | Ga0307410_10064110 | 3300031852 | Bacteria | 2524 |
| 475 | Ga0307410_10215490 | 3300031852 | Bacteria | 1474 |
| 476 | Ga0307407_10035366 | 3300031903 | Bacteria | 2744 |
| 477 | Ga0307412_10025051 | 3300031911 | Bacteria | 3690 |
| 478 | Ga0307412_10052185 | 3300031911 | Bacteria | 2707 |
| 479 | Ga0307409_100014522 | 3300031995 | Bacteria | 5128 |
| 480 | Ga0307416_100007444 | 3300032002 | Bacteria | 6964 |
| 481 | Ga0307416_100104526 | 3300032002 | Bacteria | 2476 |
| 482 | Ga0307414_10047790 | 3300032004 | Bacteria | 2948 |
| 483 | Ga0307414_10115699 | 3300032004 | Bacteria | 2051 |
| 484 | Ga0307415_100009625 | 3300032126 | Bacteria | 5431 |
| 485 | Ga0307415_100019016 | 3300032126 | Bacteria | 4162 |
| 486 | Ga0373948_0018968 | 3300034817 | Bacteria | 1296 |
| 487 | Ga0373949_0001601 | 3300035090 | Bacteria | 6374 |
| 488 | Ga0373951_0014834 | 3300035091 | Bacteria | 1753 |
| 489 | Ga0373932_0017901 | 3300035112 | Bacteria | 1826 |
| 490 | Ga0373943_0247174 | 3300035170 | Bacteria | 1001 |
| 491 | Ga0373931_0003309 | 3300035691 | Bacteria | 7217 |
| 492 | Ga0373931_0075511 | 3300035691 | Bacteria | 1849 |
| 493 | Ga0373935_0065352 | 3300035692 | Bacteria | 2334 |
| 494 | Ga0373947_0039950 | 3300035725 | Bacteria | 2794 |
| 495 | Ga0242420_025256 | 3300038996 | Bacteria | 1079 |
| 496 | Ga0439448_0004613 | 3300042005 | Bacteria | 3897 |
| 497 | Ga0439450_001193 | 3300042008 | Bacteria | 3732 |
| 498 | Ga0439435_0045685 | 3300042436 | Bacteria | 1239 |
| 499 | Ga0439464_0003489 | 3300042439 | Bacteria | 3970 |
| 500 | Ga0439460_0000212 | 3300042461 | Bacteria | 11551 |
| 501 | Ga0450893_0020800 | 3300042532 | Bacteria | 1130 |
| 502 | Ga0451577_0003828 | 3300042876 | Bacteria | 16376 |
| 503 | Ga0451577_0032065 | 3300042876 | Bacteria | 4734 |
| 504 | Ga0451577_0288279 | 3300042876 | Bacteria | 1488 |
| 505 | Ga0451577_0380143 | 3300042876 | Bacteria | 1281 |
| 506 | Ga0451577_0564659 | 3300042876 | Unclassified | 1033 |
| 507 | Ga0453683_0015559 | 3300044673 | Bacteria | 4924 |
| 508 | Ga0453683_0034845 | 3300044673 | Bacteria | 3173 |
| 509 | Ga0453683_0067087 | 3300044673 | Unclassified | 2243 |
| 510 | Ga0453683_0086734 | 3300044673 | Bacteria | 1961 |
| 511 | Ga0453683_0089063 | 3300044673 | Bacteria | 1934 |
| 512 | Ga0453684_0020509 | 3300044712 | Bacteria | 9962 |
| 513 | Ga0453684_0028795 | 3300044712 | Bacteria | 7910 |
| 514 | Ga0453684_0067501 | 3300044712 | Bacteria | 4547 |
| 515 | Ga0451576_0007231 | 3300045051 | Bacteria | 13371 |
| 516 | Ga0451576_0055701 | 3300045051 | Bacteria | 4135 |
| 517 | Ga0451576_0063275 | 3300045051 | Bacteria | 3856 |
| 518 | Ga0451576_0075385 | 3300045051 | Bacteria | 3510 |
| 519 | Ga0451576_0098364 | 3300045051 | Bacteria | 3043 |
| 520 | Ga0451576_0465121 | 3300045051 | Bacteria | 1328 |
| 521 | Ga0495580_0093037 | 3300046472 | Bacteria | 2098 |
| 522 | Ga0495582_0129083 | 3300046473 | Bacteria | 1428 |
| 523 | Ga0495584_0164887 | 3300046491 | Bacteria | 1126 |
| 524 | Ga0495659_0036045 | 3300046664 | Bacteria | 1746 |
| 525 | Ga0496106_0197223 | 3300048909 | Bacteria | 1602 |
| 526 | Ga0496111_0378396 | 3300048914 | Bacteria | 1047 |
| 527 | Ga0496112_0069699 | 3300048915 | Bacteria | 3473 |
| 528 | Ga0496112_0099084 | 3300048915 | Bacteria | 2884 |
| 529 | Ga0496112_0235777 | 3300048915 | Bacteria | 1783 |
| 530 | Ga0496114_0019669 | 3300048917 | Bacteria | 5472 |
| 531 | Ga0501031_0029564 | 3300049568 | Bacteria | 3574 |
| 532 | Ga0501031_0034922 | 3300049568 | Bacteria | 3281 |
| 533 | Ga0501032_0051456 | 3300049569 | Bacteria | 2777 |
| 534 | Ga0501033_0093134 | 3300049570 | Bacteria | 2203 |
| 535 | Ga0501034_0109543 | 3300049571 | Bacteria | 2753 |
| 536 | Ga0501036_0021698 | 3300049572 | Bacteria | 5398 |
| 537 | Ga0501036_0042144 | 3300049572 | Bacteria | 3864 |
| 538 | Ga0501037_0015751 | 3300049573 | Bacteria | 5564 |
| 539 | Ga0501037_0025709 | 3300049573 | Bacteria | 4348 |
| 540 | Ga0501038_0002511 | 3300049574 | Bacteria | 17093 |
| 541 | Ga0501038_0047038 | 3300049574 | Bacteria | 3738 |
| 542 | Ga0501039_0001556 | 3300049575 | Bacteria | 16876 |
| 543 | Ga0501039_0241058 | 3300049575 | Bacteria | 1421 |
| 544 | Ga0501040_0003219 | 3300049576 | Bacteria | 10561 |
| 545 | Ga0501040_0011029 | 3300049576 | Bacteria | 5908 |
| 546 | Ga0501040_0015343 | 3300049576 | Bacteria | 5066 |
| 547 | Ga0501040_0017189 | 3300049576 | Bacteria | 4801 |
| 548 | Ga0501040_0129391 | 3300049576 | Bacteria | 1774 |
| 549 | Ga0501041_0000212 | 3300049577 | Bacteria | 26965 |
| 550 | Ga0501041_0024648 | 3300049577 | Bacteria | 3610 |
| 551 | Ga0501041_0140100 | 3300049577 | Bacteria | 1508 |
| 552 | Ga0501041_0195228 | 3300049577 | Bacteria | 1268 |
| 553 | Ga0501042_0000098 | 3300049578 | Bacteria | 34576 |
| 554 | Ga0501042_0013216 | 3300049578 | Bacteria | 5620 |
| 555 | Ga0501042_0176423 | 3300049578 | Bacteria | 1541 |
| 556 | Ga0501043_0010972 | 3300049579 | Bacteria | 7098 |
| 557 | Ga0501043_0012354 | 3300049579 | Bacteria | 6677 |
| 558 | Ga0501043_0063974 | 3300049579 | Bacteria | 2889 |
| 559 | Ga0501046_0009321 | 3300049580 | Bacteria | 8493 |
| 560 | Ga0501046_0015300 | 3300049580 | Bacteria | 6451 |
| 561 | Ga0501046_0182445 | 3300049580 | Bacteria | 1569 |
| 562 | Ga0501048_0004806 | 3300049582 | Bacteria | 10296 |
| 563 | Ga0501048_0019522 | 3300049582 | Bacteria | 4972 |
| 564 | Ga0501048_0073577 | 3300049582 | Bacteria | 2411 |
| 565 | Ga0501048_0113089 | 3300049582 | Bacteria | 1918 |
| 566 | Ga0501068_0029907 | 3300049584 | Bacteria | 3229 |
| 567 | Ga0501069_0010011 | 3300049585 | Bacteria | 5012 |
| 568 | Ga0501069_0060479 | 3300049585 | Bacteria | 2115 |
| 569 | Ga0501069_0173936 | 3300049585 | Bacteria | 1243 |
| 570 | Ga0501070_0017605 | 3300049586 | Bacteria | 5999 |
| 571 | Ga0501070_0018760 | 3300049586 | Bacteria | 5803 |
| 572 | Ga0501071_0000452 | 3300049587 | Bacteria | 20662 |
| 573 | Ga0501071_0292592 | 3300049587 | Bacteria | 1233 |
| 574 | Ga0501071_0310443 | 3300049587 | Bacteria | 1197 |
| 575 | Ga0501072_0039234 | 3300049588 | Bacteria | 3718 |
| 576 | Ga0501072_0061061 | 3300049588 | Bacteria | 2972 |
| 577 | Ga0501072_0241360 | 3300049588 | Bacteria | 1439 |
| 578 | Ga0501073_0021533 | 3300049589 | Bacteria | 4647 |
| 579 | Ga0501074_0004506 | 3300049590 | Bacteria | 9974 |
| 580 | Ga0501075_0000095 | 3300049591 | Bacteria | 40804 |
| 581 | Ga0501075_0004952 | 3300049591 | Bacteria | 9082 |
| 582 | Ga0501075_0036199 | 3300049591 | Bacteria | 3684 |
| 583 | Ga0501075_0059906 | 3300049591 | Bacteria | 2868 |
| 584 | Ga0501076_0000386 | 3300049592 | Bacteria | 27579 |
| 585 | Ga0501076_0006409 | 3300049592 | Bacteria | 8534 |
| 586 | Ga0501076_0091193 | 3300049592 | Bacteria | 2451 |
| 587 | Ga0501076_0217206 | 3300049592 | Bacteria | 1563 |
| 588 | Ga0501077_0000670 | 3300049593 | Bacteria | 20698 |
| 589 | Ga0501077_0010466 | 3300049593 | Bacteria | 5774 |
| 590 | Ga0501077_0014420 | 3300049593 | Bacteria | 4967 |
| 591 | Ga0501077_0047914 | 3300049593 | Bacteria | 2715 |
| 592 | Ga0501077_0074150 | 3300049593 | Bacteria | 2155 |
| 593 | Ga0501077_0089379 | 3300049593 | Bacteria | 1952 |
| 594 | Ga0501079_0001408 | 3300049741 | Bacteria | 16936 |
| 595 | Ga0501079_0001514 | 3300049741 | Bacteria | 16455 |
| 596 | Ga0501079_0002232 | 3300049741 | Bacteria | 13970 |
| 597 | Ga0501079_0006617 | 3300049741 | Bacteria | 8720 |
| 598 | Ga0501080_0025806 | 3300049742 | Bacteria | 5458 |
| 599 | Ga0501080_0027305 | 3300049742 | Bacteria | 5308 |
| 600 | Ga0501080_0201548 | 3300049742 | Bacteria | 1827 |
| 601 | Ga0501080_0264543 | 3300049742 | Bacteria | 1566 |
| 602 | Ga0501081_0000063 | 3300049743 | Bacteria | 41530 |
| 603 | Ga0501081_0011007 | 3300049743 | Bacteria | 5914 |
| 604 | Ga0501081_0224113 | 3300049743 | Bacteria | 1368 |
| 605 | Ga0501083_0007185 | 3300049744 | Bacteria | 7908 |
| 606 | Ga0501083_0008605 | 3300049744 | Bacteria | 7201 |
| 607 | Ga0501083_0069906 | 3300049744 | Bacteria | 2336 |
| 608 | Ga0501083_0126326 | 3300049744 | Bacteria | 1676 |
| 609 | Ga0501035_0056322 | 3300049822 | Bacteria | 3508 |
