F474824

General Info

Members Datasets Scaffolds Average Seq Length
681 267 681 286

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100306483|Ga0068855_1003064832
Length 303
Sequence MRIASCRTNRGDNPETPVKNYSIAIALFLAVLAGQAGAQQLQGTLKKIADTKTIRLGYLKEGVPFSFADVPGKPIGYSVDICQHIVTGIQRQLGLTQLDVKWVEVNTANRFDRVADGTIDMECGTSTITLARQKQVDFSLMTWVDGGTFLVKPEMPVKLLADLAGKRIAVIEGTTTDKALRDALAQRYINAQIVTVKEHLEGLNAVANGQADAYAGDQTVLIGLALAVGTQIQLQLAEGQFSFEPYGLAMRRNDPDFKLAVNTVLARLYRSAQIMEVYERWFGKFGKPSPSIIAVYMLNGVPE

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
166 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
196 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
197 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
206 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
238 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
239 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
240 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
241 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
250 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
264 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0.29
Rhizoplane 0.88
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1476970 2162886006 Bacteria 1194
2 Ga0055524_1000307 3300003775 Bacteria 46545
3 JGI25405J52794_10003167 3300003911 Bacteria 2867
4 Ga0065712_10000569 3300005290 Bacteria 16026
5 Ga0065712_10068007 3300005290 Bacteria 17374
6 Ga0065715_10000426 3300005293 Bacteria 19372
7 Ga0065715_10009394 3300005293 Bacteria 5401
8 Ga0065715_10114658 3300005293 Bacteria 2443
9 Ga0065707_10003569 3300005295 Bacteria 5455
10 Ga0065707_10010381 3300005295 Bacteria 2938
11 Ga0065707_10013686 3300005295 Bacteria 2076
12 Ga0065707_10033544 3300005295 Bacteria 1578
13 Ga0065707_10098051 3300005295 Bacteria 3117
14 Ga0070658_10202046 3300005327 Unclassified 1677
15 Ga0070676_10006146 3300005328 Bacteria 6413
16 Ga0070690_100001728 3300005330 Bacteria 11534
17 Ga0070690_100007358 3300005330 Bacteria 6303
18 Ga0070690_100195632 3300005330 Bacteria 1404
19 Ga0070670_100000241 3300005331 Bacteria 49604
20 Ga0070670_100011459 3300005331 Bacteria 7584
21 Ga0068869_100012652 3300005334 Bacteria 5582
22 Ga0068869_100050505 3300005334 Bacteria 3014
23 Ga0068869_100087233 3300005334 Bacteria 2341
24 Ga0068869_100310188 3300005334 Bacteria 1277
25 Ga0070666_10023588 3300005335 Bacteria 4005
26 Ga0070680_100001386 3300005336 Bacteria 17512
27 Ga0070680_100017312 3300005336 Bacteria 5679
28 Ga0070680_100022831 3300005336 Bacteria 4984
29 Ga0070680_100055288 3300005336 Bacteria 3243
30 Ga0070680_100160637 3300005336 Bacteria 1888
31 Ga0070682_100000179 3300005337 Bacteria 47429
32 Ga0070682_100027582 3300005337 Bacteria 3409
33 Ga0068868_100029544 3300005338 Bacteria 4198
34 Ga0070660_100009221 3300005339 Bacteria 6932
35 Ga0070660_100136885 3300005339 Bacteria 1962
36 Ga0070689_100015332 3300005340 Bacteria 5586
37 Ga0070689_100041651 3300005340 Bacteria 3525
38 Ga0070691_10002490 3300005341 Bacteria 8194
39 Ga0070691_10003903 3300005341 Bacteria 6747
40 Ga0070687_100029307 3300005343 Bacteria 2679
41 Ga0070687_100071564 3300005343 Bacteria 1864
42 Ga0070687_100154047 3300005343 Bacteria 1352
43 Ga0070661_100001244 3300005344 Bacteria 17902
44 Ga0070661_100064324 3300005344 Bacteria 2695
45 Ga0070692_10004506 3300005345 Bacteria 5826
46 Ga0070692_10005570 3300005345 Bacteria 5386
47 Ga0070692_10037555 3300005345 Bacteria 2463
48 Ga0070668_100167641 3300005347 Bacteria 1786
49 Ga0070669_100062838 3300005353 Bacteria 2731
50 Ga0070669_100067667 3300005353 Bacteria 2635
51 Ga0070675_100015962 3300005354 Bacteria 5950
52 Ga0070675_100047188 3300005354 Bacteria 3529
53 Ga0070675_100405175 3300005354 Bacteria 1217
54 Ga0070671_100123386 3300005355 Bacteria 2180
55 Ga0070671_100155151 3300005355 Bacteria 1934
56 Ga0070674_100171294 3300005356 Bacteria 1655
57 Ga0070674_100171886 3300005356 Bacteria 1653
58 Ga0070673_100009896 3300005364 Bacteria 6424
59 Ga0070673_100150891 3300005364 Bacteria 1968
60 Ga0070688_100200044 3300005365 Bacteria 1397
61 Ga0070659_100000831 3300005366 Bacteria 22519
62 Ga0070659_100070890 3300005366 Bacteria 2770
63 Ga0070659_100103382 3300005366 Bacteria 2294
64 Ga0070667_100009817 3300005367 Bacteria 7934
65 Ga0070701_10014437 3300005438 Bacteria 3622
66 Ga0070701_10025346 3300005438 Bacteria 2879
67 Ga0070701_10028186 3300005438 Bacteria 2759
68 Ga0070701_10111425 3300005438 Bacteria 1529
69 Ga0070711_100053264 3300005439 Bacteria 2788
70 Ga0070705_100001080 3300005440 Bacteria 15131
71 Ga0070705_100034025 3300005440 Bacteria 2845
72 Ga0070705_100205647 3300005440 Bacteria 1353
73 Ga0070700_100014869 3300005441 Bacteria 4399
74 Ga0070700_100093866 3300005441 Bacteria 1964
75 Ga0070700_100188399 3300005441 Bacteria 1441
76 Ga0070694_100000224 3300005444 Bacteria 29764
77 Ga0070694_100003004 3300005444 Bacteria 10035
78 Ga0070694_100008818 3300005444 Bacteria 6178
79 Ga0070694_100017968 3300005444 Bacteria 4479
80 Ga0070694_100018562 3300005444 Bacteria 4415
81 Ga0070694_100023175 3300005444 Bacteria 3989
82 Ga0070694_100038937 3300005444 Bacteria 3161
83 Ga0070708_100028448 3300005445 Bacteria 4809
84 Ga0070708_100457454 3300005445 Bacteria 1204
85 Ga0070663_100050570 3300005455 Bacteria 2957
86 Ga0070663_100096591 3300005455 Bacteria 2198
87 Ga0070678_100046894 3300005456 Bacteria 3102
88 Ga0070678_100061976 3300005456 Bacteria 2759
89 Ga0070678_100219641 3300005456 Bacteria 1579
90 Ga0070662_100015674 3300005457 Bacteria 5082
91 Ga0070681_10019365 3300005458 Bacteria 6811
92 Ga0070681_10026811 3300005458 Bacteria 5793
93 Ga0068867_100007078 3300005459 Bacteria 7926
94 Ga0070706_100221774 3300005467 Bacteria 1765
95 Ga0070706_100340272 3300005467 Bacteria 1399
96 Ga0070706_100384195 3300005467 Bacteria 1307
97 Ga0070707_100011228 3300005468 Bacteria 8347
98 Ga0070707_100018261 3300005468 Bacteria 6599
99 Ga0070707_100025476 3300005468 Bacteria 5611
100 Ga0070707_100164030 3300005468 Bacteria 2165
101 Ga0070707_100233555 3300005468 Bacteria 1790
102 Ga0070698_100028441 3300005471 Bacteria 5806
103 Ga0070698_100366466 3300005471 Bacteria 1373
104 Ga0070698_100571346 3300005471 Bacteria 1070
105 Ga0070698_100693880 3300005471 Unclassified 960
106 Ga0070699_100043701 3300005518 Bacteria 3878
107 Ga0070699_100201344 3300005518 Bacteria 1771
108 Ga0070699_100332078 3300005518 Bacteria 1368
109 Ga0070699_100401869 3300005518 Bacteria 1239
110 Ga0070699_100457426 3300005518 Bacteria 1157
111 Ga0070699_100474058 3300005518 Bacteria 1136
112 Ga0070679_100001386 3300005530 Bacteria 21340
113 Ga0070679_100050772 3300005530 Bacteria 4131
114 Ga0070679_100072710 3300005530 Bacteria 3430
115 Ga0070684_100290083 3300005535 Bacteria 1500
116 Ga0070697_100009161 3300005536 Bacteria 7733
117 Ga0070697_100014184 3300005536 Bacteria 6258
118 Ga0070697_100031141 3300005536 Bacteria 4289
119 Ga0070697_100109797 3300005536 Bacteria 2297
120 Ga0070697_100112358 3300005536 Bacteria 2272
121 Ga0070697_100198555 3300005536 Bacteria 1705
122 Ga0070697_100308162 3300005536 Bacteria 1362
123 Ga0070697_100339168 3300005536 Bacteria 1297
124 Ga0068853_100013726 3300005539 Bacteria 6618
125 Ga0068853_100595176 3300005539 Bacteria 1050
126 Ga0068853_100690159 3300005539 Unclassified 973
127 Ga0068853_100695837 3300005539 Bacteria 969
128 Ga0070672_100055242 3300005543 Bacteria 3110
129 Ga0070686_100028942 3300005544 Bacteria 3364
130 Ga0070686_100069349 3300005544 Bacteria 2303
131 Ga0070695_100007445 3300005545 Bacteria 6489
132 Ga0070695_100017441 3300005545 Bacteria 4353
133 Ga0070695_100033167 3300005545 Bacteria 3230
134 Ga0070695_100065518 3300005545 Bacteria 2366
135 Ga0070695_100158984 3300005545 Bacteria 1584
136 Ga0070696_100001530 3300005546 Bacteria 15168
137 Ga0070696_100044218 3300005546 Bacteria 3083
138 Ga0070696_100069326 3300005546 Bacteria 2477
139 Ga0070696_100079092 3300005546 Bacteria 2326
140 Ga0070693_100003136 3300005547 Bacteria 7676
141 Ga0070693_100116275 3300005547 Bacteria 1653
142 Ga0070665_100602142 3300005548 Unclassified 1112
143 Ga0070704_100001927 3300005549 Bacteria 11464
144 Ga0070704_100184482 3300005549 Bacteria 1672
145 Ga0070704_100618756 3300005549 Unclassified 953
146 Ga0068855_100004335 3300005563 Bacteria 17345
147 Ga0068855_100306483 3300005563 Bacteria 1758
148 Ga0070664_100001253 3300005564 Bacteria 20319
149 Ga0070664_100009717 3300005564 Bacteria 7799
150 Ga0068857_100014057 3300005577 Bacteria 6966
151 Ga0068857_100583951 3300005577 Bacteria 1055
152 Ga0068854_100027889 3300005578 Bacteria 3895
153 Ga0068856_100007569 3300005614 Bacteria 10595
154 Ga0068856_100012019 3300005614 Bacteria 8388
155 Ga0070702_100017997 3300005615 Bacteria 3656
156 Ga0070702_100133252 3300005615 Bacteria 1572
157 Ga0070702_100133666 3300005615 Bacteria 1571
158 Ga0068852_100019708 3300005616 Bacteria 5347
159 Ga0068859_100010607 3300005617 Bacteria 9272
160 Ga0068859_100125629 3300005617 Plasmid 2634
161 Ga0068859_100203666 3300005617 Bacteria 2064
162 Ga0068859_100264747 3300005617 Bacteria 1811
163 Ga0068859_100745944 3300005617 Unclassified 1068
164 Ga0068864_100002599 3300005618 Bacteria 14926
165 Ga0068864_100261819 3300005618 Unclassified 1609
166 Ga0068866_10000828 3300005718 Bacteria 13724
167 Ga0068866_10083410 3300005718 Bacteria 1722
168 Ga0068866_10211184 3300005718 Bacteria 1165
169 Ga0068861_100054063 3300005719 Bacteria 3058
170 Ga0068861_100134543 3300005719 Bacteria 2010
171 Ga0068870_10013306 3300005840 Bacteria 3865
172 Ga0068870_10031139 3300005840 Bacteria 2701
173 Ga0068870_10098751 3300005840 Bacteria 1646
174 Ga0068863_100009792 3300005841 Bacteria 9343
175 Ga0068863_100117421 3300005841 Bacteria 2535
176 Ga0068858_100035026 3300005842 Bacteria 4657
177 Ga0068858_100086733 3300005842 Bacteria 2912
178 Ga0068858_100101985 3300005842 Bacteria 2677
179 Ga0068860_100035984 3300005843 Bacteria 4746
180 Ga0068860_100061678 3300005843 Bacteria 3562
181 Ga0068860_100078383 3300005843 Bacteria 3142
182 Ga0068862_100005264 3300005844 Bacteria 10850
183 Ga0068862_100063481 3300005844 Bacteria 3178
184 Ga0068862_100133152 3300005844 Bacteria 2200
185 Ga0068862_100226026 3300005844 Bacteria 1696
186 Ga0068862_100232690 3300005844 Unclassified 1672
187 Ga0081455_10000592 3300005937 Bacteria 46956
188 Ga0081455_10000729 3300005937 Bacteria 42710
189 Ga0081455_10061577 3300005937 Bacteria 3157
190 Ga0081538_10002311 3300005981 Bacteria 18818
191 Ga0081538_10003654 3300005981 Bacteria 14451
192 Ga0081540_1001918 3300005983 Bacteria 17425
193 Ga0075432_10017183 3300006058 Bacteria 2469
194 Ga0070715_10074406 3300006163 Bacteria 1526
195 Ga0070716_100009838 3300006173 Bacteria 4778
196 Ga0070712_100153368 3300006175 Bacteria 1771
197 Ga0070712_100282856 3300006175 Bacteria 1336
198 Ga0097621_100043957 3300006237 Bacteria 3603
199 Ga0097621_100241944 3300006237 Bacteria 1578
200 Ga0068871_100087053 3300006358 Bacteria 2596
201 Ga0068871_100090839 3300006358 Bacteria 2544
202 Ga0075430_100113233 3300006846 Bacteria 2261
203 Ga0075430_100141085 3300006846 Bacteria 2007
204 Ga0075430_100162306 3300006846 Bacteria 1860
205 Ga0075430_100243360 3300006846 Bacteria 1491
206 Ga0075431_100000693 3300006847 Bacteria 28995
207 Ga0075431_100013006 3300006847 Bacteria 8405
208 Ga0075431_100029643 3300006847 Bacteria 5635
209 Ga0075431_100145348 3300006847 Bacteria 2444
210 Ga0075431_100197388 3300006847 Bacteria 2060