| 610 | Ga0501035_0103790 | 3300049822 | Bacteria | 2493 |
| 611 | Ga0501044_0035034 | 3300049823 | Bacteria | 5259 |
| 612 | Ga0501045_0000164 | 3300049824 | Bacteria | 36415 |
| 613 | Ga0501045_0000186 | 3300049824 | Bacteria | 34725 |
| 614 | Ga0501045_0020558 | 3300049824 | Bacteria | 4717 |
| 615 | Ga0501045_0136415 | 3300049824 | Bacteria | 1824 |
| 616 | Ga0501045_0139247 | 3300049824 | Bacteria | 1805 |
| 617 | nmdc:mga05p37_11017_c1 | 3300050507 | Bacteria | 10739 |
| 618 | nmdc:mga05p37_153938_c1 | 3300050507 | Bacteria | 2811 |
| 619 | nmdc:mga05p37_17070_c2 | 3300050507 | Bacteria | 8069 |
| 620 | nmdc:mga05p37_219222_c1 | 3300050507 | Bacteria | 2296 |
| 621 | nmdc:mga05p37_326315_c1 | 3300050507 | Bacteria | 1815 |
| 622 | nmdc:mga05p37_605849_c1 | 3300050507 | Bacteria | 1235 |
| 623 | nmdc:mga09592_535751_c1 | 3300050508 | Unclassified | 1006 |
| 624 | nmdc:mga0qj67_135159_c1 | 3300050509 | Unclassified | 1998 |
| 625 | nmdc:mga0qj67_138062_c1 | 3300050509 | Bacteria | 1976 |
| 626 | nmdc:mga0qj67_148937_c1 | 3300050509 | Bacteria | 1898 |
| 627 | nmdc:mga0qj67_180495_c1 | 3300050509 | Bacteria | 1714 |
| 628 | nmdc:mga0qj67_23322_c1 | 3300050509 | Bacteria | 4759 |
| 629 | nmdc:mga0qj67_500283_c1 | 3300050509 | Bacteria | 977 |
| 630 | nmdc:mga06r32_17445_c1 | 3300050510 | Bacteria | 6552 |
| 631 | nmdc:mga06r32_1752_c1 | 3300050510 | Bacteria | 19498 |
| 632 | nmdc:mga06r32_185874_c1 | 3300050510 | Bacteria | 2065 |
| 633 | nmdc:mga06r32_256716_c1 | 3300050510 | Bacteria | 1736 |
| 634 | nmdc:mga06r32_522957_c1 | 3300050510 | Bacteria | 1162 |
| 635 | nmdc:mga06r32_68548_c1 | 3300050510 | Bacteria | 3427 |
| 636 | nmdc:mga08y16_1417_c1 | 3300050511 | Bacteria | 24061 |
| 637 | nmdc:mga08y16_277408_c1 | 3300050511 | Bacteria | 1729 |
| 638 | nmdc:mga08y16_31342_c1 | 3300050511 | Bacteria | 5592 |
| 639 | nmdc:mga08y16_570589_c1 | 3300050511 | Unclassified | 1143 |
| 640 | nmdc:mga08y16_79351_c1 | 3300050511 | Bacteria | 3421 |
| 641 | nmdc:mga08y16_94837_c1 | 3300050511 | Bacteria | 3108 |
| 642 | nmdc:mga0n895_18672_c1 | 3300050512 | Bacteria | 6423 |
| 643 | nmdc:mga0n895_233224_c1 | 3300050512 | Bacteria | 1868 |
| 644 | nmdc:mga0n895_237255_c1 | 3300050512 | Bacteria | 1851 |
| 645 | nmdc:mga0n895_25810_c1 | 3300050512 | Bacteria | 5556 |
| 646 | nmdc:mga0n895_304925_c1 | 3300050512 | Bacteria | 1614 |
| 647 | nmdc:mga0n895_373194_c1 | 3300050512 | Unclassified | 1444 |
| 648 | nmdc:mga0n895_613_c1 | 3300050512 | Bacteria | 24760 |
| 649 | nmdc:mga0n895_67200_c1 | 3300050512 | Bacteria | 3550 |
| 650 | nmdc:mga0n895_75392_c1 | 3300050512 | Bacteria | 3353 |
| 651 | nmdc:mga0rr50_107970_c1 | 3300050513 | Bacteria | 2198 |
| 652 | nmdc:mga0rr50_12707_c1 | 3300050513 | Bacteria | 5454 |
| 653 | nmdc:mga0rr50_252504_c1 | 3300050513 | Unclassified | 1465 |
| 654 | nmdc:mga0rr50_49669_c1 | 3300050513 | Bacteria | 3106 |
| 655 | nmdc:mga0rr50_4993_c1 | 3300050513 | Bacteria | 7859 |
| 656 | nmdc:mga0rr50_94600_c1 | 3300050513 | Bacteria | 2334 |
| 657 | nmdc:mga08x19_114342_c1 | 3300050514 | Bacteria | 1803 |
| 658 | nmdc:mga08x19_11443_c1 | 3300050514 | Bacteria | 5339 |
| 659 | nmdc:mga08x19_14639_c1 | 3300050514 | Bacteria | 4762 |
| 660 | nmdc:mga0a205_17778_c1 | 3300050515 | Bacteria | 6671 |
| 661 | nmdc:mga0a205_19436_c1 | 3300050515 | Bacteria | 6404 |
| 662 | nmdc:mga0a205_2042_c1 | 3300050515 | Bacteria | 17633 |
| 663 | nmdc:mga0a205_27043_c1 | 3300050515 | Bacteria | 5477 |
| 664 | nmdc:mga0a205_2749_c1 | 3300050515 | Bacteria | 15533 |
| 665 | nmdc:mga0a205_99550_c1 | 3300050515 | Bacteria | 2805 |
| 666 | Ga0501084_0000300 | 3300054114 | Bacteria | 37454 |
| 667 | Ga0501084_0000662 | 3300054114 | Bacteria | 26273 |
| 668 | Ga0501084_0003591 | 3300054114 | Bacteria | 12591 |
| 669 | Ga0501084_0024289 | 3300054114 | Bacteria | 5054 |
| 670 | Ga0501084_0125491 | 3300054114 | Bacteria | 2160 |
| 671 | Ga0590074_010587 | 3300059423 | Bacteria | 1541 |
| 672 | Ga0590075_025830 | 3300059424 | Bacteria | 1477 |
| 673 | Ga0590077_008904 | 3300059426 | Bacteria | 2055 |
| 674 | Ga0501082_0000921 | 3300060353 | Bacteria | 25918 |
| 675 | Ga0501082_0100806 | 3300060353 | Bacteria | 2497 |
| 676 | Ga0501082_0109256 | 3300060353 | Bacteria | 2394 |
| 677 | Ga0501082_0269251 | 3300060353 | Bacteria | 1482 |
| 678 | Ga0530510_0007331 | 3300061734 | Bacteria | 7676 |
| 679 | Ga0530510_0025591 | 3300061734 | Bacteria | 4221 |
| 680 | Ga0530510_0158887 | 3300061734 | Bacteria | 1671 |
| 681 | Ga0530510_0166035 | 3300061734 | Bacteria | 1634 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100457454 | Ga0070708_1004574541 | 264 |
| 2 | 3300005459 | Ga0068867_100007078 | Ga0068867_1000070782 | 264 |
| 3 | 3300005617 | Ga0068859_100203666 | Ga0068859_1002036662 | 264 |
| 4 | 3300005981 | Ga0081538_10002311 | Ga0081538_1000231114 | 264 |
| 5 | 3300006931 | Ga0097620_100203657 | Ga0097620_1002036572 | 264 |
| 6 | 3300049576 | Ga0501040_0017189 | Ga0501040_0017189_1984_2856 | 264 |
| 7 | 3300049592 | Ga0501076_0217206 | Ga0501076_0217206_451_1323 | 264 |
| 8 | 3300005844 | Ga0068862_100226026 | Ga0068862_1002260261 | 266 |
| 9 | 3300013306 | Ga0163162_10732775 | Ga0163162_107327751 | 266 |
| 10 | 3300005518 | Ga0070699_100043701 | Ga0070699_1000437012 | 272 |
| 11 | 3300009098 | Ga0105245_10028254 | Ga0105245_100282544 | 272 |
| 12 | 3300025910 | Ga0207684_10085096 | Ga0207684_100850961 | 272 |
| 13 | 3300025922 | Ga0207646_10177068 | Ga0207646_101770683 | 272 |
| 14 | 3300050512 | nmdc:mga0n895_373194_c1 | nmdc:mga0n895_373194_c1_150_968 | 272 |
| 15 | 3300005334 | Ga0068869_100087233 | Ga0068869_1000872332 | 273 |
| 16 | 3300005444 | Ga0070694_100023175 | Ga0070694_1000231754 | 273 |
| 17 | 3300005547 | Ga0070693_100116275 | Ga0070693_1001162751 | 273 |
| 18 | 3300005843 | Ga0068860_100078383 | Ga0068860_1000783834 | 273 |
| 19 | 3300005844 | Ga0068862_100063481 | Ga0068862_1000634811 | 273 |
| 20 | 3300007265 | Ga0099794_10057056 | Ga0099794_100570562 | 273 |
| 21 | 3300009094 | Ga0111539_10168183 | Ga0111539_101681833 | 273 |
| 22 | 3300025927 | Ga0207687_10134337 | Ga0207687_101343371 | 273 |
| 23 | 3300025942 | Ga0207689_10098018 | Ga0207689_100980182 | 273 |
| 24 | 3300026118 | Ga0207675_100244093 | Ga0207675_1002440932 | 273 |
| 25 | 3300028380 | Ga0268265_10034377 | Ga0268265_100343771 | 273 |
| 26 | 3300050512 | nmdc:mga0n895_233224_c1 | nmdc:mga0n895_233224_c1_549_1370 | 273 |
| 27 | 3300050512 | nmdc:mga0n895_613_c1 | nmdc:mga0n895_613_c1_18650_19471 | 273 |
| 28 | 3300050513 | nmdc:mga0rr50_12707_c1 | nmdc:mga0rr50_12707_c1_25_846 | 273 |
| 29 | 3300050515 | nmdc:mga0a205_17778_c1 | nmdc:mga0a205_17778_c1_4617_5438 | 273 |
| 30 | 3300005468 | Ga0070707_100164030 | Ga0070707_1001640302 | 274 |
| 31 | 3300005518 | Ga0070699_100474058 | Ga0070699_1004740582 | 274 |
| 32 | 3300005549 | Ga0070704_100618756 | Ga0070704_1006187561 | 274 |
| 33 | 3300005617 | Ga0068859_100264747 | Ga0068859_1002647472 | 274 |
| 34 | 3300006931 | Ga0097620_100264735 | Ga0097620_1002647352 | 274 |
| 35 | 3300025922 | Ga0207646_10000250 | Ga0207646_1000025058 | 274 |
| 36 | 3300044712 | Ga0453684_0028795 | Ga0453684_0028795_5077_5910 | 275 |
| 37 | 3300005347 | Ga0070668_100167641 | Ga0070668_1001676412 | 277 |
| 38 | 3300005456 | Ga0070678_100219641 | Ga0070678_1002196412 | 277 |
| 39 | 3300005617 | Ga0068859_100745944 | Ga0068859_1007459441 | 277 |
| 40 | 3300005718 | Ga0068866_10083410 | Ga0068866_100834102 | 277 |
| 41 | 3300006931 | Ga0097620_100745912 | Ga0097620_1007459121 | 277 |
| 42 | 3300009098 | Ga0105245_10065664 | Ga0105245_100656642 | 277 |
| 43 | 3300009147 | Ga0114129_10090914 | Ga0114129_100909142 | 277 |
| 44 | 3300009148 | Ga0105243_10101342 | Ga0105243_101013424 | 277 |
| 45 | 3300025927 | Ga0207687_10169088 | Ga0207687_101690881 | 277 |
| 46 | 3300025940 | Ga0207691_10433160 | Ga0207691_104331601 | 277 |
| 47 | 3300025972 | Ga0207668_10233711 | Ga0207668_102337112 | 277 |
| 48 | 3300026121 | Ga0207683_10127253 | Ga0207683_101272532 | 277 |