211 Ga0075431_100309626 3300006847 Bacteria 1594
212 Ga0075433_10002692 3300006852 Bacteria 13566
213 Ga0075433_10005196 3300006852 Bacteria 10198
214 Ga0075433_10038361 3300006852 Bacteria 4137
215 Ga0075433_10048994 3300006852 Bacteria 3675
216 Ga0075433_10052962 3300006852 Bacteria 3537
217 Ga0075433_10099875 3300006852 Bacteria 2569
218 Ga0075433_10132243 3300006852 Bacteria 2217
219 Ga0075433_10156533 3300006852 Bacteria 2027
220 Ga0075433_10336838 3300006852 Bacteria 1333
221 Ga0075434_100000912 3300006871 Bacteria 23726
222 Ga0075434_100003395 3300006871 Bacteria 14264
223 Ga0075434_100007287 3300006871 Bacteria 10234
224 Ga0075434_100043308 3300006871 Bacteria 4464
225 Ga0075434_100050614 3300006871 Bacteria 4127
226 Ga0075434_100051353 3300006871 Bacteria 4098
227 Ga0075434_100053087 3300006871 Bacteria 4028
228 Ga0075434_100090497 3300006871 Bacteria 3061
229 Ga0075434_100379040 3300006871 Unclassified 1435
230 Ga0075434_100664921 3300006871 Bacteria 1060
231 Ga0075429_100268518 3300006880 Bacteria 1494
232 Ga0075429_100594286 3300006880 Unclassified 970
233 Ga0068865_100001220 3300006881 Bacteria 14953
234 Ga0068865_100072944 3300006881 Bacteria 2440
235 Ga0068865_100086951 3300006881 Bacteria 2258
236 Ga0068865_100430228 3300006881 Bacteria 1087
237 Ga0075436_100013488 3300006914 Bacteria 5595
238 Ga0075436_100066888 3300006914 Bacteria 2484
239 Ga0075436_100078664 3300006914 Bacteria 2284
240 Ga0075436_100144203 3300006914 Bacteria 1674
241 Ga0097620_100010607 3300006931 Bacteria 9272
242 Ga0097620_100125627 3300006931 Plasmid 2634
243 Ga0097620_100203657 3300006931 Bacteria 2064
244 Ga0097620_100264735 3300006931 Bacteria 1811
245 Ga0097620_100745912 3300006931 Unclassified 1068
246 Ga0079104_1000009 3300006946 Bacteria 367015
247 Ga0075435_100005380 3300007076 Bacteria 8929
248 Ga0075435_100017406 3300007076 Bacteria 5441
249 Ga0075435_100089479 3300007076 Bacteria 2538
250 Ga0075435_100096467 3300007076 Bacteria 2446
251 Ga0075435_100131920 3300007076 Bacteria 2091
252 Ga0075435_100376734 3300007076 Bacteria 1219
253 Ga0099794_10046632 3300007265 Bacteria 2076
254 Ga0099794_10057056 3300007265 Bacteria 1891
255 Ga0111539_10000535 3300009094 Bacteria 48283
256 Ga0111539_10156466 3300009094 Bacteria 2667
257 Ga0111539_10168183 3300009094 Bacteria 2562
258 Ga0111539_10172094 3300009094 Bacteria 2530
259 Ga0111539_10192855 3300009094 Bacteria 2377
260 Ga0111539_10254829 3300009094 Bacteria 2043
261 Ga0111539_10287538 3300009094 Bacteria 1913
262 Ga0111539_10704697 3300009094 Unclassified 1175
263 Ga0105245_10012460 3300009098 Bacteria 7399
264 Ga0105245_10028254 3300009098 Bacteria 4945
265 Ga0105245_10065664 3300009098 Bacteria 3282
266 Ga0114129_10010794 3300009147 Bacteria 13013
267 Ga0114129_10013685 3300009147 Bacteria 11559
268 Ga0114129_10022306 3300009147 Bacteria 8989
269 Ga0114129_10046422 3300009147 Bacteria 6104
270 Ga0114129_10090914 3300009147 Bacteria 4230
271 Ga0114129_10117245 3300009147 Bacteria 3669
272 Ga0114129_10121943 3300009147 Bacteria 3587
273 Ga0114129_10188584 3300009147 Bacteria 2801
274 Ga0114129_10423867 3300009147 Bacteria 1750
275 Ga0114129_10459872 3300009147 Bacteria 1668
276 Ga0114129_10631420 3300009147 Bacteria 1384
277 Ga0114129_10957149 3300009147 Unclassified 1081
278 Ga0105243_10035210 3300009148 Bacteria 3881
279 Ga0105243_10101342 3300009148 Bacteria 2391
280 Ga0105243_10116181 3300009148 Bacteria 2247
281 Ga0105243_10293324 3300009148 Bacteria 1470
282 Ga0105241_10009789 3300009174 Bacteria 7044
283 Ga0105241_10084670 3300009174 Bacteria 2490
284 Ga0105242_10052063 3300009176 Bacteria 3339
285 Ga0105242_10087728 3300009176 Bacteria 2612
286 Ga0105242_10260422 3300009176 Bacteria 1566
287 Ga0105242_10551050 3300009176 Unclassified 1105
288 Ga0105242_10810151 3300009176 Bacteria 928
289 Ga0105237_10039387 3300009545 Bacteria 4771
290 Ga0105238_10105126 3300009551 Bacteria 2805
291 Ga0105249_10061062 3300009553 Bacteria 3459
292 Ga0105249_10065210 3300009553 Bacteria 3350
293 Ga0105249_10106076 3300009553 Bacteria 2650
294 Ga0105249_10871406 3300009553 Bacteria 967
295 Ga0099796_10043333 3300010159 Bacteria 1532
296 Ga0105239_10017697 3300010375 Bacteria 7885
297 Ga0105239_10052692 3300010375 Bacteria 4462
298 Ga0105239_10072593 3300010375 Unclassified 3784
299 Ga0157373_10000388 3300013100 Bacteria 35150
300 Ga0157373_10092948 3300013100 Bacteria 2124
301 Ga0157371_10211777 3300013102 Bacteria 1391
302 Ga0157378_10004523 3300013297 Bacteria 12201
303 Ga0157378_10016364 3300013297 Bacteria 6493
304 Ga0157378_10314440 3300013297 Bacteria 1520
305 Ga0157378_10548293 3300013297 Unclassified 1161
306 Ga0163162_10017943 3300013306 Bacteria 6925
307 Ga0163162_10123958 3300013306 Bacteria 2689
308 Ga0163162_10140706 3300013306 Bacteria 2526
309 Ga0163162_10174875 3300013306 Bacteria 2272
310 Ga0163162_10253513 3300013306 Bacteria 1891
311 Ga0163162_10574437 3300013306 Bacteria 1255
312 Ga0163162_10732775 3300013306 Bacteria 1109
313 Ga0157372_10000105 3300013307 Bacteria 88007
314 Ga0157372_10032766 3300013307 Bacteria 5701
315 Ga0157372_10483572 3300013307 Bacteria 1443
316 Ga0157375_10219956 3300013308 Bacteria 2057
317 Ga0157375_10254687 3300013308 Bacteria 1917
318 Ga0163163_10362778 3300014325 Bacteria 1505
319 Ga0157380_10165439 3300014326 Bacteria 1927
320 Ga0157380_10788747 3300014326 Unclassified 966
321 Ga0157377_10076649 3300014745 Bacteria 1945
322 Ga0157377_10167380 3300014745 Bacteria 1372
323 Ga0157376_10010980 3300014969 Bacteria 6654
324 Ga0163161_10261952 3300017792 Bacteria 1350
325 Ga0209050_1012401 3300025298 Bacteria 3913
326 Ga0209256_1000019 3300025299 Bacteria 558627
327 Ga0207653_10011816 3300025885 Bacteria 2724
328 Ga0207688_10014828 3300025901 Bacteria 4229
329 Ga0207680_10316701 3300025903 Bacteria 1090
330 Ga0207685_10046379 3300025905 Bacteria 1654
331 Ga0207645_10009598 3300025907 Bacteria 6686
332 Ga0207645_10020234 3300025907 Bacteria 4359
333 Ga0207643_10000329 3300025908 Bacteria 32532
334 Ga0207643_10019631 3300025908 Bacteria 3705
335 Ga0207684_10012875 3300025910 Bacteria 7244
336 Ga0207684_10046001 3300025910 Bacteria 3702
337 Ga0207684_10085096 3300025910 Bacteria 2693
338 Ga0207684_10314733 3300025910 Bacteria 1349
339 Ga0207654_10014749 3300025911 Bacteria 4042
340 Ga0207707_10000352 3300025912 Bacteria 48248
341 Ga0207707_10009306 3300025912 Bacteria 8519
342 Ga0207707_10032009 3300025912 Bacteria 4604
343 Ga0207671_10068612 3300025914 Bacteria 2642
344 Ga0207693_10066011 3300025915 Bacteria 2833
345 Ga0207693_10154107 3300025915 Bacteria 1808
346 Ga0207663_10067419 3300025916 Bacteria 2295
347 Ga0207663_10078825 3300025916 Bacteria 2149
348 Ga0207660_10000700 3300025917 Bacteria 22339
349 Ga0207660_10009728 3300025917 Bacteria 6223
350 Ga0207660_10025398 3300025917 Bacteria 4020
351 Ga0207660_10053857 3300025917 Bacteria 2869
352 Ga0207662_10014316 3300025918 Bacteria 4449
353 Ga0207662_10072826 3300025918 Bacteria 2083
354 Ga0207662_10287351 3300025918 Bacteria 1090
355 Ga0207657_10002201 3300025919 Bacteria 21128
356 Ga0207657_10002264 3300025919 Bacteria 20869
357 Ga0207649_10006672 3300025920 Bacteria 6273
358 Ga0207652_10002500 3300025921 Bacteria 15472
359 Ga0207652_10118130 3300025921 Unclassified 2356
360 Ga0207646_10000250 3300025922 Bacteria 73162
361 Ga0207646_10020607 3300025922 Bacteria 6107
362 Ga0207646_10022079 3300025922 Bacteria 5870
363 Ga0207646_10044313 3300025922 Bacteria 3993
364 Ga0207646_10177068 3300025922 Unclassified 1926
365 Ga0207646_10537759 3300025922 Bacteria 1051
366 Ga0207681_10042038 3300025923 Bacteria 3050
367 Ga0207681_10114175 3300025923 Bacteria 1970
368 Ga0207650_10001805 3300025925 Bacteria 15135
369 Ga0207650_10190803 3300025925 Bacteria 1637
370 Ga0207659_10067240 3300025926 Bacteria 2603
371 Ga0207687_10134337 3300025927 Bacteria 1869
372 Ga0207687_10169088 3300025927 Bacteria 1684
373 Ga0207687_10241313 3300025927 Bacteria 1432
374 Ga0207690_10003859 3300025932 Bacteria 8859
375 Ga0207690_10012404 3300025932 Bacteria 5096
376 Ga0207706_10002107 3300025933 Bacteria 19464
377 Ga0207706_10025376 3300025933 Bacteria 5310
378 Ga0207706_10241974 3300025933 Bacteria 1577
379 Ga0207706_10292616 3300025933 Bacteria 1420
380 Ga0207686_10000342 3300025934 Bacteria 33514
381 Ga0207686_10135074 3300025934 Bacteria 1697
382 Ga0207686_10416783 3300025934 Unclassified 1026
383 Ga0207709_10004313 3300025935 Bacteria 8238
384 Ga0207709_10190469 3300025935 Bacteria 1456
385 Ga0207670_10014375 3300025936 Bacteria 4698
386 Ga0207670_10041598 3300025936 Bacteria 3023
387 Ga0207704_10211568 3300025938 Bacteria 1428
388 Ga0207704_10325938 3300025938 Bacteria 1187
389 Ga0207665_10005945 3300025939 Bacteria 8118
390 Ga0207691_10008329 3300025940 Bacteria 9957
391 Ga0207691_10433160 3300025940 Bacteria 1120
392 Ga0207711_10113617 3300025941 Bacteria 2411
393 Ga0207689_10002349 3300025942 Bacteria 17681
394 Ga0207689_10014499 3300025942 Bacteria 6705
395 Ga0207689_10048500 3300025942 Bacteria 3503
396 Ga0207689_10056084 3300025942 Bacteria 3242
397 Ga0207689_10098018 3300025942 Bacteria 2408
398 Ga0207689_10242103 3300025942 Bacteria 1491
399 Ga0207679_10002955 3300025945 Bacteria 10537
400 Ga0207679_10016389 3300025945 Bacteria 4921
401 Ga0207667_10000497 3300025949 Bacteria 51927
402 Ga0207667_10376890 3300025949 Bacteria 1446
403 Ga0207651_10198673 3300025960 Bacteria 1605
404 Ga0207668_10233711 3300025972 Bacteria 1484
405 Ga0207640_10002010 3300025981 Bacteria 10985
406 Ga0207640_10045090 3300025981 Bacteria 2829
407 Ga0207677_10011748 3300026023 Bacteria 5004
408 Ga0207703_10027472 3300026035 Bacteria 4482
409 Ga0207703_10040827 3300026035 Bacteria 3715
410 Ga0207703_10472572 3300026035 Bacteria 1174
411 Ga0207639_10006390 3300026041 Bacteria 8004
412 Ga0207639_10557116 3300026041 Bacteria 1053
413 Ga0207678_10003731 3300026067 Bacteria 13700
414 Ga0207678_10006728 3300026067 Bacteria 10191
415 Ga0207708_10013908 3300026075 Bacteria 6015
416 Ga0207708_10027482 3300026075 Bacteria 4308
417 Ga0207708_10055487 3300026075 Bacteria 3021
418 Ga0207702_10019642 3300026078 Bacteria 5593
419 Ga0207702_10082368 3300026078 Bacteria 2797
420 Ga0207648_10001010 3300026089 Bacteria 31690
421 Ga0207648_10247511 3300026089 Bacteria 1589
422 Ga0207676_10025356 3300026095 Bacteria 4399
423 Ga0207676_10113162 3300026095 Bacteria 2275
424 Ga0207676_10218077 3300026095 Unclassified 1697
425 Ga0207674_10000550 3300026116 Bacteria 49205
426 Ga0207674_10017719 3300026116 Bacteria 7762
427 Ga0207675_100000430 3300026118 Bacteria 40671
428 Ga0207675_100013273 3300026118 Bacteria 7691
429 Ga0207675_100170986 3300026118 Bacteria 2077
430 Ga0207675_100244093 3300026118 Bacteria 1736
431 Ga0207675_100634738 3300026118 Bacteria 1073
432 Ga0207683_10001733 3300026121 Bacteria 19431
433 Ga0207683_10072975 3300026121 Bacteria 3036
434 Ga0207683_10127253 3300026121 Bacteria 2290
435 Ga0209281_1000023 3300027111 Bacteria 519955
436 Ga0209969_1012783 3300027360 Bacteria 1212
437 Ga0209967_1019203 3300027364 Bacteria 993
438 Ga0209981_1003252 3300027378 Bacteria 2105
439 Ga0209984_1004176 3300027424 Bacteria 1691
440 Ga0209984_1010539 3300027424 Bacteria 1187
441 Ga0210000_1007514 3300027462 Bacteria 1594
442 Ga0209968_1000952 3300027526 Bacteria 4472
443 Ga0209999_1006579 3300027543 Bacteria 2087
444 Ga0209982_1010152 3300027552 Bacteria 1394
445 Ga0209970_1006809 3300027614 Bacteria 1877
446 Ga0210002_1001446 3300027617 Bacteria 3348