| 49 | 3300042532 | Ga0450893_0020800 | Ga0450893_0020800_166_1005 | 277 |
| 50 | 3300042876 | Ga0451577_0032065 | Ga0451577_0032065_248_1087 | 277 |
| 51 | 3300044673 | Ga0453683_0067087 | Ga0453683_0067087_1364_2203 | 277 |
| 52 | 3300044712 | Ga0453684_0020509 | Ga0453684_0020509_7395_8234 | 277 |
| 53 | 3300046491 | Ga0495584_0164887 | Ga0495584_0164887_204_1043 | 277 |
| 54 | 3300049576 | Ga0501040_0129391 | Ga0501040_0129391_321_1160 | 277 |
| 55 | 3300049577 | Ga0501041_0195228 | Ga0501041_0195228_68_907 | 277 |
| 56 | 3300049591 | Ga0501075_0004952 | Ga0501075_0004952_585_1424 | 277 |
| 57 | 3300049591 | Ga0501075_0036199 | Ga0501075_0036199_1518_2357 | 277 |
| 58 | 3300049593 | Ga0501077_0047914 | Ga0501077_0047914_316_1155 | 277 |
| 59 | 3300049593 | Ga0501077_0089379 | Ga0501077_0089379_159_998 | 277 |
| 60 | 3300049741 | Ga0501079_0002232 | Ga0501079_0002232_5179_6018 | 277 |
| 61 | 3300049742 | Ga0501080_0027305 | Ga0501080_0027305_774_1613 | 277 |
| 62 | 3300049742 | Ga0501080_0264543 | Ga0501080_0264543_547_1386 | 277 |
| 63 | 3300049743 | Ga0501081_0011007 | Ga0501081_0011007_1981_2820 | 277 |
| 64 | 3300049744 | Ga0501083_0069906 | Ga0501083_0069906_721_1560 | 277 |
| 65 | 3300049824 | Ga0501045_0136415 | Ga0501045_0136415_41_880 | 277 |
| 66 | 3300049824 | Ga0501045_0139247 | Ga0501045_0139247_623_1462 | 277 |
| 67 | 3300050507 | nmdc:mga05p37_153938_c1 | nmdc:mga05p37_153938_c1_895_1734 | 277 |
| 68 | 3300050514 | nmdc:mga08x19_14639_c1 | nmdc:mga08x19_14639_c1_2951_3790 | 277 |
| 69 | 3300054114 | Ga0501084_0003591 | Ga0501084_0003591_11150_11989 | 277 |
| 70 | 3300054114 | Ga0501084_0125491 | Ga0501084_0125491_661_1500 | 277 |
| 71 | 3300060353 | Ga0501082_0109256 | Ga0501082_0109256_955_1794 | 277 |
| 72 | 3300005334 | Ga0068869_100310188 | Ga0068869_1003101882 | 278 |
| 73 | 3300005539 | Ga0068853_100695837 | Ga0068853_1006958371 | 278 |
| 74 | 3300005563 | Ga0068855_100306483 | Ga0068855_1003064832 | 278 |
| 75 | 3300005617 | Ga0068859_100125629 | Ga0068859_1001256291 | 278 |
| 76 | 3300006847 | Ga0075431_100197388 | Ga0075431_1001973882 | 278 |
| 77 | 3300006931 | Ga0097620_100125627 | Ga0097620_1001256271 | 278 |
| 78 | 3300010375 | Ga0105239_10072593 | Ga0105239_100725932 | 278 |
| 79 | 3300025942 | Ga0207689_10242103 | Ga0207689_102421032 | 278 |
| 80 | 3300025949 | Ga0207667_10376890 | Ga0207667_103768902 | 278 |
| 81 | 3300026035 | Ga0207703_10472572 | Ga0207703_104725722 | 278 |
| 82 | 3300050510 | nmdc:mga06r32_522957_c1 | nmdc:mga06r32_522957_c1_56_916 | 278 |
| 83 | 3300003775 | Ga0055524_1000307 | Ga0055524_100030731 | 279 |
| 84 | 3300005345 | Ga0070692_10037555 | Ga0070692_100375553 | 279 |
| 85 | 3300006946 | Ga0079104_1000009 | Ga0079104_1000009206 | 279 |
| 86 | 3300025298 | Ga0209050_1012401 | Ga0209050_10124013 | 279 |
| 87 | 3300025299 | Ga0209256_1000019 | Ga0209256_1000019266 | 279 |
| 88 | 3300026075 | Ga0207708_10055487 | Ga0207708_100554871 | 279 |
| 89 | 3300027111 | Ga0209281_1000023 | Ga0209281_1000023181 | 279 |
| 90 | 3300048917 | Ga0496114_0019669 | Ga0496114_0019669_3455_4324 | 279 |
| 91 | 3300005330 | Ga0070690_100007358 | Ga0070690_1000073585 | 280 |
| 92 | 3300005334 | Ga0068869_100050505 | Ga0068869_1000505054 | 280 |
| 93 | 3300005340 | Ga0070689_100041651 | Ga0070689_1000416513 | 280 |
| 94 | 3300005356 | Ga0070674_100171886 | Ga0070674_1001718862 | 280 |
| 95 | 3300005365 | Ga0070688_100200044 | Ga0070688_1002000442 | 280 |
| 96 | 3300005438 | Ga0070701_10111425 | Ga0070701_101114252 | 280 |
| 97 | 3300005441 | Ga0070700_100014869 | Ga0070700_1000148694 | 280 |
| 98 | 3300005444 | Ga0070694_100017968 | Ga0070694_1000179684 | 280 |
| 99 | 3300005456 | Ga0070678_100046894 | Ga0070678_1000468944 | 280 |
| 100 | 3300005539 | Ga0068853_100595176 | Ga0068853_1005951762 | 280 |
| 101 | 3300005544 | Ga0070686_100028942 | Ga0070686_1000289424 | 280 |
| 102 | 3300005545 | Ga0070695_100158984 | Ga0070695_1001589842 | 280 |
| 103 | 3300005615 | Ga0070702_100133252 | Ga0070702_1001332522 | 280 |
| 104 | 3300005718 | Ga0068866_10000828 | Ga0068866_1000082813 | 280 |
| 105 | 3300005840 | Ga0068870_10098751 | Ga0068870_100987513 | 280 |
| 106 | 3300005842 | Ga0068858_100086733 | Ga0068858_1000867334 | 280 |
| 107 | 3300005844 | Ga0068862_100133152 | Ga0068862_1001331522 | 280 |
| 108 | 3300006237 | Ga0097621_100043957 | Ga0097621_1000439575 | 280 |
| 109 | 3300006358 | Ga0068871_100087053 | Ga0068871_1000870534 | 280 |
| 110 | 3300006881 | Ga0068865_100001220 | Ga0068865_10000122013 | 280 |
| 111 | 3300009098 | Ga0105245_10012460 | Ga0105245_100124607 | 280 |
| 112 | 3300009176 | Ga0105242_10052063 | Ga0105242_100520634 | 280 |
| 113 | 3300009553 | Ga0105249_10106076 | Ga0105249_101060764 | 280 |
| 114 | 3300013297 | Ga0157378_10004523 | Ga0157378_100045238 | 280 |
| 115 | 3300025934 | Ga0207686_10000342 | Ga0207686_1000034228 | 280 |
| 116 | 3300025935 | Ga0207709_10004313 | Ga0207709_100043137 | 280 |
| 117 | 3300025936 | Ga0207670_10041598 | Ga0207670_100415983 | 280 |
| 118 | 3300025942 | Ga0207689_10002349 | Ga0207689_100023497 | 280 |
| 119 | 3300026035 | Ga0207703_10040827 | Ga0207703_100408274 | 280 |
| 120 | 3300026041 | Ga0207639_10557116 | Ga0207639_105571162 | 280 |
| 121 | 3300026075 | Ga0207708_10013908 | Ga0207708_100139084 | 280 |
| 122 | 3300026089 | Ga0207648_10001010 | Ga0207648_1000101014 | 280 |
| 123 | 3300026118 | Ga0207675_100000430 | Ga0207675_10000043036 | 280 |
| 124 | 3300026121 | Ga0207683_10072975 | Ga0207683_100729754 | 280 |
| 125 | 3300028380 | Ga0268265_10074481 | Ga0268265_100744813 | 280 |
| 126 | 3300007265 | Ga0099794_10046632 | Ga0099794_100466322 | 281 |
| 127 | 3300009148 | Ga0105243_10116181 | Ga0105243_101161812 | 281 |
| 128 | 3300009553 | Ga0105249_10871406 | Ga0105249_108714061 | 281 |
| 129 | 3300010159 | Ga0099796_10043333 | Ga0099796_100433332 | 281 |
| 130 | 3300010375 | Ga0105239_10052692 | Ga0105239_100526926 | 281 |
| 131 | 3300013100 | Ga0157373_10000388 | Ga0157373_1000038833 | 281 |
| 132 | 3300013102 | Ga0157371_10211777 | Ga0157371_102117772 | 281 |
| 133 | 3300013297 | Ga0157378_10314440 | Ga0157378_103144402 | 281 |
| 134 | 3300013306 | Ga0163162_10253513 | Ga0163162_102535132 | 281 |
| 135 | 3300013307 | Ga0157372_10000105 | Ga0157372_1000010580 | 281 |
| 136 | 3300013308 | Ga0157375_10254687 | Ga0157375_102546871 | 281 |
| 137 | 3300014326 | Ga0157380_10165439 | Ga0157380_101654392 | 281 |
| 138 | 3300014745 | Ga0157377_10076649 | Ga0157377_100766492 | 281 |
| 139 | 3300034817 | Ga0373948_0018968 | Ga0373948_0018968_26_877 | 281 |
| 140 | 3300035090 | Ga0373949_0001601 | Ga0373949_0001601_4710_5561 | 281 |
| 141 | 3300035091 | Ga0373951_0014834 | Ga0373951_0014834_540_1391 | 281 |
| 142 | 3300035691 | Ga0373931_0075511 | Ga0373931_0075511_723_1574 | 281 |
| 143 | 3300042005 | Ga0439448_0004613 | Ga0439448_0004613_2358_3209 | 281 |
| 144 | 3300045051 | Ga0451576_0007231 | Ga0451576_0007231_5765_6616 | 281 |
| 145 | 3300045051 | Ga0451576_0063275 | Ga0451576_0063275_2971_3822 | 281 |
| 146 | 3300045051 | Ga0451576_0075385 | Ga0451576_0075385_1373_2224 | 281 |
| 147 | 3300045051 | Ga0451576_0098364 | Ga0451576_0098364_1153_2004 | 281 |
| 148 | 3300046472 | Ga0495580_0093037 | Ga0495580_0093037_1091_1942 | 281 |
| 149 | 3300048914 | Ga0496111_0378396 | Ga0496111_0378396_49_900 | 281 |
| 150 | 3300048915 | Ga0496112_0099084 | Ga0496112_0099084_1999_2850 | 281 |
| 151 | 3300049588 | Ga0501072_0061061 | Ga0501072_0061061_522_1373 | 281 |
| 152 | 3300050512 | nmdc:mga0n895_18672_c1 | nmdc:mga0n895_18672_c1_2862_3713 | 281 |
| 153 | 3300050513 | nmdc:mga0rr50_4993_c1 | nmdc:mga0rr50_4993_c1_2151_3002 | 281 |
| 154 | 3300050515 | nmdc:mga0a205_2749_c1 | nmdc:mga0a205_2749_c1_5531_6382 | 281 |
| 155 | 3300005354 | Ga0070675_100405175 | Ga0070675_1004051752 | 283 |
| 156 | 3300005444 | Ga0070694_100000224 | Ga0070694_10000022419 | 283 |
| 157 | 3300005536 | Ga0070697_100014184 | Ga0070697_1000141842 | 283 |
| 158 | 3300007076 | Ga0075435_100376734 | Ga0075435_1003767341 | 283 |
| 159 | 3300009147 | Ga0114129_10117245 | Ga0114129_101172453 | 283 |
| 160 | 3300031548 | Ga0307408_100221434 | Ga0307408_1002214342 | 283 |
| 161 | 3300031731 | Ga0307405_10125823 | Ga0307405_101258231 | 283 |
| 162 | 3300031824 | Ga0307413_10015212 | Ga0307413_100152123 | 283 |
| 163 | 3300031852 | Ga0307410_10064110 | Ga0307410_100641102 | 283 |
| 164 | 3300031903 | Ga0307407_10035366 | Ga0307407_100353663 | 283 |
| 165 | 3300031911 | Ga0307412_10025051 | Ga0307412_100250514 | 283 |
| 166 | 3300031995 | Ga0307409_100014522 | Ga0307409_1000145224 | 283 |
| 167 | 3300032002 | Ga0307416_100104526 | Ga0307416_1001045264 | 283 |
| 168 | 3300032004 | Ga0307414_10115699 | Ga0307414_101156992 | 283 |
| 169 | 3300032126 | Ga0307415_100009625 | Ga0307415_1000096255 | 283 |
| 170 | 3300050508 | nmdc:mga09592_535751_c1 | nmdc:mga09592_535751_c1_14_868 | 283 |
| 171 | 3300005290 | Ga0065712_10000569 | Ga0065712_100005698 | 284 |
| 172 | 3300005290 | Ga0065712_10068007 | Ga0065712_100680078 | 284 |
| 173 | 3300005293 | Ga0065715_10000426 | Ga0065715_100004267 | 284 |
| 174 | 3300005293 | Ga0065715_10009394 | Ga0065715_100093943 | 284 |
| 175 | 3300005295 | Ga0065707_10013686 | Ga0065707_100136862 | 284 |
| 176 | 3300005295 | Ga0065707_10033544 | Ga0065707_100335442 | 284 |
| 177 | 3300005295 | Ga0065707_10098051 | Ga0065707_100980514 | 284 |
| 178 | 3300005327 | Ga0070658_10202046 | Ga0070658_102020462 | 284 |
| 179 | 3300005330 | Ga0070690_100001728 | Ga0070690_1000017288 | 284 |
| 180 | 3300005331 | Ga0070670_100000241 | Ga0070670_10000024112 | 284 |
| 181 | 3300005335 | Ga0070666_10023588 | Ga0070666_100235883 | 284 |
| 182 | 3300005336 | Ga0070680_100055288 | Ga0070680_1000552882 | 284 |
| 183 | 3300005337 | Ga0070682_100027582 | Ga0070682_1000275823 | 284 |
| 184 | 3300005339 | Ga0070660_100136885 | Ga0070660_1001368852 | 284 |
| 185 | 3300005341 | Ga0070691_10003903 | Ga0070691_100039035 | 284 |
| 186 | 3300005343 | Ga0070687_100154047 | Ga0070687_1001540472 | 284 |
| 187 | 3300005344 | Ga0070661_100064324 | Ga0070661_1000643244 | 284 |
| 188 | 3300005353 | Ga0070669_100062838 | Ga0070669_1000628384 | 284 |
| 189 | 3300005354 | Ga0070675_100015962 | Ga0070675_1000159624 | 284 |
| 190 | 3300005355 | Ga0070671_100123386 | Ga0070671_1001233862 | 284 |
| 191 | 3300005356 | Ga0070674_100171294 | Ga0070674_1001712942 | 284 |
| 192 | 3300005364 | Ga0070673_100009896 | Ga0070673_1000098963 | 284 |
| 193 | 3300005366 | Ga0070659_100070890 | Ga0070659_1000708902 | 284 |
| 194 | 3300005366 | Ga0070659_100103382 | Ga0070659_1001033822 | 284 |
| 195 | 3300005367 | Ga0070667_100009817 | Ga0070667_1000098175 | 284 |
| 196 | 3300005439 | Ga0070711_100053264 | Ga0070711_1000532642 | 284 |
| 197 | 3300005441 | Ga0070700_100093866 | Ga0070700_1000938661 | 284 |
| 198 | 3300005444 | Ga0070694_100008818 | Ga0070694_1000088186 | 284 |
| 199 | 3300005455 | Ga0070663_100050570 | Ga0070663_1000505703 | 284 |
| 200 | 3300005456 | Ga0070678_100061976 | Ga0070678_1000619763 | 284 |
| 201 | 3300005458 | Ga0070681_10019365 | Ga0070681_100193654 | 284 |
| 202 | 3300005467 | Ga0070706_100221774 | Ga0070706_1002217742 | 284 |
| 203 | 3300005468 | Ga0070707_100025476 | Ga0070707_1000254764 | 284 |
| 204 | 3300005471 | Ga0070698_100366466 | Ga0070698_1003664662 | 284 |
| 205 | 3300005518 | Ga0070699_100401869 | Ga0070699_1004018691 | 284 |
| 206 | 3300005530 | Ga0070679_100050772 | Ga0070679_1000507725 | 284 |
| 207 | 3300005536 | Ga0070697_100031141 | Ga0070697_1000311414 | 284 |
| 208 | 3300005536 | Ga0070697_100109797 | Ga0070697_1001097971 | 284 |
| 209 | 3300005536 | Ga0070697_100308162 | Ga0070697_1003081621 | 284 |
| 210 | 3300005539 | Ga0068853_100690159 | Ga0068853_1006901591 | 284 |
| 211 | 3300005543 | Ga0070672_100055242 | Ga0070672_1000552423 | 284 |
| 212 | 3300005544 | Ga0070686_100069349 | Ga0070686_1000693493 | 284 |
| 213 | 3300005545 | Ga0070695_100017441 | Ga0070695_1000174414 | 284 |
| 214 | 3300005548 | Ga0070665_100602142 | Ga0070665_1006021421 | 284 |
| 215 | 3300005564 | Ga0070664_100001253 | Ga0070664_10000125312 | 284 |
| 216 | 3300005577 | Ga0068857_100583951 | Ga0068857_1005839511 | 284 |
| 217 | 3300005614 | Ga0068856_100012019 | Ga0068856_1000120191 | 284 |
| 218 | 3300005615 | Ga0070702_100133666 | Ga0070702_1001336661 | 284 |
| 219 | 3300005618 | Ga0068864_100261819 | Ga0068864_1002618192 | 284 |
| 220 | 3300005719 | Ga0068861_100134543 | Ga0068861_1001345432 | 284 |
| 221 | 3300005842 | Ga0068858_100101985 | Ga0068858_1001019853 | 284 |
| 222 | 3300005937 | Ga0081455_10000729 | Ga0081455_100007296 | 284 |
| 223 | 3300005937 | Ga0081455_10061577 | Ga0081455_100615772 | 284 |
| 224 | 3300005981 | Ga0081538_10003654 | Ga0081538_100036543 | 284 |
| 225 | 3300006058 | Ga0075432_10017183 | Ga0075432_100171833 | 284 |
| 226 | 3300006175 | Ga0070712_100153368 | Ga0070712_1001533682 | 284 |
| 227 | 3300006846 | Ga0075430_100113233 | Ga0075430_1001132332 | 284 |
| 228 | 3300006846 | Ga0075430_100162306 | Ga0075430_1001623062 | 284 |
| 229 | 3300006847 | Ga0075431_100000693 | Ga0075431_10000069314 | 284 |
| 230 | 3300006847 | Ga0075431_100029643 | Ga0075431_1000296433 | 284 |
| 231 | 3300006847 | Ga0075431_100309626 | Ga0075431_1003096262 | 284 |
| 232 | 3300006852 | Ga0075433_10052962 | Ga0075433_100529622 | 284 |
| 233 | 3300006852 | Ga0075433_10132243 | Ga0075433_101322432 | 284 |
| 234 | 3300006852 | Ga0075433_10156533 | Ga0075433_101565332 | 284 |
| 235 | 3300006852 | Ga0075433_10336838 | Ga0075433_103368382 | 284 |
| 236 | 3300006871 | Ga0075434_100000912 | Ga0075434_1000009124 | 284 |
| 237 | 3300006871 | Ga0075434_100003395 | Ga0075434_10000339510 | 284 |
| 238 | 3300006871 | Ga0075434_100050614 | Ga0075434_1000506141 | 284 |
| 239 | 3300006871 | Ga0075434_100053087 | Ga0075434_1000530874 | 284 |
| 240 | 3300006871 | Ga0075434_100379040 | Ga0075434_1003790402 | 284 |
| 241 | 3300006871 | Ga0075434_100664921 | Ga0075434_1006649211 | 284 |
| 242 | 3300006881 | Ga0068865_100072944 | Ga0068865_1000729444 | 284 |
| 243 | 3300006914 | Ga0075436_100078664 | Ga0075436_1000786642 | 284 |
| 244 | 3300007076 | Ga0075435_100005380 | Ga0075435_1000053802 | 284 |
| 245 | 3300007076 | Ga0075435_100096467 | Ga0075435_1000964671 | 284 |
| 246 | 3300009094 | Ga0111539_10254829 | Ga0111539_102548292 | 284 |
| 247 | 3300009094 | Ga0111539_10287538 | Ga0111539_102875381 | 284 |
| 248 | 3300009094 | Ga0111539_10704697 | Ga0111539_107046972 | 284 |
| 249 | 3300009147 | Ga0114129_10022306 | Ga0114129_100223064 | 284 |
| 250 | 3300009174 | Ga0105241_10009789 | Ga0105241_100097895 | 284 |
| 251 | 3300009545 | Ga0105237_10039387 | Ga0105237_100393874 | 284 |
| 252 | 3300009551 | Ga0105238_10105126 | Ga0105238_101051262 | 284 |
| 253 | 3300010375 | Ga0105239_10017697 | Ga0105239_100176975 | 284 |
| 254 | 3300013100 | Ga0157373_10092948 | Ga0157373_100929482 | 284 |
| 255 | 3300013297 | Ga0157378_10548293 | Ga0157378_105482932 | 284 |
| 256 | 3300013306 | Ga0163162_10017943 | Ga0163162_100179435 | 284 |
| 257 | 3300013306 | Ga0163162_10574437 | Ga0163162_105744371 | 284 |
| 258 | 3300013307 | Ga0157372_10032766 | Ga0157372_100327664 | 284 |
| 259 | 3300013308 | Ga0157375_10219956 | Ga0157375_102199562 | 284 |
| 260 | 3300014325 | Ga0163163_10362778 | Ga0163163_103627782 | 284 |
| 261 | 3300014745 | Ga0157377_10167380 | Ga0157377_101673801 | 284 |
| 262 | 3300014969 | Ga0157376_10010980 | Ga0157376_100109805 | 284 |
| 263 | 3300025901 | Ga0207688_10014828 | Ga0207688_100148284 | 284 |
| 264 | 3300025907 | Ga0207645_10020234 | Ga0207645_100202345 | 284 |
| 265 | 3300025912 | Ga0207707_10032009 | Ga0207707_100320094 | 284 |
| 266 | 3300025914 | Ga0207671_10068612 | Ga0207671_100686122 | 284 |
| 267 | 3300025915 | Ga0207693_10154107 | Ga0207693_101541073 | 284 |
| 268 | 3300025916 | Ga0207663_10067419 | Ga0207663_100674193 | 284 |
| 269 | 3300025917 | Ga0207660_10025398 | Ga0207660_100253984 | 284 |
| 270 | 3300025918 | Ga0207662_10287351 | Ga0207662_102873512 | 284 |
| 271 | 3300025919 | Ga0207657_10002201 | Ga0207657_1000220113 | 284 |