447 Ga0210002_1021014 3300027617 Unclassified 1053
448 Ga0209983_1005789 3300027665 Bacteria 2552
449 Ga0209983_1006509 3300027665 Bacteria 2397
450 Ga0209588_1021428 3300027671 Bacteria 2031
451 Ga0209971_1000028 3300027682 Bacteria 53458
452 Ga0209971_1011248 3300027682 Bacteria 2120
453 Ga0209971_1048046 3300027682 Bacteria 1030
454 Ga0209966_1000073 3300027695 Bacteria 44067
455 Ga0209998_10000001 3300027717 Bacteria 203589
456 Ga0209998_10003754 3300027717 Bacteria 3287
457 Ga0209974_10005514 3300027876 Bacteria 4448
458 Ga0209974_10007787 3300027876 Bacteria 3682
459 Ga0207428_10000394 3300027907 Bacteria 54660
460 Ga0207428_10019791 3300027907 Bacteria 5733
461 Ga0207428_10227041 3300027907 Bacteria 1398
462 Ga0268265_10019548 3300028380 Bacteria 4711
463 Ga0268265_10034377 3300028380 Bacteria 3694
464 Ga0268265_10074481 3300028380 Bacteria 2656
465 Ga0268265_10522212 3300028380 Bacteria 1122
466 Ga0268264_10101537 3300028381 Bacteria 2501
467 Ga0268264_10304018 3300028381 Bacteria 1502
468 Ga0268264_10430533 3300028381 Unclassified 1274
469 Ga0307408_100221434 3300031548 Bacteria 1544
470 Ga0307408_100337599 3300031548 Bacteria 1274
471 Ga0307405_10117364 3300031731 Bacteria 1814
472 Ga0307405_10125823 3300031731 Bacteria 1762
473 Ga0307413_10015212 3300031824 Bacteria 3936
474 Ga0307410_10064110 3300031852 Bacteria 2524
475 Ga0307410_10215490 3300031852 Bacteria 1474
476 Ga0307407_10035366 3300031903 Bacteria 2744
477 Ga0307412_10025051 3300031911 Bacteria 3690
478 Ga0307412_10052185 3300031911 Bacteria 2707
479 Ga0307409_100014522 3300031995 Bacteria 5128
480 Ga0307416_100007444 3300032002 Bacteria 6964
481 Ga0307416_100104526 3300032002 Bacteria 2476
482 Ga0307414_10047790 3300032004 Bacteria 2948
483 Ga0307414_10115699 3300032004 Bacteria 2051
484 Ga0307415_100009625 3300032126 Bacteria 5431
485 Ga0307415_100019016 3300032126 Bacteria 4162
486 Ga0373948_0018968 3300034817 Bacteria 1296
487 Ga0373949_0001601 3300035090 Bacteria 6374
488 Ga0373951_0014834 3300035091 Bacteria 1753
489 Ga0373932_0017901 3300035112 Bacteria 1826
490 Ga0373943_0247174 3300035170 Bacteria 1001
491 Ga0373931_0003309 3300035691 Bacteria 7217
492 Ga0373931_0075511 3300035691 Bacteria 1849
493 Ga0373935_0065352 3300035692 Bacteria 2334
494 Ga0373947_0039950 3300035725 Bacteria 2794
495 Ga0242420_025256 3300038996 Bacteria 1079
496 Ga0439448_0004613 3300042005 Bacteria 3897
497 Ga0439450_001193 3300042008 Bacteria 3732
498 Ga0439435_0045685 3300042436 Bacteria 1239
499 Ga0439464_0003489 3300042439 Bacteria 3970
500 Ga0439460_0000212 3300042461 Bacteria 11551
501 Ga0450893_0020800 3300042532 Bacteria 1130
502 Ga0451577_0003828 3300042876 Bacteria 16376
503 Ga0451577_0032065 3300042876 Bacteria 4734
504 Ga0451577_0288279 3300042876 Bacteria 1488
505 Ga0451577_0380143 3300042876 Bacteria 1281
506 Ga0451577_0564659 3300042876 Unclassified 1033
507 Ga0453683_0015559 3300044673 Bacteria 4924
508 Ga0453683_0034845 3300044673 Bacteria 3173
509 Ga0453683_0067087 3300044673 Unclassified 2243
510 Ga0453683_0086734 3300044673 Bacteria 1961
511 Ga0453683_0089063 3300044673 Bacteria 1934
512 Ga0453684_0020509 3300044712 Bacteria 9962
513 Ga0453684_0028795 3300044712 Bacteria 7910
514 Ga0453684_0067501 3300044712 Bacteria 4547
515 Ga0451576_0007231 3300045051 Bacteria 13371
516 Ga0451576_0055701 3300045051 Bacteria 4135
517 Ga0451576_0063275 3300045051 Bacteria 3856
518 Ga0451576_0075385 3300045051 Bacteria 3510
519 Ga0451576_0098364 3300045051 Bacteria 3043
520 Ga0451576_0465121 3300045051 Bacteria 1328
521 Ga0495580_0093037 3300046472 Bacteria 2098
522 Ga0495582_0129083 3300046473 Bacteria 1428
523 Ga0495584_0164887 3300046491 Bacteria 1126
524 Ga0495659_0036045 3300046664 Bacteria 1746
525 Ga0496106_0197223 3300048909 Bacteria 1602
526 Ga0496111_0378396 3300048914 Bacteria 1047
527 Ga0496112_0069699 3300048915 Bacteria 3473
528 Ga0496112_0099084 3300048915 Bacteria 2884
529 Ga0496112_0235777 3300048915 Bacteria 1783
530 Ga0496114_0019669 3300048917 Bacteria 5472
531 Ga0501031_0029564 3300049568 Bacteria 3574
532 Ga0501031_0034922 3300049568 Bacteria 3281
533 Ga0501032_0051456 3300049569 Bacteria 2777
534 Ga0501033_0093134 3300049570 Bacteria 2203
535 Ga0501034_0109543 3300049571 Bacteria 2753
536 Ga0501036_0021698 3300049572 Bacteria 5398
537 Ga0501036_0042144 3300049572 Bacteria 3864
538 Ga0501037_0015751 3300049573 Bacteria 5564
539 Ga0501037_0025709 3300049573 Bacteria 4348
540 Ga0501038_0002511 3300049574 Bacteria 17093
541 Ga0501038_0047038 3300049574 Bacteria 3738
542 Ga0501039_0001556 3300049575 Bacteria 16876
543 Ga0501039_0241058 3300049575 Bacteria 1421
544 Ga0501040_0003219 3300049576 Bacteria 10561
545 Ga0501040_0011029 3300049576 Bacteria 5908
546 Ga0501040_0015343 3300049576 Bacteria 5066
547 Ga0501040_0017189 3300049576 Bacteria 4801
548 Ga0501040_0129391 3300049576 Bacteria 1774
549 Ga0501041_0000212 3300049577 Bacteria 26965
550 Ga0501041_0024648 3300049577 Bacteria 3610
551 Ga0501041_0140100 3300049577 Bacteria 1508
552 Ga0501041_0195228 3300049577 Bacteria 1268
553 Ga0501042_0000098 3300049578 Bacteria 34576
554 Ga0501042_0013216 3300049578 Bacteria 5620
555 Ga0501042_0176423 3300049578 Bacteria 1541
556 Ga0501043_0010972 3300049579 Bacteria 7098
557 Ga0501043_0012354 3300049579 Bacteria 6677
558 Ga0501043_0063974 3300049579 Bacteria 2889
559 Ga0501046_0009321 3300049580 Bacteria 8493
560 Ga0501046_0015300 3300049580 Bacteria 6451
561 Ga0501046_0182445 3300049580 Bacteria 1569
562 Ga0501048_0004806 3300049582 Bacteria 10296
563 Ga0501048_0019522 3300049582 Bacteria 4972
564 Ga0501048_0073577 3300049582 Bacteria 2411
565 Ga0501048_0113089 3300049582 Bacteria 1918
566 Ga0501068_0029907 3300049584 Bacteria 3229
567 Ga0501069_0010011 3300049585 Bacteria 5012
568 Ga0501069_0060479 3300049585 Bacteria 2115
569 Ga0501069_0173936 3300049585 Bacteria 1243
570 Ga0501070_0017605 3300049586 Bacteria 5999
571 Ga0501070_0018760 3300049586 Bacteria 5803
572 Ga0501071_0000452 3300049587 Bacteria 20662
573 Ga0501071_0292592 3300049587 Bacteria 1233
574 Ga0501071_0310443 3300049587 Bacteria 1197
575 Ga0501072_0039234 3300049588 Bacteria 3718
576 Ga0501072_0061061 3300049588 Bacteria 2972
577 Ga0501072_0241360 3300049588 Bacteria 1439
578 Ga0501073_0021533 3300049589 Bacteria 4647
579 Ga0501074_0004506 3300049590 Bacteria 9974
580 Ga0501075_0000095 3300049591 Bacteria 40804
581 Ga0501075_0004952 3300049591 Bacteria 9082
582 Ga0501075_0036199 3300049591 Bacteria 3684
583 Ga0501075_0059906 3300049591 Bacteria 2868
584 Ga0501076_0000386 3300049592 Bacteria 27579
585 Ga0501076_0006409 3300049592 Bacteria 8534
586 Ga0501076_0091193 3300049592 Bacteria 2451
587 Ga0501076_0217206 3300049592 Bacteria 1563
588 Ga0501077_0000670 3300049593 Bacteria 20698
589 Ga0501077_0010466 3300049593 Bacteria 5774
590 Ga0501077_0014420 3300049593 Bacteria 4967
591 Ga0501077_0047914 3300049593 Bacteria 2715
592 Ga0501077_0074150 3300049593 Bacteria 2155
593 Ga0501077_0089379 3300049593 Bacteria 1952
594 Ga0501079_0001408 3300049741 Bacteria 16936
595 Ga0501079_0001514 3300049741 Bacteria 16455
596 Ga0501079_0002232 3300049741 Bacteria 13970
597 Ga0501079_0006617 3300049741 Bacteria 8720
598 Ga0501080_0025806 3300049742 Bacteria 5458
599 Ga0501080_0027305 3300049742 Bacteria 5308
600 Ga0501080_0201548 3300049742 Bacteria 1827
601 Ga0501080_0264543 3300049742 Bacteria 1566
602 Ga0501081_0000063 3300049743 Bacteria 41530
603 Ga0501081_0011007 3300049743 Bacteria 5914
604 Ga0501081_0224113 3300049743 Bacteria 1368
605 Ga0501083_0007185 3300049744 Bacteria 7908
606 Ga0501083_0008605 3300049744 Bacteria 7201
607 Ga0501083_0069906 3300049744 Bacteria 2336
608 Ga0501083_0126326 3300049744 Bacteria 1676
609 Ga0501035_0056322 3300049822 Bacteria 3508
610 Ga0501035_0103790 3300049822 Bacteria 2493
611 Ga0501044_0035034 3300049823 Bacteria 5259
612 Ga0501045_0000164 3300049824 Bacteria 36415
613 Ga0501045_0000186 3300049824 Bacteria 34725
614 Ga0501045_0020558 3300049824 Bacteria 4717
615 Ga0501045_0136415 3300049824 Bacteria 1824
616 Ga0501045_0139247 3300049824 Bacteria 1805
617 nmdc:mga05p37_11017_c1 3300050507 Bacteria 10739
618 nmdc:mga05p37_153938_c1 3300050507 Bacteria 2811
619 nmdc:mga05p37_17070_c2 3300050507 Bacteria 8069
620 nmdc:mga05p37_219222_c1 3300050507 Bacteria 2296
621 nmdc:mga05p37_326315_c1 3300050507 Bacteria 1815
622 nmdc:mga05p37_605849_c1 3300050507 Bacteria 1235
623 nmdc:mga09592_535751_c1 3300050508 Unclassified 1006
624 nmdc:mga0qj67_135159_c1 3300050509 Unclassified 1998
625 nmdc:mga0qj67_138062_c1 3300050509 Bacteria 1976
626 nmdc:mga0qj67_148937_c1 3300050509 Bacteria 1898
627 nmdc:mga0qj67_180495_c1 3300050509 Bacteria 1714
628 nmdc:mga0qj67_23322_c1 3300050509 Bacteria 4759
629 nmdc:mga0qj67_500283_c1 3300050509 Bacteria 977
630 nmdc:mga06r32_17445_c1 3300050510 Bacteria 6552
631 nmdc:mga06r32_1752_c1 3300050510 Bacteria 19498
632 nmdc:mga06r32_185874_c1 3300050510 Bacteria 2065
633 nmdc:mga06r32_256716_c1 3300050510 Bacteria 1736
634 nmdc:mga06r32_522957_c1 3300050510 Bacteria 1162
635 nmdc:mga06r32_68548_c1 3300050510 Bacteria 3427
636 nmdc:mga08y16_1417_c1 3300050511 Bacteria 24061
637 nmdc:mga08y16_277408_c1 3300050511 Bacteria 1729
638 nmdc:mga08y16_31342_c1 3300050511 Bacteria 5592
639 nmdc:mga08y16_570589_c1 3300050511 Unclassified 1143
640 nmdc:mga08y16_79351_c1 3300050511 Bacteria 3421
641 nmdc:mga08y16_94837_c1 3300050511 Bacteria 3108
642 nmdc:mga0n895_18672_c1 3300050512 Bacteria 6423
643 nmdc:mga0n895_233224_c1 3300050512 Bacteria 1868
644 nmdc:mga0n895_237255_c1 3300050512 Bacteria 1851
645 nmdc:mga0n895_25810_c1 3300050512 Bacteria 5556
646 nmdc:mga0n895_304925_c1 3300050512 Bacteria 1614
647 nmdc:mga0n895_373194_c1 3300050512 Unclassified 1444
648 nmdc:mga0n895_613_c1 3300050512 Bacteria 24760
649 nmdc:mga0n895_67200_c1 3300050512 Bacteria 3550
650 nmdc:mga0n895_75392_c1 3300050512 Bacteria 3353
651 nmdc:mga0rr50_107970_c1 3300050513 Bacteria 2198
652 nmdc:mga0rr50_12707_c1 3300050513 Bacteria 5454
653 nmdc:mga0rr50_252504_c1 3300050513 Unclassified 1465
654 nmdc:mga0rr50_49669_c1 3300050513 Bacteria 3106
655 nmdc:mga0rr50_4993_c1 3300050513 Bacteria 7859
656 nmdc:mga0rr50_94600_c1 3300050513 Bacteria 2334
657 nmdc:mga08x19_114342_c1 3300050514 Bacteria 1803
658 nmdc:mga08x19_11443_c1 3300050514 Bacteria 5339
659 nmdc:mga08x19_14639_c1 3300050514 Bacteria 4762
660 nmdc:mga0a205_17778_c1 3300050515 Bacteria 6671
661 nmdc:mga0a205_19436_c1 3300050515 Bacteria 6404
662 nmdc:mga0a205_2042_c1 3300050515 Bacteria 17633
663 nmdc:mga0a205_27043_c1 3300050515 Bacteria 5477
664 nmdc:mga0a205_2749_c1 3300050515 Bacteria 15533
665 nmdc:mga0a205_99550_c1 3300050515 Bacteria 2805
666 Ga0501084_0000300 3300054114 Bacteria 37454
667 Ga0501084_0000662 3300054114 Bacteria 26273
668 Ga0501084_0003591 3300054114 Bacteria 12591
669 Ga0501084_0024289 3300054114 Bacteria 5054
670 Ga0501084_0125491 3300054114 Bacteria 2160
671 Ga0590074_010587 3300059423 Bacteria 1541
672 Ga0590075_025830 3300059424 Bacteria 1477
673 Ga0590077_008904 3300059426 Bacteria 2055
674 Ga0501082_0000921 3300060353 Bacteria 25918
675 Ga0501082_0100806 3300060353 Bacteria 2497
676 Ga0501082_0109256 3300060353 Bacteria 2394
677 Ga0501082_0269251 3300060353 Bacteria 1482
678 Ga0530510_0007331 3300061734 Bacteria 7676
679 Ga0530510_0025591 3300061734 Bacteria 4221
680 Ga0530510_0158887 3300061734 Bacteria 1671
681 Ga0530510_0166035 3300061734 Bacteria 1634

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100457454 Ga0070708_1004574541 264
2 3300005459 Ga0068867_100007078 Ga0068867_1000070782 264
3 3300005617 Ga0068859_100203666 Ga0068859_1002036662 264
4 3300005981 Ga0081538_10002311 Ga0081538_1000231114 264
5 3300006931 Ga0097620_100203657 Ga0097620_1002036572 264
6 3300049576 Ga0501040_0017189 Ga0501040_0017189_1984_2856 264
7 3300049592 Ga0501076_0217206 Ga0501076_0217206_451_1323 264
8 3300005844 Ga0068862_100226026 Ga0068862_1002260261 266
9 3300013306 Ga0163162_10732775 Ga0163162_107327751 266
10 3300005518 Ga0070699_100043701 Ga0070699_1000437012 272
11 3300009098 Ga0105245_10028254 Ga0105245_100282544 272
12 3300025910 Ga0207684_10085096 Ga0207684_100850961 272
13 3300025922 Ga0207646_10177068 Ga0207646_101770683 272
14 3300050512 nmdc:mga0n895_373194_c1 nmdc:mga0n895_373194_c1_150_968 272
15 3300005334 Ga0068869_100087233 Ga0068869_1000872332 273
16 3300005444 Ga0070694_100023175 Ga0070694_1000231754 273
17 3300005547 Ga0070693_100116275 Ga0070693_1001162751 273
18 3300005843 Ga0068860_100078383 Ga0068860_1000783834 273
19 3300005844 Ga0068862_100063481 Ga0068862_1000634811 273
20 3300007265 Ga0099794_10057056 Ga0099794_100570562 273
21 3300009094 Ga0111539_10168183 Ga0111539_101681833 273
22 3300025927 Ga0207687_10134337 Ga0207687_101343371 273
23 3300025942 Ga0207689_10098018 Ga0207689_100980182 273
24 3300026118 Ga0207675_100244093 Ga0207675_1002440932 273
25 3300028380 Ga0268265_10034377 Ga0268265_100343771 273
26 3300050512 nmdc:mga0n895_233224_c1 nmdc:mga0n895_233224_c1_549_1370 273
27 3300050512 nmdc:mga0n895_613_c1 nmdc:mga0n895_613_c1_18650_19471 273
28 3300050513 nmdc:mga0rr50_12707_c1 nmdc:mga0rr50_12707_c1_25_846 273
29 3300050515 nmdc:mga0a205_17778_c1 nmdc:mga0a205_17778_c1_4617_5438 273
30 3300005468 Ga0070707_100164030 Ga0070707_1001640302 274
31 3300005518 Ga0070699_100474058 Ga0070699_1004740582 274
32 3300005549 Ga0070704_100618756 Ga0070704_1006187561 274
33 3300005617 Ga0068859_100264747 Ga0068859_1002647472 274
34 3300006931 Ga0097620_100264735 Ga0097620_1002647352 274
35 3300025922 Ga0207646_10000250 Ga0207646_1000025058 274
36 3300044712 Ga0453684_0028795 Ga0453684_0028795_5077_5910 275
37 3300005347 Ga0070668_100167641 Ga0070668_1001676412 277
38 3300005456 Ga0070678_100219641 Ga0070678_1002196412 277
39 3300005617 Ga0068859_100745944 Ga0068859_1007459441 277
40 3300005718 Ga0068866_10083410 Ga0068866_100834102 277
41 3300006931 Ga0097620_100745912 Ga0097620_1007459121 277
42 3300009098 Ga0105245_10065664 Ga0105245_100656642 277
43 3300009147 Ga0114129_10090914 Ga0114129_100909142 277
44 3300009148 Ga0105243_10101342 Ga0105243_101013424 277
45 3300025927 Ga0207687_10169088 Ga0207687_101690881 277
46 3300025940 Ga0207691_10433160 Ga0207691_104331601 277
47 3300025972 Ga0207668_10233711 Ga0207668_102337112 277
48 3300026121 Ga0207683_10127253 Ga0207683_101272532 277
49 3300042532 Ga0450893_0020800 Ga0450893_0020800_166_1005 277
50 3300042876 Ga0451577_0032065 Ga0451577_0032065_248_1087 277
51 3300044673 Ga0453683_0067087 Ga0453683_0067087_1364_2203 277
52 3300044712 Ga0453684_0020509 Ga0453684_0020509_7395_8234 277
53 3300046491 Ga0495584_0164887 Ga0495584_0164887_204_1043 277
54 3300049576 Ga0501040_0129391 Ga0501040_0129391_321_1160 277
55 3300049577 Ga0501041_0195228 Ga0501041_0195228_68_907 277
56 3300049591 Ga0501075_0004952 Ga0501075_0004952_585_1424 277
57 3300049591 Ga0501075_0036199 Ga0501075_0036199_1518_2357 277
58 3300049593 Ga0501077_0047914 Ga0501077_0047914_316_1155 277
59 3300049593 Ga0501077_0089379 Ga0501077_0089379_159_998 277
60 3300049741 Ga0501079_0002232 Ga0501079_0002232_5179_6018 277
61 3300049742 Ga0501080_0027305 Ga0501080_0027305_774_1613 277
62 3300049742 Ga0501080_0264543 Ga0501080_0264543_547_1386 277
63 3300049743 Ga0501081_0011007 Ga0501081_0011007_1981_2820 277
64 3300049744 Ga0501083_0069906 Ga0501083_0069906_721_1560 277
65 3300049824 Ga0501045_0136415 Ga0501045_0136415_41_880 277
66 3300049824 Ga0501045_0139247 Ga0501045_0139247_623_1462 277
67 3300050507 nmdc:mga05p37_153938_c1 nmdc:mga05p37_153938_c1_895_1734 277
68 3300050514 nmdc:mga08x19_14639_c1 nmdc:mga08x19_14639_c1_2951_3790 277
69 3300054114 Ga0501084_0003591 Ga0501084_0003591_11150_11989 277
70 3300054114 Ga0501084_0125491 Ga0501084_0125491_661_1500 277
71 3300060353 Ga0501082_0109256 Ga0501082_0109256_955_1794 277
72 3300005334 Ga0068869_100310188 Ga0068869_1003101882 278
73 3300005539 Ga0068853_100695837 Ga0068853_1006958371 278
74 3300005563 Ga0068855_100306483 Ga0068855_1003064832 278
75 3300005617 Ga0068859_100125629 Ga0068859_1001256291 278
76 3300006847 Ga0075431_100197388 Ga0075431_1001973882 278
77 3300006931 Ga0097620_100125627 Ga0097620_1001256271 278
78 3300010375 Ga0105239_10072593 Ga0105239_100725932 278
79 3300025942 Ga0207689_10242103 Ga0207689_102421032 278
80 3300025949 Ga0207667_10376890 Ga0207667_103768902 278
81 3300026035 Ga0207703_10472572 Ga0207703_104725722 278
82 3300050510 nmdc:mga06r32_522957_c1 nmdc:mga06r32_522957_c1_56_916 278
83 3300003775 Ga0055524_1000307 Ga0055524_100030731 279
84 3300005345 Ga0070692_10037555 Ga0070692_100375553 279
85 3300006946 Ga0079104_1000009 Ga0079104_1000009206 279
86 3300025298 Ga0209050_1012401 Ga0209050_10124013 279
87 3300025299 Ga0209256_1000019 Ga0209256_1000019266 279
88 3300026075 Ga0207708_10055487 Ga0207708_100554871 279
89 3300027111 Ga0209281_1000023 Ga0209281_1000023181 279
90 3300048917 Ga0496114_0019669 Ga0496114_0019669_3455_4324 279
91 3300005330 Ga0070690_100007358 Ga0070690_1000073585 280
92 3300005334 Ga0068869_100050505 Ga0068869_1000505054 280
93 3300005340 Ga0070689_100041651 Ga0070689_1000416513 280
94 3300005356 Ga0070674_100171886 Ga0070674_1001718862 280
95 3300005365 Ga0070688_100200044 Ga0070688_1002000442 280
96 3300005438 Ga0070701_10111425 Ga0070701_101114252 280
97 3300005441 Ga0070700_100014869 Ga0070700_1000148694 280
98 3300005444 Ga0070694_100017968 Ga0070694_1000179684 280
99 3300005456 Ga0070678_100046894 Ga0070678_1000468944 280
100 3300005539 Ga0068853_100595176 Ga0068853_1005951762 280
101 3300005544 Ga0070686_100028942 Ga0070686_1000289424 280
102 3300005545 Ga0070695_100158984 Ga0070695_1001589842 280
103 3300005615 Ga0070702_100133252 Ga0070702_1001332522 280
104 3300005718 Ga0068866_10000828 Ga0068866_1000082813 280
105 3300005840 Ga0068870_10098751 Ga0068870_100987513 280
106 3300005842 Ga0068858_100086733 Ga0068858_1000867334 280
107 3300005844 Ga0068862_100133152 Ga0068862_1001331522 280
108 3300006237 Ga0097621_100043957 Ga0097621_1000439575 280
109 3300006358 Ga0068871_100087053 Ga0068871_1000870534 280
110 3300006881 Ga0068865_100001220 Ga0068865_10000122013 280
111 3300009098 Ga0105245_10012460 Ga0105245_100124607 280
112 3300009176 Ga0105242_10052063 Ga0105242_100520634 280
113 3300009553 Ga0105249_10106076 Ga0105249_101060764 280
114 3300013297 Ga0157378_10004523 Ga0157378_100045238 280
115 3300025934 Ga0207686_10000342 Ga0207686_1000034228 280
116 3300025935 Ga0207709_10004313 Ga0207709_100043137 280
117 3300025936 Ga0207670_10041598 Ga0207670_100415983 280
118 3300025942 Ga0207689_10002349 Ga0207689_100023497 280
119 3300026035 Ga0207703_10040827 Ga0207703_100408274 280
120 3300026041 Ga0207639_10557116 Ga0207639_105571162 280
121 3300026075 Ga0207708_10013908 Ga0207708_100139084 280
122 3300026089 Ga0207648_10001010 Ga0207648_1000101014 280
123 3300026118 Ga0207675_100000430 Ga0207675_10000043036 280
124 3300026121 Ga0207683_10072975 Ga0207683_100729754 280
125 3300028380 Ga0268265_10074481 Ga0268265_100744813 280
126 3300007265 Ga0099794_10046632 Ga0099794_100466322 281
127 3300009148 Ga0105243_10116181 Ga0105243_101161812 281
128 3300009553 Ga0105249_10871406 Ga0105249_108714061 281
129 3300010159 Ga0099796_10043333 Ga0099796_100433332 281
130 3300010375 Ga0105239_10052692 Ga0105239_100526926 281
131 3300013100 Ga0157373_10000388 Ga0157373_1000038833 281
132 3300013102 Ga0157371_10211777 Ga0157371_102117772 281
133 3300013297 Ga0157378_10314440 Ga0157378_103144402 281
134 3300013306 Ga0163162_10253513 Ga0163162_102535132 281
135 3300013307 Ga0157372_10000105 Ga0157372_1000010580 281
136 3300013308 Ga0157375_10254687 Ga0157375_102546871 281
137 3300014326 Ga0157380_10165439 Ga0157380_101654392 281
138 3300014745 Ga0157377_10076649 Ga0157377_100766492 281
139 3300034817 Ga0373948_0018968 Ga0373948_0018968_26_877 281
140 3300035090 Ga0373949_0001601 Ga0373949_0001601_4710_5561 281
141 3300035091 Ga0373951_0014834 Ga0373951_0014834_540_1391 281
142 3300035691 Ga0373931_0075511 Ga0373931_0075511_723_1574 281
143 3300042005 Ga0439448_0004613 Ga0439448_0004613_2358_3209 281
144 3300045051 Ga0451576_0007231 Ga0451576_0007231_5765_6616 281
145 3300045051 Ga0451576_0063275 Ga0451576_0063275_2971_3822 281
146 3300045051 Ga0451576_0075385 Ga0451576_0075385_1373_2224 281
147 3300045051 Ga0451576_0098364 Ga0451576_0098364_1153_2004 281
148 3300046472 Ga0495580_0093037 Ga0495580_0093037_1091_1942 281
149 3300048914 Ga0496111_0378396 Ga0496111_0378396_49_900 281
150 3300048915 Ga0496112_0099084 Ga0496112_0099084_1999_2850 281
151 3300049588 Ga0501072_0061061 Ga0501072_0061061_522_1373 281
152 3300050512 nmdc:mga0n895_18672_c1 nmdc:mga0n895_18672_c1_2862_3713 281
153 3300050513 nmdc:mga0rr50_4993_c1 nmdc:mga0rr50_4993_c1_2151_3002 281
154 3300050515 nmdc:mga0a205_2749_c1 nmdc:mga0a205_2749_c1_5531_6382 281
155 3300005354 Ga0070675_100405175 Ga0070675_1004051752 283
156 3300005444 Ga0070694_100000224 Ga0070694_10000022419 283
157 3300005536 Ga0070697_100014184 Ga0070697_1000141842 283
158 3300007076 Ga0075435_100376734 Ga0075435_1003767341 283
159 3300009147 Ga0114129_10117245 Ga0114129_101172453 283
160 3300031548 Ga0307408_100221434 Ga0307408_1002214342 283
161 3300031731 Ga0307405_10125823 Ga0307405_101258231 283
162 3300031824 Ga0307413_10015212 Ga0307413_100152123 283
163 3300031852 Ga0307410_10064110 Ga0307410_100641102 283
164 3300031903 Ga0307407_10035366 Ga0307407_100353663 283
165 3300031911 Ga0307412_10025051 Ga0307412_100250514 283
166 3300031995 Ga0307409_100014522 Ga0307409_1000145224 283
167 3300032002 Ga0307416_100104526 Ga0307416_1001045264 283
168 3300032004 Ga0307414_10115699 Ga0307414_101156992 283
169 3300032126 Ga0307415_100009625 Ga0307415_1000096255 283
170 3300050508 nmdc:mga09592_535751_c1 nmdc:mga09592_535751_c1_14_868 283
171 3300005290 Ga0065712_10000569 Ga0065712_100005698 284
172 3300005290 Ga0065712_10068007 Ga0065712_100680078 284