| 272 | 3300025921 | Ga0207652_10118130 | Ga0207652_101181302 | 284 |
| 273 | 3300025923 | Ga0207681_10042038 | Ga0207681_100420382 | 284 |
| 274 | 3300025925 | Ga0207650_10001805 | Ga0207650_100018057 | 284 |
| 275 | 3300025927 | Ga0207687_10241313 | Ga0207687_102413132 | 284 |
| 276 | 3300025932 | Ga0207690_10012404 | Ga0207690_100124042 | 284 |
| 277 | 3300025933 | Ga0207706_10002107 | Ga0207706_100021078 | 284 |
| 278 | 3300025940 | Ga0207691_10008329 | Ga0207691_100083293 | 284 |
| 279 | 3300025942 | Ga0207689_10056084 | Ga0207689_100560843 | 284 |
| 280 | 3300025945 | Ga0207679_10016389 | Ga0207679_100163891 | 284 |
| 281 | 3300025981 | Ga0207640_10045090 | Ga0207640_100450902 | 284 |
| 282 | 3300026067 | Ga0207678_10006728 | Ga0207678_100067286 | 284 |
| 283 | 3300026075 | Ga0207708_10027482 | Ga0207708_100274822 | 284 |
| 284 | 3300026078 | Ga0207702_10082368 | Ga0207702_100823683 | 284 |
| 285 | 3300026095 | Ga0207676_10218077 | Ga0207676_102180771 | 284 |
| 286 | 3300026118 | Ga0207675_100170986 | Ga0207675_1001709862 | 284 |
| 287 | 3300026121 | Ga0207683_10001733 | Ga0207683_1000173313 | 284 |
| 288 | 3300028381 | Ga0268264_10430533 | Ga0268264_104305332 | 284 |
| 289 | 3300031548 | Ga0307408_100337599 | Ga0307408_1003375991 | 284 |
| 290 | 3300031731 | Ga0307405_10117364 | Ga0307405_101173642 | 284 |
| 291 | 3300031911 | Ga0307412_10052185 | Ga0307412_100521853 | 284 |
| 292 | 3300032002 | Ga0307416_100007444 | Ga0307416_1000074444 | 284 |
| 293 | 3300032126 | Ga0307415_100019016 | Ga0307415_1000190164 | 284 |
| 294 | 3300035112 | Ga0373932_0017901 | Ga0373932_0017901_235_1092 | 284 |
| 295 | 3300035691 | Ga0373931_0003309 | Ga0373931_0003309_1380_2237 | 284 |
| 296 | 3300048909 | Ga0496106_0197223 | Ga0496106_0197223_316_1176 | 284 |
| 297 | 3300048915 | Ga0496112_0069699 | Ga0496112_0069699_1554_2414 | 284 |
| 298 | 3300048915 | Ga0496112_0235777 | Ga0496112_0235777_570_1430 | 284 |
| 299 | 3300049568 | Ga0501031_0034922 | Ga0501031_0034922_2193_3050 | 284 |
| 300 | 3300049570 | Ga0501033_0093134 | Ga0501033_0093134_1314_2171 | 284 |
| 301 | 3300049572 | Ga0501036_0021698 | Ga0501036_0021698_102_959 | 284 |
| 302 | 3300049573 | Ga0501037_0015751 | Ga0501037_0015751_3279_4136 | 284 |
| 303 | 3300049574 | Ga0501038_0002511 | Ga0501038_0002511_2817_3674 | 284 |
| 304 | 3300049575 | Ga0501039_0001556 | Ga0501039_0001556_10140_10997 | 284 |
| 305 | 3300049576 | Ga0501040_0003219 | Ga0501040_0003219_5829_6686 | 284 |
| 306 | 3300049577 | Ga0501041_0000212 | Ga0501041_0000212_11947_12804 | 284 |
| 307 | 3300049578 | Ga0501042_0000098 | Ga0501042_0000098_25837_26694 | 284 |
| 308 | 3300049579 | Ga0501043_0010972 | Ga0501043_0010972_18_875 | 284 |
| 309 | 3300049580 | Ga0501046_0015300 | Ga0501046_0015300_917_1774 | 284 |
| 310 | 3300049582 | Ga0501048_0004806 | Ga0501048_0004806_2914_3771 | 284 |
| 311 | 3300049585 | Ga0501069_0060479 | Ga0501069_0060479_1131_1988 | 284 |
| 312 | 3300049586 | Ga0501070_0017605 | Ga0501070_0017605_2776_3633 | 284 |
| 313 | 3300049587 | Ga0501071_0000452 | Ga0501071_0000452_5787_6644 | 284 |
| 314 | 3300049587 | Ga0501071_0310443 | Ga0501071_0310443_84_941 | 284 |
| 315 | 3300049588 | Ga0501072_0241360 | Ga0501072_0241360_454_1311 | 284 |
| 316 | 3300049590 | Ga0501074_0004506 | Ga0501074_0004506_4489_5346 | 284 |
| 317 | 3300049591 | Ga0501075_0000095 | Ga0501075_0000095_25830_26687 | 284 |
| 318 | 3300049592 | Ga0501076_0000386 | Ga0501076_0000386_2855_3712 | 284 |
| 319 | 3300049593 | Ga0501077_0000670 | Ga0501077_0000670_15094_15951 | 284 |
| 320 | 3300049593 | Ga0501077_0010466 | Ga0501077_0010466_1717_2574 | 284 |
| 321 | 3300049741 | Ga0501079_0001514 | Ga0501079_0001514_13958_14815 | 284 |
| 322 | 3300049743 | Ga0501081_0000063 | Ga0501081_0000063_14201_15058 | 284 |
| 323 | 3300049743 | Ga0501081_0224113 | Ga0501081_0224113_152_1009 | 284 |
| 324 | 3300049744 | Ga0501083_0007185 | Ga0501083_0007185_2480_3337 | 284 |
| 325 | 3300049822 | Ga0501035_0056322 | Ga0501035_0056322_692_1549 | 284 |
| 326 | 3300049824 | Ga0501045_0000186 | Ga0501045_0000186_6637_7494 | 284 |
| 327 | 3300050509 | nmdc:mga0qj67_135159_c1 | nmdc:mga0qj67_135159_c1_54_911 | 284 |
| 328 | 3300050509 | nmdc:mga0qj67_180495_c1 | nmdc:mga0qj67_180495_c1_446_1300 | 284 |
| 329 | 3300050509 | nmdc:mga0qj67_500283_c1 | nmdc:mga0qj67_500283_c1_19_882 | 284 |
| 330 | 3300050510 | nmdc:mga06r32_1752_c1 | nmdc:mga06r32_1752_c1_15242_16105 | 284 |
| 331 | 3300050510 | nmdc:mga06r32_256716_c1 | nmdc:mga06r32_256716_c1_852_1709 | 284 |
| 332 | 3300050510 | nmdc:mga06r32_68548_c1 | nmdc:mga06r32_68548_c1_1062_1916 | 284 |
| 333 | 3300050511 | nmdc:mga08y16_277408_c1 | nmdc:mga08y16_277408_c1_10_867 | 284 |
| 334 | 3300050511 | nmdc:mga08y16_570589_c1 | nmdc:mga08y16_570589_c1_97_957 | 284 |
| 335 | 3300050511 | nmdc:mga08y16_94837_c1 | nmdc:mga08y16_94837_c1_164_1024 | 284 |
| 336 | 3300050512 | nmdc:mga0n895_237255_c1 | nmdc:mga0n895_237255_c1_682_1539 | 284 |
| 337 | 3300050512 | nmdc:mga0n895_25810_c1 | nmdc:mga0n895_25810_c1_3841_4701 | 284 |
| 338 | 3300050513 | nmdc:mga0rr50_49669_c1 | nmdc:mga0rr50_49669_c1_2115_2975 | 284 |
| 339 | 3300050513 | nmdc:mga0rr50_94600_c1 | nmdc:mga0rr50_94600_c1_91_948 | 284 |
| 340 | 3300050514 | nmdc:mga08x19_114342_c1 | nmdc:mga08x19_114342_c1_872_1732 | 284 |
| 341 | 3300054114 | Ga0501084_0000662 | Ga0501084_0000662_22562_23419 | 284 |
| 342 | 3300060353 | Ga0501082_0000921 | Ga0501082_0000921_4748_5605 | 284 |
| 343 | 3300061734 | Ga0530510_0007331 | Ga0530510_0007331_4113_4970 | 284 |
| 344 | 3300061734 | Ga0530510_0166035 | Ga0530510_0166035_427_1284 | 284 |
| 345 | 2162886006 | SwRhRL3b_contig_1476970 | SwRhRL3b_0290.00000520 | 285 |
| 346 | 3300003911 | JGI25405J52794_10003167 | JGI25405J52794_100031672 | 285 |
| 347 | 3300005293 | Ga0065715_10114658 | Ga0065715_101146583 | 285 |
| 348 | 3300005295 | Ga0065707_10003569 | Ga0065707_100035694 | 285 |
| 349 | 3300005295 | Ga0065707_10010381 | Ga0065707_100103813 | 285 |
| 350 | 3300005328 | Ga0070676_10006146 | Ga0070676_100061463 | 285 |
| 351 | 3300005330 | Ga0070690_100195632 | Ga0070690_1001956322 | 285 |
| 352 | 3300005331 | Ga0070670_100011459 | Ga0070670_1000114597 | 285 |
| 353 | 3300005334 | Ga0068869_100012652 | Ga0068869_1000126524 | 285 |
| 354 | 3300005336 | Ga0070680_100001386 | Ga0070680_1000013866 | 285 |
| 355 | 3300005336 | Ga0070680_100017312 | Ga0070680_1000173122 | 285 |
| 356 | 3300005336 | Ga0070680_100022831 | Ga0070680_1000228315 | 285 |
| 357 | 3300005336 | Ga0070680_100160637 | Ga0070680_1001606372 | 285 |
| 358 | 3300005337 | Ga0070682_100000179 | Ga0070682_1000001798 | 285 |
| 359 | 3300005338 | Ga0068868_100029544 | Ga0068868_1000295443 | 285 |
| 360 | 3300005339 | Ga0070660_100009221 | Ga0070660_1000092217 | 285 |
| 361 | 3300005340 | Ga0070689_100015332 | Ga0070689_1000153323 | 285 |
| 362 | 3300005341 | Ga0070691_10002490 | Ga0070691_100024902 | 285 |
| 363 | 3300005343 | Ga0070687_100029307 | Ga0070687_1000293073 | 285 |
| 364 | 3300005343 | Ga0070687_100071564 | Ga0070687_1000715642 | 285 |
| 365 | 3300005344 | Ga0070661_100001244 | Ga0070661_10000124414 | 285 |
| 366 | 3300005345 | Ga0070692_10004506 | Ga0070692_100045065 | 285 |
| 367 | 3300005345 | Ga0070692_10005570 | Ga0070692_100055702 | 285 |
| 368 | 3300005353 | Ga0070669_100067667 | Ga0070669_1000676673 | 285 |
| 369 | 3300005354 | Ga0070675_100047188 | Ga0070675_1000471883 | 285 |
| 370 | 3300005355 | Ga0070671_100155151 | Ga0070671_1001551512 | 285 |
| 371 | 3300005364 | Ga0070673_100150891 | Ga0070673_1001508912 | 285 |
| 372 | 3300005366 | Ga0070659_100000831 | Ga0070659_10000083121 | 285 |
| 373 | 3300005438 | Ga0070701_10014437 | Ga0070701_100144373 | 285 |
| 374 | 3300005438 | Ga0070701_10025346 | Ga0070701_100253462 | 285 |
| 375 | 3300005438 | Ga0070701_10028186 | Ga0070701_100281861 | 285 |
| 376 | 3300005440 | Ga0070705_100001080 | Ga0070705_10000108013 | 285 |
| 377 | 3300005440 | Ga0070705_100034025 | Ga0070705_1000340251 | 285 |
| 378 | 3300005440 | Ga0070705_100205647 | Ga0070705_1002056472 | 285 |