173 3300005293 Ga0065715_10000426 Ga0065715_100004267 284
174 3300005293 Ga0065715_10009394 Ga0065715_100093943 284
175 3300005295 Ga0065707_10013686 Ga0065707_100136862 284
176 3300005295 Ga0065707_10033544 Ga0065707_100335442 284
177 3300005295 Ga0065707_10098051 Ga0065707_100980514 284
178 3300005327 Ga0070658_10202046 Ga0070658_102020462 284
179 3300005330 Ga0070690_100001728 Ga0070690_1000017288 284
180 3300005331 Ga0070670_100000241 Ga0070670_10000024112 284
181 3300005335 Ga0070666_10023588 Ga0070666_100235883 284
182 3300005336 Ga0070680_100055288 Ga0070680_1000552882 284
183 3300005337 Ga0070682_100027582 Ga0070682_1000275823 284
184 3300005339 Ga0070660_100136885 Ga0070660_1001368852 284
185 3300005341 Ga0070691_10003903 Ga0070691_100039035 284
186 3300005343 Ga0070687_100154047 Ga0070687_1001540472 284
187 3300005344 Ga0070661_100064324 Ga0070661_1000643244 284
188 3300005353 Ga0070669_100062838 Ga0070669_1000628384 284
189 3300005354 Ga0070675_100015962 Ga0070675_1000159624 284
190 3300005355 Ga0070671_100123386 Ga0070671_1001233862 284
191 3300005356 Ga0070674_100171294 Ga0070674_1001712942 284
192 3300005364 Ga0070673_100009896 Ga0070673_1000098963 284
193 3300005366 Ga0070659_100070890 Ga0070659_1000708902 284
194 3300005366 Ga0070659_100103382 Ga0070659_1001033822 284
195 3300005367 Ga0070667_100009817 Ga0070667_1000098175 284
196 3300005439 Ga0070711_100053264 Ga0070711_1000532642 284
197 3300005441 Ga0070700_100093866 Ga0070700_1000938661 284
198 3300005444 Ga0070694_100008818 Ga0070694_1000088186 284
199 3300005455 Ga0070663_100050570 Ga0070663_1000505703 284
200 3300005456 Ga0070678_100061976 Ga0070678_1000619763 284
201 3300005458 Ga0070681_10019365 Ga0070681_100193654 284
202 3300005467 Ga0070706_100221774 Ga0070706_1002217742 284
203 3300005468 Ga0070707_100025476 Ga0070707_1000254764 284
204 3300005471 Ga0070698_100366466 Ga0070698_1003664662 284
205 3300005518 Ga0070699_100401869 Ga0070699_1004018691 284
206 3300005530 Ga0070679_100050772 Ga0070679_1000507725 284
207 3300005536 Ga0070697_100031141 Ga0070697_1000311414 284
208 3300005536 Ga0070697_100109797 Ga0070697_1001097971 284
209 3300005536 Ga0070697_100308162 Ga0070697_1003081621 284
210 3300005539 Ga0068853_100690159 Ga0068853_1006901591 284
211 3300005543 Ga0070672_100055242 Ga0070672_1000552423 284
212 3300005544 Ga0070686_100069349 Ga0070686_1000693493 284
213 3300005545 Ga0070695_100017441 Ga0070695_1000174414 284
214 3300005548 Ga0070665_100602142 Ga0070665_1006021421 284
215 3300005564 Ga0070664_100001253 Ga0070664_10000125312 284
216 3300005577 Ga0068857_100583951 Ga0068857_1005839511 284
217 3300005614 Ga0068856_100012019 Ga0068856_1000120191 284
218 3300005615 Ga0070702_100133666 Ga0070702_1001336661 284
219 3300005618 Ga0068864_100261819 Ga0068864_1002618192 284
220 3300005719 Ga0068861_100134543 Ga0068861_1001345432 284
221 3300005842 Ga0068858_100101985 Ga0068858_1001019853 284
222 3300005937 Ga0081455_10000729 Ga0081455_100007296 284
223 3300005937 Ga0081455_10061577 Ga0081455_100615772 284
224 3300005981 Ga0081538_10003654 Ga0081538_100036543 284
225 3300006058 Ga0075432_10017183 Ga0075432_100171833 284
226 3300006175 Ga0070712_100153368 Ga0070712_1001533682 284
227 3300006846 Ga0075430_100113233 Ga0075430_1001132332 284
228 3300006846 Ga0075430_100162306 Ga0075430_1001623062 284
229 3300006847 Ga0075431_100000693 Ga0075431_10000069314 284
230 3300006847 Ga0075431_100029643 Ga0075431_1000296433 284
231 3300006847 Ga0075431_100309626 Ga0075431_1003096262 284
232 3300006852 Ga0075433_10052962 Ga0075433_100529622 284
233 3300006852 Ga0075433_10132243 Ga0075433_101322432 284
234 3300006852 Ga0075433_10156533 Ga0075433_101565332 284
235 3300006852 Ga0075433_10336838 Ga0075433_103368382 284
236 3300006871 Ga0075434_100000912 Ga0075434_1000009124 284
237 3300006871 Ga0075434_100003395 Ga0075434_10000339510 284
238 3300006871 Ga0075434_100050614 Ga0075434_1000506141 284
239 3300006871 Ga0075434_100053087 Ga0075434_1000530874 284
240 3300006871 Ga0075434_100379040 Ga0075434_1003790402 284
241 3300006871 Ga0075434_100664921 Ga0075434_1006649211 284
242 3300006881 Ga0068865_100072944 Ga0068865_1000729444 284
243 3300006914 Ga0075436_100078664 Ga0075436_1000786642 284
244 3300007076 Ga0075435_100005380 Ga0075435_1000053802 284
245 3300007076 Ga0075435_100096467 Ga0075435_1000964671 284
246 3300009094 Ga0111539_10254829 Ga0111539_102548292 284
247 3300009094 Ga0111539_10287538 Ga0111539_102875381 284
248 3300009094 Ga0111539_10704697 Ga0111539_107046972 284
249 3300009147 Ga0114129_10022306 Ga0114129_100223064 284
250 3300009174 Ga0105241_10009789 Ga0105241_100097895 284
251 3300009545 Ga0105237_10039387 Ga0105237_100393874 284
252 3300009551 Ga0105238_10105126 Ga0105238_101051262 284
253 3300010375 Ga0105239_10017697 Ga0105239_100176975 284
254 3300013100 Ga0157373_10092948 Ga0157373_100929482 284
255 3300013297 Ga0157378_10548293 Ga0157378_105482932 284
256 3300013306 Ga0163162_10017943 Ga0163162_100179435 284
257 3300013306 Ga0163162_10574437 Ga0163162_105744371 284
258 3300013307 Ga0157372_10032766 Ga0157372_100327664 284
259 3300013308 Ga0157375_10219956 Ga0157375_102199562 284
260 3300014325 Ga0163163_10362778 Ga0163163_103627782 284
261 3300014745 Ga0157377_10167380 Ga0157377_101673801 284
262 3300014969 Ga0157376_10010980 Ga0157376_100109805 284
263 3300025901 Ga0207688_10014828 Ga0207688_100148284 284
264 3300025907 Ga0207645_10020234 Ga0207645_100202345 284
265 3300025912 Ga0207707_10032009 Ga0207707_100320094 284
266 3300025914 Ga0207671_10068612 Ga0207671_100686122 284
267 3300025915 Ga0207693_10154107 Ga0207693_101541073 284
268 3300025916 Ga0207663_10067419 Ga0207663_100674193 284
269 3300025917 Ga0207660_10025398 Ga0207660_100253984 284
270 3300025918 Ga0207662_10287351 Ga0207662_102873512 284
271 3300025919 Ga0207657_10002201 Ga0207657_1000220113 284
272 3300025921 Ga0207652_10118130 Ga0207652_101181302 284
273 3300025923 Ga0207681_10042038 Ga0207681_100420382 284
274 3300025925 Ga0207650_10001805 Ga0207650_100018057 284
275 3300025927 Ga0207687_10241313 Ga0207687_102413132 284
276 3300025932 Ga0207690_10012404 Ga0207690_100124042 284
277 3300025933 Ga0207706_10002107 Ga0207706_100021078 284
278 3300025940 Ga0207691_10008329 Ga0207691_100083293 284
279 3300025942 Ga0207689_10056084 Ga0207689_100560843 284
280 3300025945 Ga0207679_10016389 Ga0207679_100163891 284
281 3300025981 Ga0207640_10045090 Ga0207640_100450902 284
282 3300026067 Ga0207678_10006728 Ga0207678_100067286 284
283 3300026075 Ga0207708_10027482 Ga0207708_100274822 284
284 3300026078 Ga0207702_10082368 Ga0207702_100823683 284
285 3300026095 Ga0207676_10218077 Ga0207676_102180771 284
286 3300026118 Ga0207675_100170986 Ga0207675_1001709862 284
287 3300026121 Ga0207683_10001733 Ga0207683_1000173313 284
288 3300028381 Ga0268264_10430533 Ga0268264_104305332 284
289 3300031548 Ga0307408_100337599 Ga0307408_1003375991 284
290 3300031731 Ga0307405_10117364 Ga0307405_101173642 284
291 3300031911 Ga0307412_10052185 Ga0307412_100521853 284
292 3300032002 Ga0307416_100007444 Ga0307416_1000074444 284
293 3300032126 Ga0307415_100019016 Ga0307415_1000190164 284
294 3300035112 Ga0373932_0017901 Ga0373932_0017901_235_1092 284
295 3300035691 Ga0373931_0003309 Ga0373931_0003309_1380_2237 284
296 3300048909 Ga0496106_0197223 Ga0496106_0197223_316_1176 284
297 3300048915 Ga0496112_0069699 Ga0496112_0069699_1554_2414 284
298 3300048915 Ga0496112_0235777 Ga0496112_0235777_570_1430 284
299 3300049568 Ga0501031_0034922 Ga0501031_0034922_2193_3050 284
300 3300049570 Ga0501033_0093134 Ga0501033_0093134_1314_2171 284
301 3300049572 Ga0501036_0021698 Ga0501036_0021698_102_959 284
302 3300049573 Ga0501037_0015751 Ga0501037_0015751_3279_4136 284
303 3300049574 Ga0501038_0002511 Ga0501038_0002511_2817_3674 284
304 3300049575 Ga0501039_0001556 Ga0501039_0001556_10140_10997 284
305 3300049576 Ga0501040_0003219 Ga0501040_0003219_5829_6686 284
306 3300049577 Ga0501041_0000212 Ga0501041_0000212_11947_12804 284
307 3300049578 Ga0501042_0000098 Ga0501042_0000098_25837_26694 284
308 3300049579 Ga0501043_0010972 Ga0501043_0010972_18_875 284
309 3300049580 Ga0501046_0015300 Ga0501046_0015300_917_1774 284
310 3300049582 Ga0501048_0004806 Ga0501048_0004806_2914_3771 284
311 3300049585 Ga0501069_0060479 Ga0501069_0060479_1131_1988 284
312 3300049586 Ga0501070_0017605 Ga0501070_0017605_2776_3633 284
313 3300049587 Ga0501071_0000452 Ga0501071_0000452_5787_6644 284
314 3300049587 Ga0501071_0310443 Ga0501071_0310443_84_941 284
315 3300049588 Ga0501072_0241360 Ga0501072_0241360_454_1311 284
316 3300049590 Ga0501074_0004506 Ga0501074_0004506_4489_5346 284
317 3300049591 Ga0501075_0000095 Ga0501075_0000095_25830_26687 284
318 3300049592 Ga0501076_0000386 Ga0501076_0000386_2855_3712 284
319 3300049593 Ga0501077_0000670 Ga0501077_0000670_15094_15951 284
320 3300049593 Ga0501077_0010466 Ga0501077_0010466_1717_2574 284
321 3300049741 Ga0501079_0001514 Ga0501079_0001514_13958_14815 284
322 3300049743 Ga0501081_0000063 Ga0501081_0000063_14201_15058 284
323 3300049743 Ga0501081_0224113 Ga0501081_0224113_152_1009 284
324 3300049744 Ga0501083_0007185 Ga0501083_0007185_2480_3337 284
325 3300049822 Ga0501035_0056322 Ga0501035_0056322_692_1549 284
326 3300049824 Ga0501045_0000186 Ga0501045_0000186_6637_7494 284
327 3300050509 nmdc:mga0qj67_135159_c1 nmdc:mga0qj67_135159_c1_54_911 284
328 3300050509 nmdc:mga0qj67_180495_c1 nmdc:mga0qj67_180495_c1_446_1300 284
329 3300050509 nmdc:mga0qj67_500283_c1 nmdc:mga0qj67_500283_c1_19_882 284
330 3300050510 nmdc:mga06r32_1752_c1 nmdc:mga06r32_1752_c1_15242_16105 284
331 3300050510 nmdc:mga06r32_256716_c1 nmdc:mga06r32_256716_c1_852_1709 284
332 3300050510 nmdc:mga06r32_68548_c1 nmdc:mga06r32_68548_c1_1062_1916 284
333 3300050511 nmdc:mga08y16_277408_c1 nmdc:mga08y16_277408_c1_10_867 284
334 3300050511 nmdc:mga08y16_570589_c1 nmdc:mga08y16_570589_c1_97_957 284
335 3300050511 nmdc:mga08y16_94837_c1 nmdc:mga08y16_94837_c1_164_1024 284
336 3300050512 nmdc:mga0n895_237255_c1 nmdc:mga0n895_237255_c1_682_1539 284
337 3300050512 nmdc:mga0n895_25810_c1 nmdc:mga0n895_25810_c1_3841_4701 284
338 3300050513 nmdc:mga0rr50_49669_c1 nmdc:mga0rr50_49669_c1_2115_2975 284
339 3300050513 nmdc:mga0rr50_94600_c1 nmdc:mga0rr50_94600_c1_91_948 284
340 3300050514 nmdc:mga08x19_114342_c1 nmdc:mga08x19_114342_c1_872_1732 284
341 3300054114 Ga0501084_0000662 Ga0501084_0000662_22562_23419 284