| 379 | 3300005441 | Ga0070700_100188399 | Ga0070700_1001883991 | 285 |
| 380 | 3300005444 | Ga0070694_100003004 | Ga0070694_1000030044 | 285 |
| 381 | 3300005444 | Ga0070694_100018562 | Ga0070694_1000185622 | 285 |
| 382 | 3300005444 | Ga0070694_100038937 | Ga0070694_1000389374 | 285 |
| 383 | 3300005445 | Ga0070708_100028448 | Ga0070708_1000284484 | 285 |
| 384 | 3300005455 | Ga0070663_100096591 | Ga0070663_1000965912 | 285 |
| 385 | 3300005457 | Ga0070662_100015674 | Ga0070662_1000156743 | 285 |
| 386 | 3300005458 | Ga0070681_10026811 | Ga0070681_100268112 | 285 |
| 387 | 3300005467 | Ga0070706_100340272 | Ga0070706_1003402721 | 285 |
| 388 | 3300005467 | Ga0070706_100384195 | Ga0070706_1003841951 | 285 |
| 389 | 3300005468 | Ga0070707_100011228 | Ga0070707_10001122810 | 285 |
| 390 | 3300005468 | Ga0070707_100018261 | Ga0070707_1000182614 | 285 |
| 391 | 3300005468 | Ga0070707_100233555 | Ga0070707_1002335552 | 285 |
| 392 | 3300005471 | Ga0070698_100028441 | Ga0070698_1000284417 | 285 |
| 393 | 3300005471 | Ga0070698_100571346 | Ga0070698_1005713461 | 285 |
| 394 | 3300005471 | Ga0070698_100693880 | Ga0070698_1006938801 | 285 |
| 395 | 3300005518 | Ga0070699_100201344 | Ga0070699_1002013441 | 285 |
| 396 | 3300005518 | Ga0070699_100332078 | Ga0070699_1003320782 | 285 |
| 397 | 3300005518 | Ga0070699_100457426 | Ga0070699_1004574261 | 285 |
| 398 | 3300005530 | Ga0070679_100001386 | Ga0070679_10000138613 | 285 |
| 399 | 3300005530 | Ga0070679_100072710 | Ga0070679_1000727103 | 285 |
| 400 | 3300005535 | Ga0070684_100290083 | Ga0070684_1002900832 | 285 |
| 401 | 3300005536 | Ga0070697_100009161 | Ga0070697_1000091616 | 285 |
| 402 | 3300005536 | Ga0070697_100112358 | Ga0070697_1001123582 | 285 |
| 403 | 3300005536 | Ga0070697_100198555 | Ga0070697_1001985551 | 285 |
| 404 | 3300005536 | Ga0070697_100339168 | Ga0070697_1003391682 | 285 |
| 405 | 3300005539 | Ga0068853_100013726 | Ga0068853_1000137265 | 285 |
| 406 | 3300005545 | Ga0070695_100007445 | Ga0070695_1000074453 | 285 |
| 407 | 3300005545 | Ga0070695_100033167 | Ga0070695_1000331673 | 285 |
| 408 | 3300005545 | Ga0070695_100065518 | Ga0070695_1000655181 | 285 |
| 409 | 3300005546 | Ga0070696_100001530 | Ga0070696_10000153013 | 285 |
| 410 | 3300005546 | Ga0070696_100044218 | Ga0070696_1000442184 | 285 |
| 411 | 3300005546 | Ga0070696_100069326 | Ga0070696_1000693261 | 285 |
| 412 | 3300005546 | Ga0070696_100079092 | Ga0070696_1000790922 | 285 |
| 413 | 3300005547 | Ga0070693_100003136 | Ga0070693_1000031366 | 285 |
| 414 | 3300005549 | Ga0070704_100001927 | Ga0070704_1000019277 | 285 |
| 415 | 3300005549 | Ga0070704_100184482 | Ga0070704_1001844821 | 285 |
| 416 | 3300005563 | Ga0068855_100004335 | Ga0068855_10000433513 | 285 |
| 417 | 3300005564 | Ga0070664_100009717 | Ga0070664_1000097176 | 285 |
| 418 | 3300005577 | Ga0068857_100014057 | Ga0068857_1000140577 | 285 |
| 419 | 3300005578 | Ga0068854_100027889 | Ga0068854_1000278892 | 285 |
| 420 | 3300005614 | Ga0068856_100007569 | Ga0068856_1000075695 | 285 |
| 421 | 3300005615 | Ga0070702_100017997 | Ga0070702_1000179974 | 285 |
| 422 | 3300005616 | Ga0068852_100019708 | Ga0068852_1000197084 | 285 |
| 423 | 3300005617 | Ga0068859_100010607 | Ga0068859_1000106074 | 285 |
| 424 | 3300005618 | Ga0068864_100002599 | Ga0068864_10000259917 | 285 |
| 425 | 3300005718 | Ga0068866_10211184 | Ga0068866_102111841 | 285 |
| 426 | 3300005719 | Ga0068861_100054063 | Ga0068861_1000540632 | 285 |
| 427 | 3300005840 | Ga0068870_10013306 | Ga0068870_100133063 | 285 |
| 428 | 3300005840 | Ga0068870_10031139 | Ga0068870_100311392 | 285 |
| 429 | 3300005841 | Ga0068863_100009792 | Ga0068863_1000097927 | 285 |
| 430 | 3300005841 | Ga0068863_100117421 | Ga0068863_1001174212 | 285 |
| 431 | 3300005842 | Ga0068858_100035026 | Ga0068858_1000350264 | 285 |
| 432 | 3300005843 | Ga0068860_100035984 | Ga0068860_1000359844 | 285 |
| 433 | 3300005843 | Ga0068860_100061678 | Ga0068860_1000616782 | 285 |
| 434 | 3300005844 | Ga0068862_100005264 | Ga0068862_1000052648 | 285 |
| 435 | 3300005844 | Ga0068862_100232690 | Ga0068862_1002326901 | 285 |
| 436 | 3300005937 | Ga0081455_10000592 | Ga0081455_1000059229 | 285 |
| 437 | 3300005983 | Ga0081540_1001918 | Ga0081540_100191819 | 285 |
| 438 | 3300006163 | Ga0070715_10074406 | Ga0070715_100744061 | 285 |
| 439 | 3300006173 | Ga0070716_100009838 | Ga0070716_1000098385 | 285 |
| 440 | 3300006175 | Ga0070712_100282856 | Ga0070712_1002828562 | 285 |
| 441 | 3300006237 | Ga0097621_100241944 | Ga0097621_1002419442 | 285 |
| 442 | 3300006358 | Ga0068871_100090839 | Ga0068871_1000908392 | 285 |
| 443 | 3300006846 | Ga0075430_100141085 | Ga0075430_1001410852 | 285 |
| 444 | 3300006846 | Ga0075430_100243360 | Ga0075430_1002433602 | 285 |
| 445 | 3300006847 | Ga0075431_100013006 | Ga0075431_1000130065 | 285 |
| 446 | 3300006847 | Ga0075431_100145348 | Ga0075431_1001453482 | 285 |
| 447 | 3300006852 | Ga0075433_10002692 | Ga0075433_100026928 | 285 |
| 448 | 3300006852 | Ga0075433_10005196 | Ga0075433_1000519611 | 285 |
| 449 | 3300006852 | Ga0075433_10038361 | Ga0075433_100383612 | 285 |
| 450 | 3300006852 | Ga0075433_10048994 | Ga0075433_100489942 | 285 |
| 451 | 3300006852 | Ga0075433_10099875 | Ga0075433_100998752 | 285 |
| 452 | 3300006871 | Ga0075434_100007287 | Ga0075434_10000728712 | 285 |
| 453 | 3300006871 | Ga0075434_100043308 | Ga0075434_1000433084 | 285 |
| 454 | 3300006871 | Ga0075434_100051353 | Ga0075434_1000513533 | 285 |
| 455 | 3300006871 | Ga0075434_100090497 | Ga0075434_1000904973 | 285 |
| 456 | 3300006880 | Ga0075429_100268518 | Ga0075429_1002685182 | 285 |
| 457 | 3300006880 | Ga0075429_100594286 | Ga0075429_1005942861 | 285 |
| 458 | 3300006881 | Ga0068865_100086951 | Ga0068865_1000869512 | 285 |
| 459 | 3300006881 | Ga0068865_100430228 | Ga0068865_1004302282 | 285 |
| 460 | 3300006914 | Ga0075436_100013488 | Ga0075436_1000134885 | 285 |
| 461 | 3300006914 | Ga0075436_100066888 | Ga0075436_1000668882 | 285 |
| 462 | 3300006914 | Ga0075436_100144203 | Ga0075436_1001442032 | 285 |
| 463 | 3300006931 | Ga0097620_100010607 | Ga0097620_1000106078 | 285 |
| 464 | 3300007076 | Ga0075435_100017406 | Ga0075435_1000174063 | 285 |
| 465 | 3300007076 | Ga0075435_100089479 | Ga0075435_1000894792 | 285 |
| 466 | 3300007076 | Ga0075435_100131920 | Ga0075435_1001319202 | 285 |
| 467 | 3300009094 | Ga0111539_10000535 | Ga0111539_1000053517 | 285 |
| 468 | 3300009094 | Ga0111539_10156466 | Ga0111539_101564663 | 285 |
| 469 | 3300009094 | Ga0111539_10172094 | Ga0111539_101720943 | 285 |
| 470 | 3300009094 | Ga0111539_10192855 | Ga0111539_101928552 | 285 |
| 471 | 3300009147 | Ga0114129_10010794 | Ga0114129_100107945 | 285 |
| 472 | 3300009147 | Ga0114129_10013685 | Ga0114129_100136858 | 285 |
| 473 | 3300009147 | Ga0114129_10046422 | Ga0114129_100464224 | 285 |
| 474 | 3300009147 | Ga0114129_10121943 | Ga0114129_101219432 | 285 |
| 475 | 3300009147 | Ga0114129_10188584 | Ga0114129_101885843 | 285 |
| 476 | 3300009147 | Ga0114129_10423867 | Ga0114129_104238671 | 285 |
| 477 | 3300009147 | Ga0114129_10459872 | Ga0114129_104598722 | 285 |
| 478 | 3300009147 | Ga0114129_10631420 | Ga0114129_106314201 | 285 |
| 479 | 3300009147 | Ga0114129_10957149 | Ga0114129_109571491 | 285 |
| 480 | 3300009148 | Ga0105243_10035210 | Ga0105243_100352104 | 285 |
| 481 | 3300009148 | Ga0105243_10293324 | Ga0105243_102933242 | 285 |
| 482 | 3300009174 | Ga0105241_10084670 | Ga0105241_100846702 | 285 |
| 483 | 3300009176 | Ga0105242_10087728 | Ga0105242_100877283 | 285 |
| 484 | 3300009176 | Ga0105242_10260422 | Ga0105242_102604222 | 285 |
| 485 | 3300009176 | Ga0105242_10551050 | Ga0105242_105510502 | 285 |
| 486 | 3300009176 | Ga0105242_10810151 | Ga0105242_108101511 | 285 |
| 487 | 3300009553 | Ga0105249_10061062 | Ga0105249_100610623 | 285 |
| 488 | 3300009553 | Ga0105249_10065210 | Ga0105249_100652102 | 285 |
| 489 | 3300013297 | Ga0157378_10016364 | Ga0157378_100163643 | 285 |
| 490 | 3300013306 | Ga0163162_10123958 | Ga0163162_101239582 | 285 |
| 491 | 3300013306 | Ga0163162_10140706 | Ga0163162_101407061 | 285 |