342 3300060353 Ga0501082_0000921 Ga0501082_0000921_4748_5605 284
343 3300061734 Ga0530510_0007331 Ga0530510_0007331_4113_4970 284
344 3300061734 Ga0530510_0166035 Ga0530510_0166035_427_1284 284
345 2162886006 SwRhRL3b_contig_1476970 SwRhRL3b_0290.00000520 285
346 3300003911 JGI25405J52794_10003167 JGI25405J52794_100031672 285
347 3300005293 Ga0065715_10114658 Ga0065715_101146583 285
348 3300005295 Ga0065707_10003569 Ga0065707_100035694 285
349 3300005295 Ga0065707_10010381 Ga0065707_100103813 285
350 3300005328 Ga0070676_10006146 Ga0070676_100061463 285
351 3300005330 Ga0070690_100195632 Ga0070690_1001956322 285
352 3300005331 Ga0070670_100011459 Ga0070670_1000114597 285
353 3300005334 Ga0068869_100012652 Ga0068869_1000126524 285
354 3300005336 Ga0070680_100001386 Ga0070680_1000013866 285
355 3300005336 Ga0070680_100017312 Ga0070680_1000173122 285
356 3300005336 Ga0070680_100022831 Ga0070680_1000228315 285
357 3300005336 Ga0070680_100160637 Ga0070680_1001606372 285
358 3300005337 Ga0070682_100000179 Ga0070682_1000001798 285
359 3300005338 Ga0068868_100029544 Ga0068868_1000295443 285
360 3300005339 Ga0070660_100009221 Ga0070660_1000092217 285
361 3300005340 Ga0070689_100015332 Ga0070689_1000153323 285
362 3300005341 Ga0070691_10002490 Ga0070691_100024902 285
363 3300005343 Ga0070687_100029307 Ga0070687_1000293073 285
364 3300005343 Ga0070687_100071564 Ga0070687_1000715642 285
365 3300005344 Ga0070661_100001244 Ga0070661_10000124414 285
366 3300005345 Ga0070692_10004506 Ga0070692_100045065 285
367 3300005345 Ga0070692_10005570 Ga0070692_100055702 285
368 3300005353 Ga0070669_100067667 Ga0070669_1000676673 285
369 3300005354 Ga0070675_100047188 Ga0070675_1000471883 285
370 3300005355 Ga0070671_100155151 Ga0070671_1001551512 285
371 3300005364 Ga0070673_100150891 Ga0070673_1001508912 285
372 3300005366 Ga0070659_100000831 Ga0070659_10000083121 285
373 3300005438 Ga0070701_10014437 Ga0070701_100144373 285
374 3300005438 Ga0070701_10025346 Ga0070701_100253462 285
375 3300005438 Ga0070701_10028186 Ga0070701_100281861 285
376 3300005440 Ga0070705_100001080 Ga0070705_10000108013 285
377 3300005440 Ga0070705_100034025 Ga0070705_1000340251 285
378 3300005440 Ga0070705_100205647 Ga0070705_1002056472 285
379 3300005441 Ga0070700_100188399 Ga0070700_1001883991 285
380 3300005444 Ga0070694_100003004 Ga0070694_1000030044 285
381 3300005444 Ga0070694_100018562 Ga0070694_1000185622 285
382 3300005444 Ga0070694_100038937 Ga0070694_1000389374 285
383 3300005445 Ga0070708_100028448 Ga0070708_1000284484 285
384 3300005455 Ga0070663_100096591 Ga0070663_1000965912 285
385 3300005457 Ga0070662_100015674 Ga0070662_1000156743 285
386 3300005458 Ga0070681_10026811 Ga0070681_100268112 285
387 3300005467 Ga0070706_100340272 Ga0070706_1003402721 285
388 3300005467 Ga0070706_100384195 Ga0070706_1003841951 285
389 3300005468 Ga0070707_100011228 Ga0070707_10001122810 285
390 3300005468 Ga0070707_100018261 Ga0070707_1000182614 285
391 3300005468 Ga0070707_100233555 Ga0070707_1002335552 285
392 3300005471 Ga0070698_100028441 Ga0070698_1000284417 285
393 3300005471 Ga0070698_100571346 Ga0070698_1005713461 285
394 3300005471 Ga0070698_100693880 Ga0070698_1006938801 285
395 3300005518 Ga0070699_100201344 Ga0070699_1002013441 285
396 3300005518 Ga0070699_100332078 Ga0070699_1003320782 285
397 3300005518 Ga0070699_100457426 Ga0070699_1004574261 285
398 3300005530 Ga0070679_100001386 Ga0070679_10000138613 285
399 3300005530 Ga0070679_100072710 Ga0070679_1000727103 285
400 3300005535 Ga0070684_100290083 Ga0070684_1002900832 285
401 3300005536 Ga0070697_100009161 Ga0070697_1000091616 285
402 3300005536 Ga0070697_100112358 Ga0070697_1001123582 285
403 3300005536 Ga0070697_100198555 Ga0070697_1001985551 285
404 3300005536 Ga0070697_100339168 Ga0070697_1003391682 285
405 3300005539 Ga0068853_100013726 Ga0068853_1000137265 285
406 3300005545 Ga0070695_100007445 Ga0070695_1000074453 285
407 3300005545 Ga0070695_100033167 Ga0070695_1000331673 285
408 3300005545 Ga0070695_100065518 Ga0070695_1000655181 285
409 3300005546 Ga0070696_100001530 Ga0070696_10000153013 285
410 3300005546 Ga0070696_100044218 Ga0070696_1000442184 285
411 3300005546 Ga0070696_100069326 Ga0070696_1000693261 285
412 3300005546 Ga0070696_100079092 Ga0070696_1000790922 285
413 3300005547 Ga0070693_100003136 Ga0070693_1000031366 285
414 3300005549 Ga0070704_100001927 Ga0070704_1000019277 285
415 3300005549 Ga0070704_100184482 Ga0070704_1001844821 285
416 3300005563 Ga0068855_100004335 Ga0068855_10000433513 285
417 3300005564 Ga0070664_100009717 Ga0070664_1000097176 285
418 3300005577 Ga0068857_100014057 Ga0068857_1000140577 285
419 3300005578 Ga0068854_100027889 Ga0068854_1000278892 285
420 3300005614 Ga0068856_100007569 Ga0068856_1000075695 285
421 3300005615 Ga0070702_100017997 Ga0070702_1000179974 285
422 3300005616 Ga0068852_100019708 Ga0068852_1000197084 285
423 3300005617 Ga0068859_100010607 Ga0068859_1000106074 285
424 3300005618 Ga0068864_100002599 Ga0068864_10000259917 285
425 3300005718 Ga0068866_10211184 Ga0068866_102111841 285
426 3300005719 Ga0068861_100054063 Ga0068861_1000540632 285
427 3300005840 Ga0068870_10013306 Ga0068870_100133063 285
428 3300005840 Ga0068870_10031139 Ga0068870_100311392 285
429 3300005841 Ga0068863_100009792 Ga0068863_1000097927 285
430 3300005841 Ga0068863_100117421 Ga0068863_1001174212 285
431 3300005842 Ga0068858_100035026 Ga0068858_1000350264 285
432 3300005843 Ga0068860_100035984 Ga0068860_1000359844 285
433 3300005843 Ga0068860_100061678 Ga0068860_1000616782 285
434 3300005844 Ga0068862_100005264 Ga0068862_1000052648 285
435 3300005844 Ga0068862_100232690 Ga0068862_1002326901 285
436 3300005937 Ga0081455_10000592 Ga0081455_1000059229 285
437 3300005983 Ga0081540_1001918 Ga0081540_100191819 285
438 3300006163 Ga0070715_10074406 Ga0070715_100744061 285
439 3300006173 Ga0070716_100009838 Ga0070716_1000098385 285
440 3300006175 Ga0070712_100282856 Ga0070712_1002828562 285
441 3300006237 Ga0097621_100241944 Ga0097621_1002419442 285
442 3300006358 Ga0068871_100090839 Ga0068871_1000908392 285
443 3300006846 Ga0075430_100141085 Ga0075430_1001410852 285
444 3300006846 Ga0075430_100243360 Ga0075430_1002433602 285
445 3300006847 Ga0075431_100013006 Ga0075431_1000130065 285
446 3300006847 Ga0075431_100145348 Ga0075431_1001453482 285
447 3300006852 Ga0075433_10002692 Ga0075433_100026928 285
448 3300006852 Ga0075433_10005196 Ga0075433_1000519611 285
449 3300006852 Ga0075433_10038361 Ga0075433_100383612 285
450 3300006852 Ga0075433_10048994 Ga0075433_100489942 285
451 3300006852 Ga0075433_10099875 Ga0075433_100998752 285
452 3300006871 Ga0075434_100007287 Ga0075434_10000728712 285
453 3300006871 Ga0075434_100043308 Ga0075434_1000433084 285
454 3300006871 Ga0075434_100051353 Ga0075434_1000513533 285
455 3300006871 Ga0075434_100090497 Ga0075434_1000904973 285
456 3300006880 Ga0075429_100268518 Ga0075429_1002685182 285
457 3300006880 Ga0075429_100594286 Ga0075429_1005942861 285
458 3300006881 Ga0068865_100086951 Ga0068865_1000869512 285
459 3300006881 Ga0068865_100430228 Ga0068865_1004302282 285
460 3300006914 Ga0075436_100013488 Ga0075436_1000134885 285
461 3300006914 Ga0075436_100066888 Ga0075436_1000668882 285
462 3300006914 Ga0075436_100144203 Ga0075436_1001442032 285
463 3300006931 Ga0097620_100010607 Ga0097620_1000106078 285
464 3300007076 Ga0075435_100017406 Ga0075435_1000174063 285
465 3300007076 Ga0075435_100089479 Ga0075435_1000894792 285
466 3300007076 Ga0075435_100131920 Ga0075435_1001319202 285
467 3300009094 Ga0111539_10000535 Ga0111539_1000053517 285
468 3300009094 Ga0111539_10156466 Ga0111539_101564663 285
469 3300009094 Ga0111539_10172094 Ga0111539_101720943 285
470 3300009094 Ga0111539_10192855 Ga0111539_101928552 285
471 3300009147 Ga0114129_10010794 Ga0114129_100107945 285
472 3300009147 Ga0114129_10013685 Ga0114129_100136858 285
473 3300009147 Ga0114129_10046422 Ga0114129_100464224 285
474 3300009147 Ga0114129_10121943 Ga0114129_101219432 285
475 3300009147 Ga0114129_10188584 Ga0114129_101885843 285
476 3300009147 Ga0114129_10423867 Ga0114129_104238671 285
477 3300009147 Ga0114129_10459872 Ga0114129_104598722 285
478 3300009147 Ga0114129_10631420 Ga0114129_106314201 285
479 3300009147 Ga0114129_10957149 Ga0114129_109571491 285
480 3300009148 Ga0105243_10035210 Ga0105243_100352104 285
481 3300009148 Ga0105243_10293324 Ga0105243_102933242 285
482 3300009174 Ga0105241_10084670 Ga0105241_100846702 285
483 3300009176 Ga0105242_10087728 Ga0105242_100877283 285
484 3300009176 Ga0105242_10260422 Ga0105242_102604222 285
485 3300009176 Ga0105242_10551050 Ga0105242_105510502 285
486 3300009176 Ga0105242_10810151 Ga0105242_108101511 285
487 3300009553 Ga0105249_10061062 Ga0105249_100610623 285
488 3300009553 Ga0105249_10065210 Ga0105249_100652102 285
489 3300013297 Ga0157378_10016364 Ga0157378_100163643 285
490 3300013306 Ga0163162_10123958 Ga0163162_101239582 285
491 3300013306 Ga0163162_10140706 Ga0163162_101407061 285
492 3300013306 Ga0163162_10174875 Ga0163162_101748752 285
493 3300013307 Ga0157372_10483572 Ga0157372_104835722 285
494 3300014326 Ga0157380_10788747 Ga0157380_107887471 285
495 3300017792 Ga0163161_10261952 Ga0163161_102619521 285
496 3300025885 Ga0207653_10011816 Ga0207653_100118162 285
497 3300025903 Ga0207680_10316701 Ga0207680_103167012 285
498 3300025905 Ga0207685_10046379 Ga0207685_100463792 285
499 3300025907 Ga0207645_10009598 Ga0207645_100095985 285
500 3300025908 Ga0207643_10000329 Ga0207643_1000032921 285
501 3300025908 Ga0207643_10019631 Ga0207643_100196314 285
502 3300025910 Ga0207684_10012875 Ga0207684_100128755 285
503 3300025910 Ga0207684_10046001 Ga0207684_100460013 285
504 3300025910 Ga0207684_10314733 Ga0207684_103147332 285
505 3300025911 Ga0207654_10014749 Ga0207654_100147491 285
506 3300025912 Ga0207707_10000352 Ga0207707_1000035230 285
507 3300025912 Ga0207707_10009306 Ga0207707_100093062 285
508 3300025915 Ga0207693_10066011 Ga0207693_100660113 285
509 3300025916 Ga0207663_10078825 Ga0207663_100788253 285
510 3300025917 Ga0207660_10000700 Ga0207660_100007004 285
511 3300025917 Ga0207660_10009728 Ga0207660_100097287 285
512 3300025917 Ga0207660_10053857 Ga0207660_100538573 285
513 3300025918 Ga0207662_10014316 Ga0207662_100143164 285
514 3300025918 Ga0207662_10072826 Ga0207662_100728262 285
515 3300025919 Ga0207657_10002264 Ga0207657_1000226418 285
516 3300025920 Ga0207649_10006672 Ga0207649_100066724 285