| 492 | 3300013306 | Ga0163162_10174875 | Ga0163162_101748752 | 285 |
| 493 | 3300013307 | Ga0157372_10483572 | Ga0157372_104835722 | 285 |
| 494 | 3300014326 | Ga0157380_10788747 | Ga0157380_107887471 | 285 |
| 495 | 3300017792 | Ga0163161_10261952 | Ga0163161_102619521 | 285 |
| 496 | 3300025885 | Ga0207653_10011816 | Ga0207653_100118162 | 285 |
| 497 | 3300025903 | Ga0207680_10316701 | Ga0207680_103167012 | 285 |
| 498 | 3300025905 | Ga0207685_10046379 | Ga0207685_100463792 | 285 |
| 499 | 3300025907 | Ga0207645_10009598 | Ga0207645_100095985 | 285 |
| 500 | 3300025908 | Ga0207643_10000329 | Ga0207643_1000032921 | 285 |
| 501 | 3300025908 | Ga0207643_10019631 | Ga0207643_100196314 | 285 |
| 502 | 3300025910 | Ga0207684_10012875 | Ga0207684_100128755 | 285 |
| 503 | 3300025910 | Ga0207684_10046001 | Ga0207684_100460013 | 285 |
| 504 | 3300025910 | Ga0207684_10314733 | Ga0207684_103147332 | 285 |
| 505 | 3300025911 | Ga0207654_10014749 | Ga0207654_100147491 | 285 |
| 506 | 3300025912 | Ga0207707_10000352 | Ga0207707_1000035230 | 285 |
| 507 | 3300025912 | Ga0207707_10009306 | Ga0207707_100093062 | 285 |
| 508 | 3300025915 | Ga0207693_10066011 | Ga0207693_100660113 | 285 |
| 509 | 3300025916 | Ga0207663_10078825 | Ga0207663_100788253 | 285 |
| 510 | 3300025917 | Ga0207660_10000700 | Ga0207660_100007004 | 285 |
| 511 | 3300025917 | Ga0207660_10009728 | Ga0207660_100097287 | 285 |
| 512 | 3300025917 | Ga0207660_10053857 | Ga0207660_100538573 | 285 |
| 513 | 3300025918 | Ga0207662_10014316 | Ga0207662_100143164 | 285 |
| 514 | 3300025918 | Ga0207662_10072826 | Ga0207662_100728262 | 285 |
| 515 | 3300025919 | Ga0207657_10002264 | Ga0207657_1000226418 | 285 |
| 516 | 3300025920 | Ga0207649_10006672 | Ga0207649_100066724 | 285 |
| 517 | 3300025921 | Ga0207652_10002500 | Ga0207652_1000250013 | 285 |
| 518 | 3300025922 | Ga0207646_10020607 | Ga0207646_100206074 | 285 |
| 519 | 3300025922 | Ga0207646_10022079 | Ga0207646_100220796 | 285 |
| 520 | 3300025922 | Ga0207646_10044313 | Ga0207646_100443134 | 285 |
| 521 | 3300025922 | Ga0207646_10537759 | Ga0207646_105377591 | 285 |
| 522 | 3300025923 | Ga0207681_10114175 | Ga0207681_101141752 | 285 |
| 523 | 3300025925 | Ga0207650_10190803 | Ga0207650_101908032 | 285 |
| 524 | 3300025926 | Ga0207659_10067240 | Ga0207659_100672402 | 285 |
| 525 | 3300025932 | Ga0207690_10003859 | Ga0207690_100038596 | 285 |
| 526 | 3300025933 | Ga0207706_10025376 | Ga0207706_100253764 | 285 |
| 527 | 3300025933 | Ga0207706_10241974 | Ga0207706_102419742 | 285 |
| 528 | 3300025933 | Ga0207706_10292616 | Ga0207706_102926162 | 285 |
| 529 | 3300025934 | Ga0207686_10135074 | Ga0207686_101350741 | 285 |
| 530 | 3300025934 | Ga0207686_10416783 | Ga0207686_104167831 | 285 |
| 531 | 3300025935 | Ga0207709_10190469 | Ga0207709_101904692 | 285 |
| 532 | 3300025936 | Ga0207670_10014375 | Ga0207670_100143753 | 285 |
| 533 | 3300025938 | Ga0207704_10211568 | Ga0207704_102115681 | 285 |
| 534 | 3300025938 | Ga0207704_10325938 | Ga0207704_103259382 | 285 |
| 535 | 3300025939 | Ga0207665_10005945 | Ga0207665_100059452 | 285 |
| 536 | 3300025941 | Ga0207711_10113617 | Ga0207711_101136174 | 285 |
| 537 | 3300025942 | Ga0207689_10014499 | Ga0207689_100144996 | 285 |
| 538 | 3300025942 | Ga0207689_10048500 | Ga0207689_100485004 | 285 |
| 539 | 3300025945 | Ga0207679_10002955 | Ga0207679_100029558 | 285 |
| 540 | 3300025949 | Ga0207667_10000497 | Ga0207667_1000049742 | 285 |
| 541 | 3300025960 | Ga0207651_10198673 | Ga0207651_101986732 | 285 |
| 542 | 3300025981 | Ga0207640_10002010 | Ga0207640_100020103 | 285 |
| 543 | 3300026023 | Ga0207677_10011748 | Ga0207677_100117484 | 285 |
| 544 | 3300026035 | Ga0207703_10027472 | Ga0207703_100274724 | 285 |
| 545 | 3300026041 | Ga0207639_10006390 | Ga0207639_100063907 | 285 |
| 546 | 3300026067 | Ga0207678_10003731 | Ga0207678_1000373114 | 285 |
| 547 | 3300026078 | Ga0207702_10019642 | Ga0207702_100196424 | 285 |
| 548 | 3300026089 | Ga0207648_10247511 | Ga0207648_102475112 | 285 |
| 549 | 3300026095 | Ga0207676_10025356 | Ga0207676_100253562 | 285 |
| 550 | 3300026095 | Ga0207676_10113162 | Ga0207676_101131623 | 285 |
| 551 | 3300026116 | Ga0207674_10000550 | Ga0207674_1000055025 | 285 |
| 552 | 3300026116 | Ga0207674_10017719 | Ga0207674_100177199 | 285 |
| 553 | 3300026118 | Ga0207675_100013273 | Ga0207675_1000132736 | 285 |
| 554 | 3300026118 | Ga0207675_100634738 | Ga0207675_1006347381 | 285 |
| 555 | 3300027360 | Ga0209969_1012783 | Ga0209969_10127832 | 285 |
| 556 | 3300027364 | Ga0209967_1019203 | Ga0209967_10192031 | 285 |
| 557 | 3300027378 | Ga0209981_1003252 | Ga0209981_10032523 | 285 |
| 558 | 3300027424 | Ga0209984_1004176 | Ga0209984_10041762 | 285 |
| 559 | 3300027424 | Ga0209984_1010539 | Ga0209984_10105391 | 285 |
| 560 | 3300027462 | Ga0210000_1007514 | Ga0210000_10075142 | 285 |
| 561 | 3300027526 | Ga0209968_1000952 | Ga0209968_10009524 | 285 |
| 562 | 3300027543 | Ga0209999_1006579 | Ga0209999_10065791 | 285 |
| 563 | 3300027552 | Ga0209982_1010152 | Ga0209982_10101522 | 285 |
| 564 | 3300027614 | Ga0209970_1006809 | Ga0209970_10068092 | 285 |
| 565 | 3300027617 | Ga0210002_1001446 | Ga0210002_10014463 | 285 |
| 566 | 3300027617 | Ga0210002_1021014 | Ga0210002_10210141 | 285 |
| 567 | 3300027665 | Ga0209983_1005789 | Ga0209983_10057892 | 285 |
| 568 | 3300027665 | Ga0209983_1006509 | Ga0209983_10065092 | 285 |
| 569 | 3300027671 | Ga0209588_1021428 | Ga0209588_10214282 | 285 |
| 570 | 3300027682 | Ga0209971_1000028 | Ga0209971_100002831 | 285 |
| 571 | 3300027682 | Ga0209971_1011248 | Ga0209971_10112483 | 285 |
| 572 | 3300027682 | Ga0209971_1048046 | Ga0209971_10480462 | 285 |
| 573 | 3300027695 | Ga0209966_1000073 | Ga0209966_100007323 | 285 |
| 574 | 3300027717 | Ga0209998_10000001 | Ga0209998_10000001171 | 285 |
| 575 | 3300027717 | Ga0209998_10003754 | Ga0209998_100037541 | 285 |
| 576 | 3300027876 | Ga0209974_10005514 | Ga0209974_100055144 | 285 |
| 577 | 3300027876 | Ga0209974_10007787 | Ga0209974_100077874 | 285 |
| 578 | 3300027907 | Ga0207428_10000394 | Ga0207428_1000039422 | 285 |
| 579 | 3300027907 | Ga0207428_10019791 | Ga0207428_100197914 | 285 |
| 580 | 3300027907 | Ga0207428_10227041 | Ga0207428_102270412 | 285 |
| 581 | 3300028380 | Ga0268265_10019548 | Ga0268265_100195484 | 285 |
| 582 | 3300028380 | Ga0268265_10522212 | Ga0268265_105222122 | 285 |
| 583 | 3300028381 | Ga0268264_10101537 | Ga0268264_101015373 | 285 |
| 584 | 3300028381 | Ga0268264_10304018 | Ga0268264_103040182 | 285 |
| 585 | 3300031852 | Ga0307410_10215490 | Ga0307410_102154902 | 285 |
| 586 | 3300032004 | Ga0307414_10047790 | Ga0307414_100477902 | 285 |
| 587 | 3300035170 | Ga0373943_0247174 | Ga0373943_0247174_49_909 | 285 |
| 588 | 3300035692 | Ga0373935_0065352 | Ga0373935_0065352_1076_1936 | 285 |
| 589 | 3300035725 | Ga0373947_0039950 | Ga0373947_0039950_1841_2701 | 285 |
| 590 | 3300038996 | Ga0242420_025256 | Ga0242420_025256_22_888 | 285 |
| 591 | 3300042008 | Ga0439450_001193 | Ga0439450_001193_2745_3608 | 285 |
| 592 | 3300042436 | Ga0439435_0045685 | Ga0439435_0045685_56_931 | 285 |
| 593 | 3300042439 | Ga0439464_0003489 | Ga0439464_0003489_1868_2731 | 285 |
| 594 | 3300042461 | Ga0439460_0000212 | Ga0439460_0000212_2256_3119 | 285 |
| 595 | 3300042876 | Ga0451577_0003828 | Ga0451577_0003828_3538_4404 | 285 |
| 596 | 3300042876 | Ga0451577_0288279 | Ga0451577_0288279_240_1100 | 285 |
| 597 | 3300042876 | Ga0451577_0380143 | Ga0451577_0380143_289_1152 | 285 |
| 598 | 3300042876 | Ga0451577_0564659 | Ga0451577_0564659_157_1014 | 285 |
| 599 | 3300044673 | Ga0453683_0015559 | Ga0453683_0015559_64_930 | 285 |
| 600 | 3300044673 | Ga0453683_0034845 | Ga0453683_0034845_1821_2693 | 285 |
| 601 | 3300044673 | Ga0453683_0086734 | Ga0453683_0086734_993_1865 | 285 |
| 602 | 3300044673 | Ga0453683_0089063 | Ga0453683_0089063_138_1001 | 285 |
| 603 | 3300044712 | Ga0453684_0067501 | Ga0453684_0067501_3613_4479 | 285 |
| 604 | 3300045051 | Ga0451576_0055701 | Ga0451576_0055701_2330_3196 | 285 |
| 605 | 3300045051 | Ga0451576_0465121 | Ga0451576_0465121_319_1179 | 285 |