517 3300025921 Ga0207652_10002500 Ga0207652_1000250013 285
518 3300025922 Ga0207646_10020607 Ga0207646_100206074 285
519 3300025922 Ga0207646_10022079 Ga0207646_100220796 285
520 3300025922 Ga0207646_10044313 Ga0207646_100443134 285
521 3300025922 Ga0207646_10537759 Ga0207646_105377591 285
522 3300025923 Ga0207681_10114175 Ga0207681_101141752 285
523 3300025925 Ga0207650_10190803 Ga0207650_101908032 285
524 3300025926 Ga0207659_10067240 Ga0207659_100672402 285
525 3300025932 Ga0207690_10003859 Ga0207690_100038596 285
526 3300025933 Ga0207706_10025376 Ga0207706_100253764 285
527 3300025933 Ga0207706_10241974 Ga0207706_102419742 285
528 3300025933 Ga0207706_10292616 Ga0207706_102926162 285
529 3300025934 Ga0207686_10135074 Ga0207686_101350741 285
530 3300025934 Ga0207686_10416783 Ga0207686_104167831 285
531 3300025935 Ga0207709_10190469 Ga0207709_101904692 285
532 3300025936 Ga0207670_10014375 Ga0207670_100143753 285
533 3300025938 Ga0207704_10211568 Ga0207704_102115681 285
534 3300025938 Ga0207704_10325938 Ga0207704_103259382 285
535 3300025939 Ga0207665_10005945 Ga0207665_100059452 285
536 3300025941 Ga0207711_10113617 Ga0207711_101136174 285
537 3300025942 Ga0207689_10014499 Ga0207689_100144996 285
538 3300025942 Ga0207689_10048500 Ga0207689_100485004 285
539 3300025945 Ga0207679_10002955 Ga0207679_100029558 285
540 3300025949 Ga0207667_10000497 Ga0207667_1000049742 285
541 3300025960 Ga0207651_10198673 Ga0207651_101986732 285
542 3300025981 Ga0207640_10002010 Ga0207640_100020103 285
543 3300026023 Ga0207677_10011748 Ga0207677_100117484 285
544 3300026035 Ga0207703_10027472 Ga0207703_100274724 285
545 3300026041 Ga0207639_10006390 Ga0207639_100063907 285
546 3300026067 Ga0207678_10003731 Ga0207678_1000373114 285
547 3300026078 Ga0207702_10019642 Ga0207702_100196424 285
548 3300026089 Ga0207648_10247511 Ga0207648_102475112 285
549 3300026095 Ga0207676_10025356 Ga0207676_100253562 285
550 3300026095 Ga0207676_10113162 Ga0207676_101131623 285
551 3300026116 Ga0207674_10000550 Ga0207674_1000055025 285
552 3300026116 Ga0207674_10017719 Ga0207674_100177199 285
553 3300026118 Ga0207675_100013273 Ga0207675_1000132736 285
554 3300026118 Ga0207675_100634738 Ga0207675_1006347381 285
555 3300027360 Ga0209969_1012783 Ga0209969_10127832 285
556 3300027364 Ga0209967_1019203 Ga0209967_10192031 285
557 3300027378 Ga0209981_1003252 Ga0209981_10032523 285
558 3300027424 Ga0209984_1004176 Ga0209984_10041762 285
559 3300027424 Ga0209984_1010539 Ga0209984_10105391 285
560 3300027462 Ga0210000_1007514 Ga0210000_10075142 285
561 3300027526 Ga0209968_1000952 Ga0209968_10009524 285
562 3300027543 Ga0209999_1006579 Ga0209999_10065791 285
563 3300027552 Ga0209982_1010152 Ga0209982_10101522 285
564 3300027614 Ga0209970_1006809 Ga0209970_10068092 285
565 3300027617 Ga0210002_1001446 Ga0210002_10014463 285
566 3300027617 Ga0210002_1021014 Ga0210002_10210141 285
567 3300027665 Ga0209983_1005789 Ga0209983_10057892 285
568 3300027665 Ga0209983_1006509 Ga0209983_10065092 285
569 3300027671 Ga0209588_1021428 Ga0209588_10214282 285
570 3300027682 Ga0209971_1000028 Ga0209971_100002831 285
571 3300027682 Ga0209971_1011248 Ga0209971_10112483 285
572 3300027682 Ga0209971_1048046 Ga0209971_10480462 285
573 3300027695 Ga0209966_1000073 Ga0209966_100007323 285
574 3300027717 Ga0209998_10000001 Ga0209998_10000001171 285
575 3300027717 Ga0209998_10003754 Ga0209998_100037541 285
576 3300027876 Ga0209974_10005514 Ga0209974_100055144 285
577 3300027876 Ga0209974_10007787 Ga0209974_100077874 285
578 3300027907 Ga0207428_10000394 Ga0207428_1000039422 285
579 3300027907 Ga0207428_10019791 Ga0207428_100197914 285
580 3300027907 Ga0207428_10227041 Ga0207428_102270412 285
581 3300028380 Ga0268265_10019548 Ga0268265_100195484 285
582 3300028380 Ga0268265_10522212 Ga0268265_105222122 285
583 3300028381 Ga0268264_10101537 Ga0268264_101015373 285
584 3300028381 Ga0268264_10304018 Ga0268264_103040182 285
585 3300031852 Ga0307410_10215490 Ga0307410_102154902 285
586 3300032004 Ga0307414_10047790 Ga0307414_100477902 285
587 3300035170 Ga0373943_0247174 Ga0373943_0247174_49_909 285
588 3300035692 Ga0373935_0065352 Ga0373935_0065352_1076_1936 285
589 3300035725 Ga0373947_0039950 Ga0373947_0039950_1841_2701 285
590 3300038996 Ga0242420_025256 Ga0242420_025256_22_888 285
591 3300042008 Ga0439450_001193 Ga0439450_001193_2745_3608 285
592 3300042436 Ga0439435_0045685 Ga0439435_0045685_56_931 285
593 3300042439 Ga0439464_0003489 Ga0439464_0003489_1868_2731 285
594 3300042461 Ga0439460_0000212 Ga0439460_0000212_2256_3119 285
595 3300042876 Ga0451577_0003828 Ga0451577_0003828_3538_4404 285
596 3300042876 Ga0451577_0288279 Ga0451577_0288279_240_1100 285
597 3300042876 Ga0451577_0380143 Ga0451577_0380143_289_1152 285
598 3300042876 Ga0451577_0564659 Ga0451577_0564659_157_1014 285
599 3300044673 Ga0453683_0015559 Ga0453683_0015559_64_930 285
600 3300044673 Ga0453683_0034845 Ga0453683_0034845_1821_2693 285
601 3300044673 Ga0453683_0086734 Ga0453683_0086734_993_1865 285
602 3300044673 Ga0453683_0089063 Ga0453683_0089063_138_1001 285
603 3300044712 Ga0453684_0067501 Ga0453684_0067501_3613_4479 285
604 3300045051 Ga0451576_0055701 Ga0451576_0055701_2330_3196 285
605 3300045051 Ga0451576_0465121 Ga0451576_0465121_319_1179 285
606 3300046473 Ga0495582_0129083 Ga0495582_0129083_48_908 285
607 3300046664 Ga0495659_0036045 Ga0495659_0036045_178_1038 285
608 3300049568 Ga0501031_0029564 Ga0501031_0029564_1418_2278 285
609 3300049569 Ga0501032_0051456 Ga0501032_0051456_260_1120 285
610 3300049571 Ga0501034_0109543 Ga0501034_0109543_1166_2026 285
611 3300049572 Ga0501036_0042144 Ga0501036_0042144_1082_1942 285
612 3300049573 Ga0501037_0025709 Ga0501037_0025709_958_1818 285
613 3300049574 Ga0501038_0047038 Ga0501038_0047038_2404_3264 285
614 3300049575 Ga0501039_0241058 Ga0501039_0241058_347_1207 285
615 3300049576 Ga0501040_0011029 Ga0501040_0011029_999_1862 285
616 3300049576 Ga0501040_0015343 Ga0501040_0015343_221_1081 285
617 3300049577 Ga0501041_0024648 Ga0501041_0024648_2404_3264 285
618 3300049577 Ga0501041_0140100 Ga0501041_0140100_258_1115 285
619 3300049578 Ga0501042_0013216 Ga0501042_0013216_143_1006 285
620 3300049578 Ga0501042_0176423 Ga0501042_0176423_467_1327 285
621 3300049579 Ga0501043_0012354 Ga0501043_0012354_5518_6378 285
622 3300049579 Ga0501043_0063974 Ga0501043_0063974_590_1453 285
623 3300049580 Ga0501046_0009321 Ga0501046_0009321_2329_3192 285
624 3300049580 Ga0501046_0182445 Ga0501046_0182445_81_944 285
625 3300049582 Ga0501048_0019522 Ga0501048_0019522_1942_2805 285
626 3300049582 Ga0501048_0073577 Ga0501048_0073577_1209_2069 285
627 3300049582 Ga0501048_0113089 Ga0501048_0113089_565_1422 285
628 3300049584 Ga0501068_0029907 Ga0501068_0029907_1585_2445 285
629 3300049585 Ga0501069_0010011 Ga0501069_0010011_1103_1963 285
630 3300049585 Ga0501069_0173936 Ga0501069_0173936_19_882 285
631 3300049586 Ga0501070_0018760 Ga0501070_0018760_3983_4843 285
632 3300049587 Ga0501071_0292592 Ga0501071_0292592_185_1045 285
633 3300049588 Ga0501072_0039234 Ga0501072_0039234_1568_2428 285
634 3300049589 Ga0501073_0021533 Ga0501073_0021533_3152_4012 285
635 3300049591 Ga0501075_0059906 Ga0501075_0059906_845_1705 285
636 3300049592 Ga0501076_0006409 Ga0501076_0006409_5675_6532 285
637 3300049592 Ga0501076_0091193 Ga0501076_0091193_1548_2408 285
638 3300049593 Ga0501077_0014420 Ga0501077_0014420_3797_4660 285
639 3300049593 Ga0501077_0074150 Ga0501077_0074150_1081_1941 285
640 3300049741 Ga0501079_0001408 Ga0501079_0001408_3906_4769 285
641 3300049741 Ga0501079_0006617 Ga0501079_0006617_7281_8141 285
642 3300049742 Ga0501080_0025806 Ga0501080_0025806_921_1781 285
643 3300049742 Ga0501080_0201548 Ga0501080_0201548_566_1423 285
644 3300049744 Ga0501083_0008605 Ga0501083_0008605_1165_2028 285
645 3300049744 Ga0501083_0126326 Ga0501083_0126326_343_1203 285
646 3300049822 Ga0501035_0103790 Ga0501035_0103790_343_1203 285
647 3300049823 Ga0501044_0035034 Ga0501044_0035034_4157_5017 285
648 3300049824 Ga0501045_0000164 Ga0501045_0000164_12513_13376 285
649 3300049824 Ga0501045_0020558 Ga0501045_0020558_3048_3908 285
650 3300050507 nmdc:mga05p37_11017_c1 nmdc:mga05p37_11017_c1_4662_5519 285
651 3300050507 nmdc:mga05p37_17070_c2 nmdc:mga05p37_17070_c2_6636_7493 285
652 3300050507 nmdc:mga05p37_219222_c1 nmdc:mga05p37_219222_c1_325_1182 285
653 3300050507 nmdc:mga05p37_326315_c1 nmdc:mga05p37_326315_c1_69_929 285
654 3300050507 nmdc:mga05p37_605849_c1 nmdc:mga05p37_605849_c1_296_1168 285
655 3300050509 nmdc:mga0qj67_138062_c1 nmdc:mga0qj67_138062_c1_231_1097 285
656 3300050509 nmdc:mga0qj67_148937_c1 nmdc:mga0qj67_148937_c1_257_1123 285
657 3300050509 nmdc:mga0qj67_23322_c1 nmdc:mga0qj67_23322_c1_2648_3508 285
658 3300050510 nmdc:mga06r32_17445_c1 nmdc:mga06r32_17445_c1_858_1715 285
659 3300050510 nmdc:mga06r32_185874_c1 nmdc:mga06r32_185874_c1_125_991 285
660 3300050511 nmdc:mga08y16_1417_c1 nmdc:mga08y16_1417_c1_18934_19800 285
661 3300050511 nmdc:mga08y16_31342_c1 nmdc:mga08y16_31342_c1_424_1284 285
662 3300050511 nmdc:mga08y16_79351_c1 nmdc:mga08y16_79351_c1_2324_3190 285
663 3300050512 nmdc:mga0n895_304925_c1 nmdc:mga0n895_304925_c1_131_1003 285
664 3300050512 nmdc:mga0n895_67200_c1 nmdc:mga0n895_67200_c1_681_1544 285
665 3300050512 nmdc:mga0n895_75392_c1 nmdc:mga0n895_75392_c1_953_1819 285
666 3300050513 nmdc:mga0rr50_107970_c1 nmdc:mga0rr50_107970_c1_448_1320 285
667 3300050513 nmdc:mga0rr50_252504_c1 nmdc:mga0rr50_252504_c1_441_1298 285
668 3300050514 nmdc:mga08x19_11443_c1 nmdc:mga08x19_11443_c1_3824_4684 285
669 3300050515 nmdc:mga0a205_19436_c1 nmdc:mga0a205_19436_c1_417_1274 285
670 3300050515 nmdc:mga0a205_2042_c1 nmdc:mga0a205_2042_c1_6002_6868 285
671 3300050515 nmdc:mga0a205_27043_c1 nmdc:mga0a205_27043_c1_1505_2371 285
672 3300050515 nmdc:mga0a205_99550_c1 nmdc:mga0a205_99550_c1_138_1010 285
673 3300054114 Ga0501084_0000300 Ga0501084_0000300_20893_21756 285
674 3300054114 Ga0501084_0024289 Ga0501084_0024289_3848_4708 285
675 3300059423 Ga0590074_010587 Ga0590074_010587_123_983 285
676 3300059424 Ga0590075_025830 Ga0590075_025830_506_1396 285
677 3300059426 Ga0590077_008904 Ga0590077_008904_1109_1969 285
678 3300060353 Ga0501082_0100806 Ga0501082_0100806_474_1334 285
679 3300060353 Ga0501082_0269251 Ga0501082_0269251_522_1385 285
680 3300061734 Ga0530510_0025591 Ga0530510_0025591_2439_3296 285
681 3300061734 Ga0530510_0158887 Ga0530510_0158887_291_1154 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

54

284

0.95

PF09084

NMT1

NMT1/THI5 like

138

238

0.88

PF09084

NMT1

NMT1/THI5 like

24

149

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ovo-assembly1.cif.gz_B x-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate 0.9477 24 260
8ovp-assembly1.cif.gz_A x-ray structure of the iaspsnfr in complex with l-aspartate 0.9466 24 260
8ovp-assembly1.cif.gz_B x-ray structure of the iaspsnfr in complex with l-aspartate 0.9432 23 260
5eyf-assembly1.cif.gz_A crystal structure of solute-binding protein from enterococcus faecium with bound glutamate 0.9354 24 263
4zv2-assembly1.cif.gz_A an ancestral arginine-binding protein bound to glutamine 0.9333 34 261
ID Description Score Start End Superfamily
af_P96257_184_272_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9453 130 220 3.40.190.10
5eyfB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9437 127 225 3.40.190.10
af_P30860_108_189_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9278 129 213 3.40.190.10
2pyyC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9272 127 219 3.40.190.10
5eyfB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9252 127 225 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1Q3JSH9-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9671 94 270 GO:0005576
GO:0006865
GO:0030288
AF-X1QQX8-F1-model_v4 Solute-binding protein family 3/N-terminal domain-containing protein 0.9625 68 285 GO:0005576
GO:0006865
GO:0030288
AF-A0A3B8HHM2-F1-model_v4 ABC transporter substrate-binding protein 0.9578 17 285 GO:0005576
GO:0006865
GO:0015276
GO:0016020
GO:0030288
AF-A0A7Y6ABS9-F1-model_v4 Transporter substrate-binding domain-containing protein 0.9561 87 257 GO:0005576
GO:0006865
GO:0030288
AF-A0A259CJ43-F1-model_v4 Amino acid ABC transporter substrate-binding protein 0.9443 28 278 GO:0005576
GO:0006865
GO:0030288

Feature Viewer

pLDDT pTM Quality
91.27 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map