| 606 | 3300046473 | Ga0495582_0129083 | Ga0495582_0129083_48_908 | 285 |
| 607 | 3300046664 | Ga0495659_0036045 | Ga0495659_0036045_178_1038 | 285 |
| 608 | 3300049568 | Ga0501031_0029564 | Ga0501031_0029564_1418_2278 | 285 |
| 609 | 3300049569 | Ga0501032_0051456 | Ga0501032_0051456_260_1120 | 285 |
| 610 | 3300049571 | Ga0501034_0109543 | Ga0501034_0109543_1166_2026 | 285 |
| 611 | 3300049572 | Ga0501036_0042144 | Ga0501036_0042144_1082_1942 | 285 |
| 612 | 3300049573 | Ga0501037_0025709 | Ga0501037_0025709_958_1818 | 285 |
| 613 | 3300049574 | Ga0501038_0047038 | Ga0501038_0047038_2404_3264 | 285 |
| 614 | 3300049575 | Ga0501039_0241058 | Ga0501039_0241058_347_1207 | 285 |
| 615 | 3300049576 | Ga0501040_0011029 | Ga0501040_0011029_999_1862 | 285 |
| 616 | 3300049576 | Ga0501040_0015343 | Ga0501040_0015343_221_1081 | 285 |
| 617 | 3300049577 | Ga0501041_0024648 | Ga0501041_0024648_2404_3264 | 285 |
| 618 | 3300049577 | Ga0501041_0140100 | Ga0501041_0140100_258_1115 | 285 |
| 619 | 3300049578 | Ga0501042_0013216 | Ga0501042_0013216_143_1006 | 285 |
| 620 | 3300049578 | Ga0501042_0176423 | Ga0501042_0176423_467_1327 | 285 |
| 621 | 3300049579 | Ga0501043_0012354 | Ga0501043_0012354_5518_6378 | 285 |
| 622 | 3300049579 | Ga0501043_0063974 | Ga0501043_0063974_590_1453 | 285 |
| 623 | 3300049580 | Ga0501046_0009321 | Ga0501046_0009321_2329_3192 | 285 |
| 624 | 3300049580 | Ga0501046_0182445 | Ga0501046_0182445_81_944 | 285 |
| 625 | 3300049582 | Ga0501048_0019522 | Ga0501048_0019522_1942_2805 | 285 |
| 626 | 3300049582 | Ga0501048_0073577 | Ga0501048_0073577_1209_2069 | 285 |
| 627 | 3300049582 | Ga0501048_0113089 | Ga0501048_0113089_565_1422 | 285 |
| 628 | 3300049584 | Ga0501068_0029907 | Ga0501068_0029907_1585_2445 | 285 |
| 629 | 3300049585 | Ga0501069_0010011 | Ga0501069_0010011_1103_1963 | 285 |
| 630 | 3300049585 | Ga0501069_0173936 | Ga0501069_0173936_19_882 | 285 |
| 631 | 3300049586 | Ga0501070_0018760 | Ga0501070_0018760_3983_4843 | 285 |
| 632 | 3300049587 | Ga0501071_0292592 | Ga0501071_0292592_185_1045 | 285 |
| 633 | 3300049588 | Ga0501072_0039234 | Ga0501072_0039234_1568_2428 | 285 |
| 634 | 3300049589 | Ga0501073_0021533 | Ga0501073_0021533_3152_4012 | 285 |
| 635 | 3300049591 | Ga0501075_0059906 | Ga0501075_0059906_845_1705 | 285 |
| 636 | 3300049592 | Ga0501076_0006409 | Ga0501076_0006409_5675_6532 | 285 |
| 637 | 3300049592 | Ga0501076_0091193 | Ga0501076_0091193_1548_2408 | 285 |
| 638 | 3300049593 | Ga0501077_0014420 | Ga0501077_0014420_3797_4660 | 285 |
| 639 | 3300049593 | Ga0501077_0074150 | Ga0501077_0074150_1081_1941 | 285 |
| 640 | 3300049741 | Ga0501079_0001408 | Ga0501079_0001408_3906_4769 | 285 |
| 641 | 3300049741 | Ga0501079_0006617 | Ga0501079_0006617_7281_8141 | 285 |
| 642 | 3300049742 | Ga0501080_0025806 | Ga0501080_0025806_921_1781 | 285 |
| 643 | 3300049742 | Ga0501080_0201548 | Ga0501080_0201548_566_1423 | 285 |
| 644 | 3300049744 | Ga0501083_0008605 | Ga0501083_0008605_1165_2028 | 285 |
| 645 | 3300049744 | Ga0501083_0126326 | Ga0501083_0126326_343_1203 | 285 |
| 646 | 3300049822 | Ga0501035_0103790 | Ga0501035_0103790_343_1203 | 285 |
| 647 | 3300049823 | Ga0501044_0035034 | Ga0501044_0035034_4157_5017 | 285 |
| 648 | 3300049824 | Ga0501045_0000164 | Ga0501045_0000164_12513_13376 | 285 |
| 649 | 3300049824 | Ga0501045_0020558 | Ga0501045_0020558_3048_3908 | 285 |
| 650 | 3300050507 | nmdc:mga05p37_11017_c1 | nmdc:mga05p37_11017_c1_4662_5519 | 285 |
| 651 | 3300050507 | nmdc:mga05p37_17070_c2 | nmdc:mga05p37_17070_c2_6636_7493 | 285 |
| 652 | 3300050507 | nmdc:mga05p37_219222_c1 | nmdc:mga05p37_219222_c1_325_1182 | 285 |
| 653 | 3300050507 | nmdc:mga05p37_326315_c1 | nmdc:mga05p37_326315_c1_69_929 | 285 |
| 654 | 3300050507 | nmdc:mga05p37_605849_c1 | nmdc:mga05p37_605849_c1_296_1168 | 285 |
| 655 | 3300050509 | nmdc:mga0qj67_138062_c1 | nmdc:mga0qj67_138062_c1_231_1097 | 285 |
| 656 | 3300050509 | nmdc:mga0qj67_148937_c1 | nmdc:mga0qj67_148937_c1_257_1123 | 285 |
| 657 | 3300050509 | nmdc:mga0qj67_23322_c1 | nmdc:mga0qj67_23322_c1_2648_3508 | 285 |
| 658 | 3300050510 | nmdc:mga06r32_17445_c1 | nmdc:mga06r32_17445_c1_858_1715 | 285 |
| 659 | 3300050510 | nmdc:mga06r32_185874_c1 | nmdc:mga06r32_185874_c1_125_991 | 285 |
| 660 | 3300050511 | nmdc:mga08y16_1417_c1 | nmdc:mga08y16_1417_c1_18934_19800 | 285 |
| 661 | 3300050511 | nmdc:mga08y16_31342_c1 | nmdc:mga08y16_31342_c1_424_1284 | 285 |
| 662 | 3300050511 | nmdc:mga08y16_79351_c1 | nmdc:mga08y16_79351_c1_2324_3190 | 285 |
| 663 | 3300050512 | nmdc:mga0n895_304925_c1 | nmdc:mga0n895_304925_c1_131_1003 | 285 |
| 664 | 3300050512 | nmdc:mga0n895_67200_c1 | nmdc:mga0n895_67200_c1_681_1544 | 285 |
| 665 | 3300050512 | nmdc:mga0n895_75392_c1 | nmdc:mga0n895_75392_c1_953_1819 | 285 |
| 666 | 3300050513 | nmdc:mga0rr50_107970_c1 | nmdc:mga0rr50_107970_c1_448_1320 | 285 |
| 667 | 3300050513 | nmdc:mga0rr50_252504_c1 | nmdc:mga0rr50_252504_c1_441_1298 | 285 |
| 668 | 3300050514 | nmdc:mga08x19_11443_c1 | nmdc:mga08x19_11443_c1_3824_4684 | 285 |
| 669 | 3300050515 | nmdc:mga0a205_19436_c1 | nmdc:mga0a205_19436_c1_417_1274 | 285 |
| 670 | 3300050515 | nmdc:mga0a205_2042_c1 | nmdc:mga0a205_2042_c1_6002_6868 | 285 |
| 671 | 3300050515 | nmdc:mga0a205_27043_c1 | nmdc:mga0a205_27043_c1_1505_2371 | 285 |
| 672 | 3300050515 | nmdc:mga0a205_99550_c1 | nmdc:mga0a205_99550_c1_138_1010 | 285 |
| 673 | 3300054114 | Ga0501084_0000300 | Ga0501084_0000300_20893_21756 | 285 |
| 674 | 3300054114 | Ga0501084_0024289 | Ga0501084_0024289_3848_4708 | 285 |
| 675 | 3300059423 | Ga0590074_010587 | Ga0590074_010587_123_983 | 285 |
| 676 | 3300059424 | Ga0590075_025830 | Ga0590075_025830_506_1396 | 285 |
| 677 | 3300059426 | Ga0590077_008904 | Ga0590077_008904_1109_1969 | 285 |
| 678 | 3300060353 | Ga0501082_0100806 | Ga0501082_0100806_474_1334 | 285 |
| 679 | 3300060353 | Ga0501082_0269251 | Ga0501082_0269251_522_1385 | 285 |
| 680 | 3300061734 | Ga0530510_0025591 | Ga0530510_0025591_2439_3296 | 285 |
| 681 | 3300061734 | Ga0530510_0158887 | Ga0530510_0158887_291_1154 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ovo-assembly1.cif.gz_B | x-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate | 0.9477 | 24 | 260 |
| 8ovp-assembly1.cif.gz_A | x-ray structure of the iaspsnfr in complex with l-aspartate | 0.9466 | 24 | 260 |
| 8ovp-assembly1.cif.gz_B | x-ray structure of the iaspsnfr in complex with l-aspartate | 0.9432 | 23 | 260 |
| 5eyf-assembly1.cif.gz_A | crystal structure of solute-binding protein from enterococcus faecium with bound glutamate | 0.9354 | 24 | 263 |
| 4zv2-assembly1.cif.gz_A | an ancestral arginine-binding protein bound to glutamine | 0.9333 | 34 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P96257_184_272_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9453 | 130 | 220 | 3.40.190.10 |
| 5eyfB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9437 | 127 | 225 | 3.40.190.10 |
| af_P30860_108_189_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9278 | 129 | 213 | 3.40.190.10 |
| 2pyyC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9272 | 127 | 219 | 3.40.190.10 |
| 5eyfB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9252 | 127 | 225 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q3JSH9-F1-model_v4 | Solute-binding protein family 3/N-terminal domain-containing protein | 0.9671 | 94 | 270 |
GO:0005576
GO:0006865 GO:0030288 |
| AF-X1QQX8-F1-model_v4 | Solute-binding protein family 3/N-terminal domain-containing protein | 0.9625 | 68 | 285 |
GO:0005576
GO:0006865 GO:0030288 |
| AF-A0A3B8HHM2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9578 | 17 | 285 |
GO:0005576
GO:0006865 GO:0015276 GO:0016020 GO:0030288 |
| AF-A0A7Y6ABS9-F1-model_v4 | Transporter substrate-binding domain-containing protein | 0.9561 | 87 | 257 |
GO:0005576
GO:0006865 GO:0030288 |
| AF-A0A259CJ43-F1-model_v4 | Amino acid ABC transporter substrate-binding protein | 0.9443 | 28 | 278 |
GO:0005576
GO:0006865 GO:0030288 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar