F474282

General Info

Members Datasets Scaffolds Average Seq Length
673 248 1346 171

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100125439|Ga0070669_1001254392
Length 167
Sequence MEHKTRFGSLQDYTKGGVEVINDDARNYVFSNVFDVASRSKPYEKVAVGKNIEYVIEAIRAEGTSGWRAPAQDEFALVMDGEVEIRLLKLDKPAGATQGSVALPGTPAGKKMGVVRARRGHMTLLPVGSAYQFHAAKPGVVLLQTVAGADTVEKWADICQTSPRPGR

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
167 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
168 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
169 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
170 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
171 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
172 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
175 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
176 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
177 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
178 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
244 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
246 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
248 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 1.63
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 8.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_100125439 3300005353 Bacteria 1964
2 JGI25406J46586_10028461 3300003203 Bacteria 2129
3 rootL2_10179812 3300003322 Unclassified 1966
4 JGI26129J50193_1002562 3300003349 Bacteria 1275
5 JGI25407J50210_10006920 3300003373 Bacteria 2835
6 JGI25407J50210_10043584 3300003373 Bacteria 1146
7 JGI25407J50210_10048456 3300003373 Bacteria 1078
8 JGI25407J50210_10093668 3300003373 Bacteria 743
9 Ga0065707_10031532 3300005295 Bacteria 1144
10 Ga0070676_10100525 3300005328 Bacteria 1785
11 Ga0070690_100311445 3300005330 Bacteria 1132
12 Ga0068869_100007399 3300005334 Bacteria 7013
13 Ga0070689_100363341 3300005340 Bacteria 1217
14 Ga0070689_100555301 3300005340 Bacteria 990
15 Ga0070691_10027357 3300005341 Bacteria 2661
16 Ga0070691_10069198 3300005341 Bacteria 1710
17 Ga0070687_100041533 3300005343 Bacteria 2325
18 Ga0070668_100132865 3300005347 Bacteria 1999
19 Ga0070668_100676605 3300005347 Unclassified 908
20 Ga0070669_100125210 3300005353 Bacteria 1966
21 Ga0070669_100248473 3300005353 Unclassified 1416
22 Ga0070669_100740086 3300005353 Bacteria 832
23 Ga0070674_100273842 3300005356 Bacteria 1335
24 Ga0070703_10009471 3300005406 Bacteria 2747
25 Ga0070709_11017557 3300005434 Bacteria 660
26 Ga0070701_10104977 3300005438 Bacteria 1570
27 Ga0070711_100774868 3300005439 Bacteria 812
28 Ga0070705_100087601 3300005440 Bacteria 1930
29 Ga0070705_100168725 3300005440 Bacteria 1471
30 Ga0070694_100003890 3300005444 Bacteria 8925
31 Ga0070694_100029173 3300005444 Bacteria 3598
32 Ga0070708_100024413 3300005445 Bacteria 5158
33 Ga0070708_100049457 3300005445 Bacteria 3719
34 Ga0070708_100050792 3300005445 Bacteria 3672
35 Ga0070708_100278984 3300005445 Bacteria 1573
36 Ga0070708_100695931 3300005445 Bacteria 957
37 Ga0070708_100796027 3300005445 Unclassified 889
38 Ga0070708_101242056 3300005445 Bacteria 696
39 Ga0070662_100059946 3300005457 Bacteria 2773
40 Ga0070662_100107716 3300005457 Bacteria 2119
41 Ga0070662_100506186 3300005457 Unclassified 1008
42 Ga0070681_10106442 3300005458 Bacteria 2746
43 Ga0068867_100169151 3300005459 Bacteria 1730
44 Ga0070706_100016134 3300005467 Bacteria 6898
45 Ga0070706_100079641 3300005467 Bacteria 3032
46 Ga0070706_100466797 3300005467 Bacteria 1174
47 Ga0070706_100494656 3300005467 Unclassified 1138
48 Ga0070706_100689179 3300005467 Bacteria 948
49 Ga0070707_100023243 3300005468 Bacteria 5864
50 Ga0070707_100035167 3300005468 Bacteria 4779
51 Ga0070707_100048016 3300005468 Bacteria 4088
52 Ga0070707_100076461 3300005468 Bacteria 3229
53 Ga0070707_100084933 3300005468 Bacteria 3059
54 Ga0070698_100006689 3300005471 Bacteria 12503
55 Ga0070698_100021105 3300005471 Bacteria 6822
56 Ga0070698_100062598 3300005471 Bacteria 3753
57 Ga0070698_100328858 3300005471 Bacteria 1459
58 Ga0070698_100704531 3300005471 Bacteria 952
59 Ga0070698_101519971 3300005471 Bacteria 621
60 Ga0070699_100001831 3300005518 Bacteria 19300
61 Ga0070699_100002198 3300005518 Bacteria 17645
62 Ga0070699_100039267 3300005518 Bacteria 4099
63 Ga0070699_101803653 3300005518 Bacteria 560
64 Ga0070679_100099573 3300005530 Plasmid 2894
65 Ga0070697_100001953 3300005536 Bacteria 15786
66 Ga0070697_100036110 3300005536 Bacteria 3991
67 Ga0070697_100043898 3300005536 Bacteria 3620
68 Ga0070697_100212671 3300005536 Bacteria 1647
69 Ga0070697_100236461 3300005536 Bacteria 1559
70 Ga0070697_100548093 3300005536 Unclassified 1014
71 Ga0070697_100613746 3300005536 Bacteria 956
72 Ga0070697_101292878 3300005536 Archaea 651
73 Ga0068853_100378803 3300005539 Bacteria 1321
74 Ga0070672_100036667 3300005543 Bacteria 3737
75 Ga0070686_100131074 3300005544 Bacteria 1734
76 Ga0070695_100000460 3300005545 Bacteria 21193
77 Ga0070695_100012869 3300005545 Bacteria 5022
78 Ga0070695_100015255 3300005545 Bacteria 4636
79 Ga0070695_100026306 3300005545 Bacteria 3599
80 Ga0070695_100283258 3300005545 Bacteria 1219
81 Ga0070696_100062549 3300005546 Bacteria 2605
82 Ga0070696_100093306 3300005546 Bacteria 2146
83 Ga0070696_100260155 3300005546 Bacteria 1315
84 Ga0070696_100514092 3300005546 Bacteria 955
85 Ga0070696_100521022 3300005546 Bacteria 949
86 Ga0070693_100022435 3300005547 Bacteria 3357
87 Ga0070665_100423974 3300005548 Bacteria 1339
88 Ga0070704_100052788 3300005549 Unclassified 2870
89 Ga0070704_100330886 3300005549 Bacteria 1280
90 Ga0070704_100677265 3300005549 Bacteria 913
91 Ga0068854_100303293 3300005578 Unclassified 1293
92 Ga0068856_100165420 3300005614 Unclassified 2223
93 Ga0070702_100312252 3300005615 Bacteria 1092
94 Ga0068859_100110747 3300005617 Bacteria 2807
95 Ga0068859_100212622 3300005617 Bacteria 2020
96 Ga0068859_100515782 3300005617 Bacteria 1290
97 Ga0068864_100153424 3300005618 Bacteria 2088
98 Ga0068864_101643256 3300005618 Bacteria 647
99 Ga0068861_100056462 3300005719 Bacteria 2997
100 Ga0068861_100345766 3300005719 Bacteria 1303
101 Ga0068861_100541973 3300005719 Bacteria 1059
102 Ga0068863_100731486 3300005841 Bacteria 985
103 Ga0068858_100451341 3300005842 Bacteria 1239
104 Ga0068860_100078574 3300005843 Bacteria 3137
105 Ga0068860_100338722 3300005843 Bacteria 1479
106 Ga0068860_100348275 3300005843 Unclassified 1457
107 Ga0068860_100368703 3300005843 Bacteria 1416
108 Ga0068862_100016565 3300005844 Bacteria 6137
109 Ga0068862_100117927 3300005844 Bacteria 2336
110 Ga0068862_100594266 3300005844 Bacteria 1062
111 Ga0068862_101126406 3300005844 Unclassified 781
112 Ga0081455_10001543 3300005937 Bacteria 28366
113 Ga0081455_10008533 3300005937 Bacteria 10636
114 Ga0081455_10053578 3300005937 Bacteria 3445
115 Ga0081455_10189691 3300005937 Bacteria 1549
116 Ga0081538_10002247 3300005981 Bacteria 19114
117 Ga0081538_10003897 3300005981 Bacteria 13932
118 Ga0081538_10008193 3300005981 Bacteria 8919
119 Ga0081538_10112891 3300005981 Bacteria 1329
120 Ga0081539_10000259 3300005985 Bacteria 121997
121 Ga0081539_10035888 3300005985 Bacteria 2973
122 Ga0075432_10004633 3300006058 Bacteria 4682
123 Ga0075432_10082206 3300006058 Bacteria 1169
124 Ga0075432_10112972 3300006058 Bacteria 1014
125 Ga0070715_10284789 3300006163 Bacteria 878
126 Ga0070715_10336202 3300006163 Bacteria 820
127 Ga0070712_100002240 3300006175 Bacteria 11897
128 Ga0097621_101552497 3300006237 Bacteria 629
129 Ga0075428_100003902 3300006844 Bacteria 16380
130 Ga0075428_100007156 3300006844 Bacteria 12364
131 Ga0075428_100008036 3300006844 Bacteria 11708
132 Ga0075428_100012139 3300006844 Bacteria 9585
133 Ga0075428_100030165 3300006844 Bacteria 5999
134 Ga0075428_100051729 3300006844 Bacteria 4504
135 Ga0075428_100302101 3300006844 Bacteria 1721
136 Ga0075428_100394885 3300006844 Bacteria 1482
137 Ga0075428_100483830 3300006844 Bacteria 1325
138 Ga0075428_100914080 3300006844 Unclassified 931
139 Ga0075430_100002663 3300006846 Bacteria 14892
140 Ga0075430_100006099 3300006846 Bacteria 10161
141 Ga0075430_100007190 3300006846 Bacteria 9391
142 Ga0075430_100011494 3300006846 Bacteria 7522
143 Ga0075430_100050602 3300006846 Bacteria 3502
144 Ga0075430_100051408 3300006846 Bacteria 3473
145 Ga0075430_100064480 3300006846 Bacteria 3078
146 Ga0075430_100187453 3300006846 Bacteria 1720
147 Ga0075430_100209856 3300006846 Bacteria 1616
148 Ga0075430_100845808 3300006846 Bacteria 754
149 Ga0075430_101217574 3300006846 Bacteria 620
150 Ga0075431_100001116 3300006847 Bacteria 24069
151 Ga0075431_100001256 3300006847 Bacteria 23086
152 Ga0075431_100004648 3300006847 Bacteria 13485
153 Ga0075431_100006340 3300006847 Bacteria 11751
154 Ga0075431_100006591 3300006847 Bacteria 11533
155 Ga0075431_100007489 3300006847 Bacteria 10870
156 Ga0075431_100008892 3300006847 Bacteria 10061
157 Ga0075431_100011272 3300006847 Bacteria 9005
158 Ga0075431_100017905 3300006847 Bacteria 7206
159 Ga0075431_100018519 3300006847 Bacteria 7093
160 Ga0075431_100034777 3300006847 Bacteria 5190
161 Ga0075431_100295658 3300006847 Bacteria 1637
162 Ga0075433_10000669 3300006852 Bacteria 23231
163 Ga0075433_10002922 3300006852 Bacteria 13112
164 Ga0075433_10004598 3300006852 Bacteria 10766
165 Ga0075433_10040844 3300006852 Bacteria 4017
166 Ga0075433_10063656 3300006852 Bacteria 3232
167 Ga0075433_10068646 3300006852 Bacteria 3112
168 Ga0075433_10212140 3300006852 Bacteria 1720
169 Ga0075433_10492936 3300006852 Bacteria 1079
170 Ga0075433_10928762 3300006852 Unclassified 759
171 Ga0075434_100011017 3300006871 Bacteria 8507
172 Ga0075434_100032110 3300006871 Bacteria 5177
173 Ga0075434_100314096 3300006871 Bacteria 1587
174 Ga0075434_100404112 3300006871 Bacteria 1387
175 Ga0075434_100721810 3300006871 Bacteria 1014
176 Ga0075429_100004679 3300006880 Bacteria 11782
177 Ga0075429_100007015 3300006880 Bacteria 9788
178 Ga0075429_100009683 3300006880 Bacteria 8354
179 Ga0075429_100012342 3300006880 Bacteria 7412
180 Ga0075429_100038696 3300006880 Bacteria 4152
181 Ga0075429_100078428 3300006880 Bacteria 2879
182 Ga0075429_100411103 3300006880 Bacteria 1185
183 Ga0075429_100415934 3300006880 Bacteria 1177
184 Ga0068865_100803660 3300006881 Bacteria 812
185 Ga0075436_100001627 3300006914 Bacteria 15377
186 Ga0097620_100110740 3300006931 Bacteria 2807
187 Ga0097620_100212628 3300006931 Bacteria 2020
188 Ga0097620_100515781 3300006931 Bacteria 1290
189 Ga0075435_100008223 3300007076 Bacteria 7472
190 Ga0075435_100067112 3300007076 Bacteria 2920
191 Ga0099794_10041399 3300007265 Bacteria 2194
192 Ga0099794_10070826 3300007265 Bacteria 1707
193 Ga0105251_10280813 3300009011 Bacteria 753
194 Ga0105250_10090266 3300009092 Bacteria 1246
195 Ga0111539_10009885 3300009094 Bacteria 12039
196 Ga0111539_10059305 3300009094 Bacteria 4538
197 Ga0111539_10211583 3300009094 Bacteria 2259
198 Ga0111539_10345166 3300009094 Bacteria 1733
199 Ga0111539_11210027 3300009094 Bacteria 877
200 Ga0105245_10526696 3300009098 Unclassified 1201
201 Ga0105245_11350496 3300009098 Bacteria 762
202 Ga0105247_10045418 3300009101 Bacteria 2695
203 Ga0114129_10003693 3300009147 Bacteria 21554
204 Ga0114129_10007696 3300009147 Bacteria 15331
205 Ga0114129_10008727 3300009147 Bacteria 14450
206 Ga0114129_10019112 3300009147 Bacteria 9759
207 Ga0114129_10029945 3300009147 Bacteria 7708
208 Ga0114129_10030216 3300009147 Bacteria 7672
209 Ga0114129_10043420 3300009147 Bacteria 6325
210 Ga0114129_10051540 3300009147 Bacteria 5778
211 Ga0114129_10056336 3300009147 Bacteria 5506
212 Ga0114129_10181504 3300009147 Bacteria 2863
213 Ga0114129_10231921 3300009147 Bacteria 2486
214 Ga0114129_10253125 3300009147 Bacteria 2363
215 Ga0114129_10330026 3300009147 Bacteria 2026
216 Ga0114129_10516126 3300009147 Bacteria 1558
217 Ga0114129_10555162 3300009147 Bacteria 1493
218 Ga0114129_10916497 3300009147 Bacteria 1109
219 Ga0114129_11968981 3300009147 Bacteria 707
220 Ga0105243_10199566 3300009148 Bacteria 1753
221 Ga0105243_11081837 3300009148 Bacteria 809
222 Ga0105243_11669631 3300009148 Bacteria 665
223 Ga0105241_10368347 3300009174 Bacteria 1252
224 Ga0105241_10559985 3300009174 Unclassified 1027
225 Ga0105242_10527536 3300009176 Unclassified 1128
226 Ga0105248_10095113 3300009177 Bacteria 3354
227 Ga0105248_10733297 3300009177 Unclassified 1115
228 Ga0105249_10013418 3300009553 Bacteria 7234
229 Ga0105249_10177492 3300009553 Bacteria 2070
230 Ga0105249_10290314 3300009553 Bacteria 1637
231 Ga0105249_10340540 3300009553 Bacteria 1516
232 Ga0105249_10481396 3300009553 Bacteria 1284
233 Ga0105249_10521171 3300009553 Bacteria 1236
234 Ga0105249_10571382 3300009553 Unclassified 1183
235 Ga0105239_11197862 3300010375 Bacteria 875
236 Ga0105239_11316227 3300010375 Bacteria 833
237 Ga0105239_11570596 3300010375 Unclassified 761
238 Ga0157371_10074606 3300013102 Bacteria 2402
239 Ga0157369_11228610 3300013105 Bacteria 764
240 Ga0163162_10354361 3300013306 Unclassified 1600
241 Ga0163162_10529467 3300013306 Bacteria 1308
242 Ga0163162_10618706 3300013306 Bacteria 1208
243 Ga0157375_11257353 3300013308 Bacteria 869
244 Ga0157375_11955601 3300013308 Bacteria 697
245 Ga0157380_11236385 3300014326 Bacteria 792
246 Ga0157379_10110911 3300014968 Bacteria 2464
247 Ga0157379_10156624 3300014968 Bacteria 2055
248 Ga0163161_10399478 3300017792 Bacteria 1102
249 Ga0213872_10216440 3300021361 Viruses 817
250 Ga0207653_10163952 3300025885 Bacteria 824
251 Ga0207692_10342927 3300025898 Bacteria 919
252 Ga0207642_10252085 3300025899 Bacteria 1002
253 Ga0207685_10047104 3300025905 Bacteria 1644
254 Ga0207699_10065682 3300025906 Bacteria 2200
255 Ga0207645_10111374 3300025907 Bacteria 1772
256 Ga0207684_10000960 3300025910 Bacteria 32371
257 Ga0207684_10004629 3300025910 Bacteria 12914
258 Ga0207684_10008063 3300025910 Bacteria 9399
259 Ga0207684_10040611 3300025910 Bacteria 3944
260 Ga0207684_10045073 3300025910 Bacteria 3741
261 Ga0207684_10524557 3300025910 Unclassified 1014
262 Ga0207654_10212515 3300025911 Bacteria 1279
263 Ga0207707_10084959 3300025912 Bacteria 2765
264 Ga0207707_10542502 3300025912 Bacteria 989
265 Ga0207695_10215593 3300025913 Bacteria 1829
266 Ga0207693_10012863 3300025915 Bacteria 6752
267 Ga0207693_10213266 3300025915 Bacteria 1517
268 Ga0207662_10054713 3300025918 Bacteria 2380
269 Ga0207646_10002161 3300025922 Bacteria 23484
270 Ga0207646_10022655 3300025922 Bacteria 5784
271 Ga0207646_10046243 3300025922 Bacteria 3905
272 Ga0207646_10141929 3300025922 Bacteria 2164
273 Ga0207646_10203358 3300025922 Bacteria 1789
274 Ga0207646_10211030 3300025922 Bacteria 1753
275 Ga0207646_10438101 3300025922 Bacteria 1179
276 Ga0207681_10090036 3300025923 Bacteria 2189
277 Ga0207681_10162889 3300025923 Unclassified 1683
278 Ga0207681_10191227 3300025923 Bacteria 1566
279 Ga0207681_10318557 3300025923 Unclassified 1236
280 Ga0207681_10931593 3300025923 Bacteria 728
281 Ga0207687_10100190 3300025927 Bacteria 2130
282 Ga0207644_10660289 3300025931 Bacteria 871
283 Ga0207706_10010308 3300025933 Bacteria 8545
284 Ga0207706_10132553 3300025933 Bacteria 2192
285 Ga0207706_10725009 3300025933 Bacteria 848
286 Ga0207686_10930074 3300025934 Unclassified 703
287 Ga0207709_10100398 3300025935 Bacteria 1912
288 Ga0207709_10112844 3300025935 Bacteria 1821
289 Ga0207670_10084188 3300025936 Bacteria 2232
290 Ga0207704_10730131 3300025938 Bacteria 822
291 Ga0207665_10005462 3300025939 Bacteria 8482
292 Ga0207691_10065571 3300025940 Bacteria 3286
293 Ga0207691_10271174 3300025940 Bacteria 1461
294 Ga0207711_10263951 3300025941 Bacteria 1583
295 Ga0207711_10297232 3300025941 Unclassified 1489
296 Ga0207689_10010181 3300025942 Bacteria 8102
297 Ga0207689_10447057 3300025942 Unclassified 1080
298 Ga0207712_10115120 3300025961 Bacteria 2024
299 Ga0207712_10177398 3300025961 Bacteria 1671
300 Ga0207712_10187688 3300025961 Bacteria 1629
301 Ga0207712_10440149 3300025961 Unclassified 1103
302 Ga0207712_10487885 3300025961 Bacteria 1051
303 Ga0207668_10402829 3300025972 Bacteria 1157
304 Ga0207640_10317828 3300025981 Unclassified 1238
305 Ga0207658_10250741 3300025986 Bacteria 1504
306 Ga0207658_10651789 3300025986 Bacteria 949
307 Ga0207703_10168626 3300026035 Bacteria 1924
308 Ga0207703_10965107 3300026035 Bacteria 817
309 Ga0207708_10279552 3300026075 Unclassified 1352
310 Ga0207702_10127253 3300026078 Bacteria 2289
311 Ga0207641_10692086 3300026088 Bacteria 1003
312 Ga0207648_10143226 3300026089 Bacteria 2108
313 Ga0207648_10177827 3300026089 Bacteria 1882
314 Ga0207648_10214639 3300026089 Bacteria 1709
315 Ga0207676_10601218 3300026095 Bacteria 1056
316 Ga0207676_11436019 3300026095 Bacteria 686
317 Ga0207674_10056448 3300026116 Bacteria 3987
318 Ga0207675_100006990 3300026118 Bacteria 10673
319 Ga0207675_100368777 3300026118 Bacteria 1410
320 Ga0207675_100660699 3300026118 Bacteria 1052
321 Ga0209973_1016300 3300027252 Bacteria 946
322 Ga0209973_1023723 3300027252 Bacteria 831
323 Ga0209981_1001706 3300027378 Bacteria 2782
324 Ga0209995_1005285 3300027471 Bacteria 2074
325 Ga0209968_1006292 3300027526 Bacteria 1787
326 Ga0209999_1003752 3300027543 Bacteria 2723
327 Ga0209983_1001578 3300027665 Bacteria 5049
328 Ga0209588_1004429 3300027671 Bacteria 3958
329 Ga0209971_1000086 3300027682 Bacteria 28580
330 Ga0209971_1091401 3300027682 Bacteria 743
331 Ga0209966_1000159 3300027695 Bacteria 28434
332 Ga0209966_1004412 3300027695 Bacteria 2384
333 Ga0209998_10000025 3300027717 Bacteria 63698
334 Ga0209998_10053919 3300027717 Bacteria 936
335 Ga0209974_10002937 3300027876 Bacteria 6184
336 Ga0207428_10003561 3300027907 Bacteria 15047
337 Ga0207428_10007174 3300027907 Bacteria 10189
338 Ga0207428_10008615 3300027907 Bacteria 9209
339 Ga0207428_10088353 3300027907 Bacteria 2410
340 Ga0207428_10192156 3300027907 Bacteria 1538
341 Ga0268266_10397679 3300028379 Bacteria 1302
342 Ga0268265_10091852 3300028380 Bacteria 2428
343 Ga0268265_10190782 3300028380 Bacteria 1769
344 Ga0268265_10213673 3300028380 Bacteria 1683
345 Ga0265340_10141190 3300031247 Bacteria 1102
346 Ga0307408_100037686 3300031548 Bacteria 3406
347 Ga0307408_100069225 3300031548 Bacteria 2602
348 Ga0307408_100176027 3300031548 Bacteria 1712
349 Ga0307408_100340493 3300031548 Bacteria 1269
350 Ga0307408_100708454 3300031548 Unclassified 905
351 Ga0307405_10051645 3300031731 Bacteria 2552
352 Ga0307405_10066726 3300031731 Bacteria 2295
353 Ga0307405_11394689 3300031731 Unclassified 612
354 Ga0307413_10062950 3300031824 Bacteria 2298
355 Ga0307406_10022349 3300031901 Bacteria 3751
356 Ga0307406_11036168 3300031901 Bacteria 706
357 Ga0307407_10037396 3300031903 Bacteria 2681
358 Ga0307407_10530132 3300031903 Bacteria 867
359 Ga0307412_10014555 3300031911 Bacteria 4643
360 Ga0307409_100018049 3300031995 Bacteria 4726
361 Ga0307409_100051879 3300031995 Bacteria 3141
362 Ga0307409_100438726 3300031995 Bacteria 1257
363 Ga0307416_100010762 3300032002 Bacteria 6060
364 Ga0307416_100013384 3300032002 Bacteria 5573
365 Ga0307416_100260906 3300032002 Bacteria 1693
366 Ga0307416_100341565 3300032002 Bacteria 1510
367 Ga0307416_100666768 3300032002 Unclassified 1126
368 Ga0307416_101146924 3300032002 Bacteria 882
369 Ga0307411_10063089 3300032005 Bacteria 2475
370 Ga0307411_10191263 3300032005 Bacteria 1563
371 Ga0307411_10247845 3300032005 Bacteria 1399
372 Ga0307411_10306219 3300032005 Bacteria 1276
373 Ga0307415_100002350 3300032126 Bacteria 9403
374 Ga0307415_100016067 3300032126 Bacteria 4449
375 Ga0307415_100020058 3300032126 Bacteria 4072
376 Ga0307415_100807280 3300032126 Bacteria 857
377 Ga0373959_0041106 3300034820 Unclassified 970
378 Ga0373938_0060010 3300034957 Bacteria 888
379 Ga0373951_0023687 3300035091 Unclassified 1419
380 Ga0373962_0032445 3300035242 Bacteria 1437
381 Ga0373931_0004718 3300035691 Bacteria 6245
382 Ga0373931_0030414 3300035691 Bacteria 2780
383 Ga0373931_1008580 3300035691 Bacteria 564
384 Ga0373935_0759957 3300035692 Bacteria 714
385 Ga0373927_0044475 3300035695 Bacteria 2873
386 Ga0395900_0006424 3300037418 Bacteria 12251
387 Ga0395900_0043674 3300037418 Bacteria 4620
388 Ga0395900_0314909 3300037418 Bacteria 1547
389 Ga0395900_0524444 3300037418 Bacteria 1132
390 Ga0395898_0027941 3300037466 Bacteria 5658
391 Ga0395898_1294969 3300037466 Bacteria 658
392 Ga0395905_0074719 3300037471 Bacteria 3177
393 Ga0395901_0400623 3300038443 Bacteria 1410
394 Ga0242420_003631 3300038996 Bacteria 2288
395 Ga0242420_015431 3300038996 Bacteria 1321
396 Ga0436360_0371304 3300039438 Bacteria 739
397 Ga0436361_0311917 3300039447 Bacteria 3811
398 Ga0436361_0824920 3300039447 Viruses 944
399 Ga0436363_0721721 3300039450 Bacteria 1323
400 Ga0436362_0731238 3300039453 Bacteria 902
401 Ga0439439_0122896 3300041406 Bacteria 725
402 Ga0439443_004230 3300042003 Bacteria 1857
403 Ga0439448_0018455 3300042005 Bacteria 2138
404 Ga0439448_0027000 3300042005 Bacteria 1808
405 Ga0439450_001039 3300042008 Bacteria 3911
406 Ga0439450_009361 3300042008 Bacteria 1858
407 Ga0439456_084961 3300042013 Unclassified 708
408 Ga0439463_034297 3300042016 Bacteria 1284
409 Ga0439463_072105 3300042016 Unclassified 885
410 Ga0450922_005047 3300042124 Bacteria 1219
411 Ga0450900_043678 3300042136 Bacteria 675
412 Ga0439458_0025493 3300042157 Bacteria 1388
413 Ga0439458_0184514 3300042157 Bacteria 567
414 Ga0439435_0040939 3300042436 Bacteria 1296
415 Ga0439444_0007403 3300042437 Bacteria 1684
416 Ga0439464_0019267 3300042439 Bacteria 1862
417 Ga0439464_0021841 3300042439 Bacteria 1758
418 Ga0439464_0051038 3300042439 Bacteria 1196
419 Ga0439460_0003521 3300042461 Bacteria 3787
420 Ga0450893_0045953 3300042532 Bacteria 809
421 Ga0451577_0024310 3300042876 Bacteria 5512
422 Ga0451577_0038516 3300042876 Bacteria 4301
423 Ga0451577_0415437 3300042876 Bacteria 1221
424 Ga0439440_0018994 3300042993 Bacteria 1528
425 Ga0439440_0020036 3300042993 Bacteria 1497
426 Ga0453683_0003814 3300044673 Bacteria 10968
427 Ga0453683_0020419 3300044673 Bacteria 4233
428 Ga0453683_0023298 3300044673 Bacteria 3947
429 Ga0453684_0030167 3300044712 Bacteria 7668
430 Ga0453684_0144846 3300044712 Bacteria 2831
431 Ga0453684_1215027 3300044712 Unclassified 791
432 Ga0451576_0061992 3300045051 Bacteria 3899
433 Ga0451576_0139132 3300045051 Bacteria 2532
434 Ga0451576_0208021 3300045051 Bacteria 2043
435 Ga0451576_0666082 3300045051 Bacteria 1093
436 Ga0495603_0185256 3300046455 Bacteria 1204
437 Ga0495584_0436053 3300046491 Bacteria 666
438 Ga0495663_0007917 3300046525 Bacteria 2938
439 Ga0495642_0015821 3300046528 Bacteria 2937
440 Ga0495642_0047293 3300046528 Bacteria 1762
441 Ga0495598_0055454 3300046537 Bacteria 1207
442 Ga0495621_0031870 3300046539 Bacteria 1811
443 Ga0495656_0002492 3300046615 Bacteria 6123
444 Ga0495656_0100328 3300046615 Bacteria 1338
445 Ga0495668_0118667 3300046616 Bacteria 1447
446 Ga0495589_0119602 3300046794 Bacteria 1269
447 Ga0495636_0373686 3300047318 Bacteria 676
448 Ga0495615_0027462 3300048090 Bacteria 1336
449 Ga0496102_0007903 3300048905 Bacteria 9091
450 Ga0496102_0534780 3300048905 Bacteria 1095
451 Ga0496102_0949291 3300048905 Bacteria 781
452 Ga0496108_0191014 3300048911 Bacteria 1775
453 Ga0496108_1122912 3300048911 Bacteria 667
454 Ga0496109_0165207 3300048912 Bacteria 2075
455 Ga0496109_0482247 3300048912 Bacteria 1171
456 Ga0496110_0044005 3300048913 Bacteria 3899
457 Ga0496110_1592184 3300048913 Unclassified 563
458 Ga0496111_0529948 3300048914 Bacteria 866
459 Ga0496114_0704794 3300048917 Bacteria 885
460 Ga0501031_0002154 3300049568 Bacteria 12423
461 Ga0501033_0019653 3300049570 Bacteria 5105
462 Ga0501036_0002244 3300049572 Bacteria 15098
463 Ga0501036_0078571 3300049572 Bacteria 2791
464 Ga0501036_0293255 3300049572 Bacteria 1361
465 Ga0501036_1085895 3300049572 Bacteria 654
466 Ga0501037_0065066 3300049573 Bacteria 2657
467 Ga0501038_0001978 3300049574 Bacteria 18930
468 Ga0501038_0112287 3300049574 Bacteria 2256
469 Ga0501038_0179221 3300049574 Bacteria 1711
470 Ga0501038_0541369 3300049574 Archaea 886
471 Ga0501039_0007573 3300049575 Bacteria 8293
472 Ga0501039_0009933 3300049575 Bacteria 7258
473 Ga0501039_0230390 3300049575 Bacteria 1456
474 Ga0501039_0546214 3300049575 Bacteria 909
475 Ga0501039_0843615 3300049575 Bacteria 714
476 Ga0501040_0003789 3300049576 Bacteria 9808
477 Ga0501040_0012388 3300049576 Bacteria 5586
478 Ga0501040_0119333 3300049576 Bacteria 1850
479 Ga0501040_0340492 3300049576 Bacteria 1074
480 Ga0501041_0000162 3300049577 Bacteria 29844
481 Ga0501041_0002997 3300049577 Bacteria 9681
482 Ga0501041_0152185 3300049577 Bacteria 1445
483 Ga0501041_0188627 3300049577 Bacteria 1291
484 Ga0501042_0000967 3300049578 Bacteria 16232
485 Ga0501042_0023379 3300049578 Bacteria 4325
486 Ga0501042_0329440 3300049578 Bacteria 1104
487 Ga0501042_0534334 3300049578 Bacteria 852
488 Ga0501042_1136795 3300049578 Bacteria 569
489 Ga0501043_0011157 3300049579 Bacteria 7037
490 Ga0501046_0001555 3300049580 Bacteria 21904
491 Ga0501046_0009547 3300049580 Bacteria 8378
492 Ga0501046_0109568 3300049580 Bacteria 2111
493 Ga0501046_0123144 3300049580 Bacteria 1972
494 Ga0501047_0007515 3300049581 Bacteria 10257
495 Ga0501048_0000372 3300049582 Bacteria 31090
496 Ga0501048_0000666 3300049582 Bacteria 24840
497 Ga0501048_0536918 3300049582 Bacteria 839
498 Ga0501048_0604890 3300049582 Bacteria 787
499 Ga0501048_0612426 3300049582 Bacteria 782
500 Ga0501048_1111506 3300049582 Unclassified 569
501 Ga0501068_0023985 3300049584 Bacteria 3579
502 Ga0501068_0027628 3300049584 Bacteria 3351
503 Ga0501068_0116148 3300049584 Bacteria 1667
504 Ga0501068_0607373 3300049584 Unclassified 713
505 Ga0501068_0643337 3300049584 Unclassified 692
506 Ga0501069_0300276 3300049585 Unclassified 942
507 Ga0501070_0199197 3300049586 Bacteria 1645
508 Ga0501070_0333599 3300049586 Bacteria 1232
509 Ga0501071_0000563 3300049587 Bacteria 19135
510 Ga0501071_0056813 3300049587 Bacteria 2828
511 Ga0501071_0382774 3300049587 Bacteria 1073
512 Ga0501071_0660284 3300049587 Unclassified 805
513 Ga0501072_0001594 3300049588 Bacteria 16954
514 Ga0501072_0025291 3300049588 Bacteria 4625
515 Ga0501072_0057909 3300049588 Bacteria 3054
516 Ga0501072_0073680 3300049588 Bacteria 2699
517 Ga0501072_0149015 3300049588 Bacteria 1865
518 Ga0501072_0345975 3300049588 Bacteria 1181
519 Ga0501072_0624805 3300049588 Unclassified 849
520 Ga0501073_0826338 3300049589 Unclassified 638
521 Ga0501074_0001088 3300049590 Bacteria 17731
522 Ga0501074_0007731 3300049590 Bacteria 7785
523 Ga0501074_0076811 3300049590 Unclassified 2397
524 Ga0501074_0243217 3300049590 Bacteria 1280
525 Ga0501074_0869240 3300049590 Bacteria 635
526 Ga0501075_0002091 3300049591 Bacteria 13201
527 Ga0501075_0024672 3300049591 Bacteria 4413
528 Ga0501075_0168081 3300049591 Bacteria 1673
529 Ga0501075_0178349 3300049591 Bacteria 1621
530 Ga0501075_0237523 3300049591 Unclassified 1389
531 Ga0501076_0000307 3300049592 Bacteria 30633
532 Ga0501076_0005167 3300049592 Bacteria 9348
533 Ga0501076_0006304 3300049592 Bacteria 8597
534 Ga0501076_0006750 3300049592 Bacteria 8329
535 Ga0501076_0010385 3300049592 Bacteria 6910
536 Ga0501076_0356484 3300049592 Bacteria 1201
537 Ga0501076_0362532 3300049592 Bacteria 1190
538 Ga0501077_0007697 3300049593 Bacteria 6648
539 Ga0501077_0011959 3300049593 Bacteria 5429
540 Ga0501077_0030710 3300049593 Bacteria 3419
541 Ga0501077_0031851 3300049593 Bacteria 3355
542 Ga0501077_0037156 3300049593 Bacteria 3103
543 Ga0501077_0151034 3300049593 Bacteria 1474
544 Ga0501077_0213885 3300049593 Bacteria 1225
545 Ga0501077_0408188 3300049593 Archaea 868
546 Ga0501079_0000457 3300049741 Bacteria 26796
547 Ga0501079_0001157 3300049741 Bacteria 18453
548 Ga0501079_0015025 3300049741 Bacteria 5902
549 Ga0501079_0110927 3300049741 Bacteria 2131
550 Ga0501080_0006353 3300049742 Bacteria 10601
551 Ga0501080_0110553 3300049742 Bacteria 2547
552 Ga0501080_0115648 3300049742 Bacteria 2487
553 Ga0501081_0000462 3300049743 Bacteria 22540
554 Ga0501081_0004539 3300049743 Bacteria 8913
555 Ga0501081_0032494 3300049743 Bacteria 3540
556 Ga0501081_0032564 3300049743 Bacteria 3536
557 Ga0501081_0054888 3300049743 Bacteria 2753
558 Ga0501081_0144025 3300049743 Archaea 1709
559 Ga0501081_0151763 3300049743 Bacteria 1665
560 Ga0501081_0216312 3300049743 Bacteria 1393
561 Ga0501081_0444434 3300049743 Unclassified 963
562 Ga0501083_0009083 3300049744 Bacteria 7020
563 Ga0501083_0036862 3300049744 Bacteria 3333
564 Ga0501083_0287815 3300049744 Bacteria 1069
565 Ga0501035_0016481 3300049822 Bacteria 6814
566 Ga0501035_0082571 3300049822 Bacteria 2836
567 Ga0501035_0275593 3300049822 Unclassified 1423
568 Ga0501035_1034220 3300049822 Bacteria 644
569 Ga0501044_0189832 3300049823 Bacteria 2018
570 Ga0501045_0000116 3300049824 Bacteria 40786
571 Ga0501045_0000181 3300049824 Bacteria 35044
572 Ga0501045_0086350 3300049824 Bacteria 2316
573 Ga0501045_0091024 3300049824 Bacteria 2254
574 Ga0501045_0237681 3300049824 Bacteria 1356
575 Ga0501045_0307735 3300049824 Bacteria 1179
576 Ga0501045_0374134 3300049824 Unclassified 1060
577 Ga0501045_0451264 3300049824 Bacteria 956
578 nmdc:mga05p37_1081756_c1 3300050507 Bacteria 842
579 nmdc:mga05p37_1199_c1 3300050507 Bacteria 29983
580 nmdc:mga05p37_13526_c1 3300050507 Bacteria 9782
581 nmdc:mga05p37_203547_c1 3300050507 Bacteria 2396
582 nmdc:mga05p37_234621_c1 3300050507 Bacteria 2209
583 nmdc:mga05p37_239287_c1 3300050507 Bacteria 2184
584 nmdc:mga05p37_26122_c1 3300050507 Bacteria 7101
585 nmdc:mga05p37_31915_c1 3300050507 Bacteria 6438
586 nmdc:mga05p37_387164_c1 3300050507 Bacteria 1636
587 nmdc:mga05p37_413177_c1 3300050507 Bacteria 1572
588 nmdc:mga05p37_4708_c1 3300050507 Bacteria 15935
589 nmdc:mga05p37_565184_c1 3300050507 Bacteria 1291
590 nmdc:mga05p37_59432_c1 3300050507 Bacteria 4708
591 nmdc:mga05p37_6557_c1 3300050507 Bacteria 13718
592 nmdc:mga05p37_7161_c1 3300050507 Bacteria 6867
593 nmdc:mga05p37_783_c1 3300050507 Bacteria 35363
594 nmdc:mga09592_19506_c1 3300050508 Bacteria 5569
595 nmdc:mga09592_21636_c1 3300050508 Bacteria 5301
596 nmdc:mga09592_3254_c1 3300050508 Bacteria 13146
597 nmdc:mga09592_336339_c1 3300050508 Unclassified 1307
598 nmdc:mga09592_55793_c1 3300050508 Bacteria 3338
599 nmdc:mga09592_62674_c1 3300050508 Bacteria 1961
600 nmdc:mga09592_9626_c1 3300050508 Bacteria 7851
601 nmdc:mga0qj67_10866_c1 3300050509 Bacteria 6809
602 nmdc:mga0qj67_15682_c1 3300050509 Bacteria 5740
603 nmdc:mga0qj67_177381_c1 3300050509 Bacteria 1730
604 nmdc:mga0qj67_409425_c1 3300050509 Unclassified 1094
605 nmdc:mga0qj67_4757_c1 3300050509 Bacteria 9865
606 nmdc:mga0qj67_78950_c1 3300050509 Bacteria 2635
607 nmdc:mga0qj67_9657_c1 3300050509 Bacteria 7191
608 nmdc:mga06r32_1103_c1 3300050510 Bacteria 24208
609 nmdc:mga06r32_124009_c1 3300050510 Bacteria 2550
610 nmdc:mga06r32_15600_c1 3300050510 Bacteria 6902
611 nmdc:mga06r32_1561_c1 3300050510 Bacteria 20670
612 nmdc:mga06r32_208233_c1 3300050510 Bacteria 1944
613 nmdc:mga06r32_226319_c1 3300050510 Bacteria 1859
614 nmdc:mga06r32_281077_c1 3300050510 Bacteria 1651
615 nmdc:mga06r32_289996_c1 3300050510 Bacteria 1623
616 nmdc:mga06r32_53677_c1 3300050510 Bacteria 3862
617 nmdc:mga06r32_8266_c1 3300050510 Bacteria 9367
618 nmdc:mga08y16_16120_c1 3300050511 Bacteria 7859
619 nmdc:mga08y16_244452_c1 3300050511 Bacteria 1855
620 nmdc:mga08y16_24631_c1 3300050511 Bacteria 6352
621 nmdc:mga08y16_441662_c1 3300050511 Bacteria 1328
622 nmdc:mga08y16_779026_c1 3300050511 Bacteria 951
623 nmdc:mga0n895_10405_c1 3300050512 Bacteria 8214
624 nmdc:mga0n895_1195835_c1 3300050512 Unclassified 734
625 nmdc:mga0n895_14226_c1 3300050512 Bacteria 7217
626 nmdc:mga0n895_1884560_c1 3300050512 Unclassified 557
627 nmdc:mga0n895_280348_c1 3300050512 Bacteria 1690
628 nmdc:mga0n895_850_c1 3300050512 Bacteria 21950
629 nmdc:mga0rr50_171691_c1 3300050513 Bacteria 1767
630 nmdc:mga0rr50_275275_c1 3300050513 Bacteria 1404
631 nmdc:mga0rr50_3850_c1 3300050513 Bacteria 8721
632 nmdc:mga0rr50_49690_c1 3300050513 Bacteria 3106
633 nmdc:mga08x19_3779_c1 3300050514 Bacteria 9007
634 nmdc:mga0a205_1030517_c1 3300050515 Unclassified 670
635 nmdc:mga0a205_11616_c1 3300050515 Bacteria 8116
636 nmdc:mga0a205_1270032_c1 3300050515 Bacteria 584
637 nmdc:mga0a205_15730_c1 3300050515 Bacteria 7072
638 nmdc:mga0a205_185605_c1 3300050515 Bacteria 1973
639 nmdc:mga0a205_2289_c1 3300050515 Bacteria 16890
640 nmdc:mga0a205_2402_c1 3300050515 Bacteria 16528
641 nmdc:mga0a205_2646_c1 3300050515 Bacteria 4866
642 nmdc:mga0a205_346655_c1 3300050515 Bacteria 1353
643 nmdc:mga0a205_56713_c1 3300050515 Bacteria 3782
644 Ga0495612_0237827 3300053078 Bacteria 809
645 Ga0500552_000761 3300053733 Bacteria 3001
646 Ga0501084_0001554 3300054114 Bacteria 18235
647 Ga0501084_0005963 3300054114 Bacteria 10029
648 Ga0501084_0012131 3300054114 Bacteria 7133
649 Ga0501084_0043160 3300054114 Bacteria 3772
650 Ga0501084_0253659 3300054114 Bacteria 1485
651 Ga0501084_0344782 3300054114 Bacteria 1258
652 Ga0590071_007535 3300059421 Bacteria 2576
653 Ga0590074_001878 3300059423 Bacteria 3424
654 Ga0590074_006378 3300059423 Bacteria 1958
655 Ga0590075_004351 3300059424 Bacteria 3353
656 Ga0590075_021655 3300059424 Bacteria 1606
657 Ga0590077_004179 3300059426 Bacteria 2975
658 Ga0590077_058472 3300059426 Bacteria 872
659 Ga0501082_0000316 3300060353 Bacteria 43097
660 Ga0501082_0003085 3300060353 Bacteria 14531
661 Ga0501082_0033762 3300060353 Bacteria 4413
662 Ga0501082_0088542 3300060353 Bacteria 2671
663 Ga0501082_0223741 3300060353 Bacteria 1637
664 Ga0501082_0271092 3300060353 Bacteria 1477
665 Ga0501082_0807146 3300060353 Bacteria 821
666 Ga0530510_0000623 3300061734 Bacteria 22839
667 Ga0530510_0019795 3300061734 Bacteria 4783
668 Ga0530510_0020260 3300061734 Bacteria 4729
669 Ga0530510_0021493 3300061734 Bacteria 4590
670 Ga0530510_0026412 3300061734 Bacteria 4156
671 Ga0530510_0054445 3300061734 Bacteria 2891
672 Ga0530510_0171567 3300061734 Unclassified 1607
673 Ga0530510_0372785 3300061734 Bacteria 1074
674 Ga0070669_100125439
675 JGI25406J46586_10028461
676 rootL2_10179812
677 JGI26129J50193_1002562
678 JGI25407J50210_10006920
679 JGI25407J50210_10043584
680 JGI25407J50210_10048456
681 JGI25407J50210_10093668
682 Ga0065707_10031532
683 Ga0070676_10100525
684 Ga0070690_100311445
685 Ga0068869_100007399
686 Ga0070689_100363341
687 Ga0070689_100555301
688 Ga0070691_10027357
689 Ga0070691_10069198
690 Ga0070687_100041533
691 Ga0070668_100132865
692 Ga0070668_100676605
693 Ga0070669_100125210
694 Ga0070669_100248473
695 Ga0070669_100740086
696 Ga0070674_100273842
697 Ga0070703_10009471
698 Ga0070709_11017557
699 Ga0070701_10104977
700 Ga0070711_100774868
701 Ga0070705_100087601
702 Ga0070705_100168725
703 Ga0070694_100003890
704 Ga0070694_100029173
705 Ga0070708_100024413
706 Ga0070708_100049457
707 Ga0070708_100050792
708 Ga0070708_100278984
709 Ga0070708_100695931
710 Ga0070708_100796027
711 Ga0070708_101242056
712 Ga0070662_100059946
713 Ga0070662_100107716
714 Ga0070662_100506186
715 Ga0070681_10106442
716 Ga0068867_100169151
717 Ga0070706_100016134
718 Ga0070706_100079641
719 Ga0070706_100466797
720 Ga0070706_100494656
721 Ga0070706_100689179
722 Ga0070707_100023243
723 Ga0070707_100035167
724 Ga0070707_100048016
725 Ga0070707_100076461
726 Ga0070707_100084933
727 Ga0070698_100006689
728 Ga0070698_100021105
729 Ga0070698_100062598
730 Ga0070698_100328858
731 Ga0070698_100704531
732 Ga0070698_101519971
733 Ga0070699_100001831
734 Ga0070699_100002198
735 Ga0070699_100039267
736 Ga0070699_101803653
737 Ga0070679_100099573
738 Ga0070697_100001953
739 Ga0070697_100036110
740 Ga0070697_100043898
741 Ga0070697_100212671
742 Ga0070697_100236461
743 Ga0070697_100548093
744 Ga0070697_100613746
745 Ga0070697_101292878
746 Ga0068853_100378803
747 Ga0070672_100036667
748 Ga0070686_100131074
749 Ga0070695_100000460
750 Ga0070695_100012869
751 Ga0070695_100015255
752 Ga0070695_100026306
753 Ga0070695_100283258
754 Ga0070696_100062549
755 Ga0070696_100093306
756 Ga0070696_100260155
757 Ga0070696_100514092
758 Ga0070696_100521022
759 Ga0070693_100022435
760 Ga0070665_100423974
761 Ga0070704_100052788
762 Ga0070704_100330886
763 Ga0070704_100677265
764 Ga0068854_100303293
765 Ga0068856_100165420
766 Ga0070702_100312252
767 Ga0068859_100110747
768 Ga0068859_100212622
769 Ga0068859_100515782
770 Ga0068864_100153424
771 Ga0068864_101643256
772 Ga0068861_100056462
773 Ga0068861_100345766
774 Ga0068861_100541973
775 Ga0068863_100731486
776 Ga0068858_100451341
777 Ga0068860_100078574
778 Ga0068860_100338722
779 Ga0068860_100348275
780 Ga0068860_100368703
781 Ga0068862_100016565
782 Ga0068862_100117927
783 Ga0068862_100594266
784 Ga0068862_101126406
785 Ga0081455_10001543
786 Ga0081455_10008533
787 Ga0081455_10053578
788 Ga0081455_10189691
789 Ga0081538_10002247
790 Ga0081538_10003897
791 Ga0081538_10008193
792 Ga0081538_10112891
793 Ga0081539_10000259
794 Ga0081539_10035888
795 Ga0075432_10004633
796 Ga0075432_10082206
797 Ga0075432_10112972
798 Ga0070715_10284789
799 Ga0070715_10336202
800 Ga0070712_100002240
801 Ga0097621_101552497
802 Ga0075428_100003902
803 Ga0075428_100007156
804 Ga0075428_100008036
805 Ga0075428_100012139
806 Ga0075428_100030165
807 Ga0075428_100051729
808 Ga0075428_100302101
809 Ga0075428_100394885
810 Ga0075428_100483830
811 Ga0075428_100914080
812 Ga0075430_100002663
813 Ga0075430_100006099
814 Ga0075430_100007190
815 Ga0075430_100011494
816 Ga0075430_100050602
817 Ga0075430_100051408
818 Ga0075430_100064480
819 Ga0075430_100187453
820 Ga0075430_100209856
821 Ga0075430_100845808
822 Ga0075430_101217574
823 Ga0075431_100001116
824 Ga0075431_100001256
825 Ga0075431_100004648
826 Ga0075431_100006340
827 Ga0075431_100006591
828 Ga0075431_100007489
829 Ga0075431_100008892
830 Ga0075431_100011272
831 Ga0075431_100017905
832 Ga0075431_100018519
833 Ga0075431_100034777
834 Ga0075431_100295658
835 Ga0075433_10000669
836 Ga0075433_10002922
837 Ga0075433_10004598
838 Ga0075433_10040844
839 Ga0075433_10063656
840 Ga0075433_10068646
841 Ga0075433_10212140
842 Ga0075433_10492936
843 Ga0075433_10928762
844 Ga0075434_100011017
845 Ga0075434_100032110
846 Ga0075434_100314096
847 Ga0075434_100404112
848 Ga0075434_100721810
849 Ga0075429_100004679
850 Ga0075429_100007015
851 Ga0075429_100009683
852 Ga0075429_100012342
853 Ga0075429_100038696
854 Ga0075429_100078428
855 Ga0075429_100411103
856 Ga0075429_100415934
857 Ga0068865_100803660
858 Ga0075436_100001627
859 Ga0097620_100110740
860 Ga0097620_100212628
861 Ga0097620_100515781
862 Ga0075435_100008223
863 Ga0075435_100067112
864 Ga0099794_10041399
865 Ga0099794_10070826
866 Ga0105251_10280813
867 Ga0105250_10090266
868 Ga0111539_10009885
869 Ga0111539_10059305
870 Ga0111539_10211583
871 Ga0111539_10345166
872 Ga0111539_11210027
873 Ga0105245_10526696
874 Ga0105245_11350496
875 Ga0105247_10045418
876 Ga0114129_10003693
877 Ga0114129_10007696
878 Ga0114129_10008727
879 Ga0114129_10019112
880 Ga0114129_10029945
881 Ga0114129_10030216
882 Ga0114129_10043420
883 Ga0114129_10051540
884 Ga0114129_10056336
885 Ga0114129_10181504
886 Ga0114129_10231921
887 Ga0114129_10253125
888 Ga0114129_10330026
889 Ga0114129_10516126
890 Ga0114129_10555162
891 Ga0114129_10916497
892 Ga0114129_11968981
893 Ga0105243_10199566
894 Ga0105243_11081837
895 Ga0105243_11669631
896 Ga0105241_10368347
897 Ga0105241_10559985
898 Ga0105242_10527536
899 Ga0105248_10095113
900 Ga0105248_10733297
901 Ga0105249_10013418
902 Ga0105249_10177492
903 Ga0105249_10290314
904 Ga0105249_10340540
905 Ga0105249_10481396
906 Ga0105249_10521171
907 Ga0105249_10571382
908 Ga0105239_11197862
909 Ga0105239_11316227
910 Ga0105239_11570596
911 Ga0157371_10074606
912 Ga0157369_11228610
913 Ga0163162_10354361
914 Ga0163162_10529467
915 Ga0163162_10618706
916 Ga0157375_11257353
917 Ga0157375_11955601
918 Ga0157380_11236385
919 Ga0157379_10110911
920 Ga0157379_10156624
921 Ga0163161_10399478
922 Ga0213872_10216440
923 Ga0207653_10163952
924 Ga0207692_10342927
925 Ga0207642_10252085
926 Ga0207685_10047104
927 Ga0207699_10065682
928 Ga0207645_10111374
929 Ga0207684_10000960
930 Ga0207684_10004629
931 Ga0207684_10008063
932 Ga0207684_10040611
933 Ga0207684_10045073
934 Ga0207684_10524557
935 Ga0207654_10212515
936 Ga0207707_10084959
937 Ga0207707_10542502
938 Ga0207695_10215593
939 Ga0207693_10012863
940 Ga0207693_10213266
941 Ga0207662_10054713
942 Ga0207646_10002161
943 Ga0207646_10022655
944 Ga0207646_10046243
945 Ga0207646_10141929
946 Ga0207646_10203358
947 Ga0207646_10211030
948 Ga0207646_10438101
949 Ga0207681_10090036
950 Ga0207681_10162889
951 Ga0207681_10191227
952 Ga0207681_10318557
953 Ga0207681_10931593
954 Ga0207687_10100190
955 Ga0207644_10660289
956 Ga0207706_10010308
957 Ga0207706_10132553
958 Ga0207706_10725009
959 Ga0207686_10930074
960 Ga0207709_10100398
961 Ga0207709_10112844
962 Ga0207670_10084188
963 Ga0207704_10730131
964 Ga0207665_10005462
965 Ga0207691_10065571
966 Ga0207691_10271174
967 Ga0207711_10263951
968 Ga0207711_10297232
969 Ga0207689_10010181
970 Ga0207689_10447057
971 Ga0207712_10115120
972 Ga0207712_10177398
973 Ga0207712_10187688
974 Ga0207712_10440149
975 Ga0207712_10487885
976 Ga0207668_10402829
977 Ga0207640_10317828
978 Ga0207658_10250741
979 Ga0207658_10651789
980 Ga0207703_10168626
981 Ga0207703_10965107
982 Ga0207708_10279552
983 Ga0207702_10127253
984 Ga0207641_10692086
985 Ga0207648_10143226
986 Ga0207648_10177827
987 Ga0207648_10214639
988 Ga0207676_10601218
989 Ga0207676_11436019
990 Ga0207674_10056448
991 Ga0207675_100006990
992 Ga0207675_100368777
993 Ga0207675_100660699
994 Ga0209973_1016300
995 Ga0209973_1023723
996 Ga0209981_1001706
997 Ga0209995_1005285
998 Ga0209968_1006292
999 Ga0209999_1003752
1000 Ga0209983_1001578
1001 Ga0209588_1004429
1002 Ga0209971_1000086
1003 Ga0209971_1091401
1004 Ga0209966_1000159
1005 Ga0209966_1004412
1006 Ga0209998_10000025
1007 Ga0209998_10053919
1008 Ga0209974_10002937
1009 Ga0207428_10003561
1010 Ga0207428_10007174
1011 Ga0207428_10008615
1012 Ga0207428_10088353
1013 Ga0207428_10192156
1014 Ga0268266_10397679
1015 Ga0268265_10091852
1016 Ga0268265_10190782
1017 Ga0268265_10213673
1018 Ga0265340_10141190
1019 Ga0307408_100037686
1020 Ga0307408_100069225
1021 Ga0307408_100176027
1022 Ga0307408_100340493
1023 Ga0307408_100708454
1024 Ga0307405_10051645
1025 Ga0307405_10066726
1026 Ga0307405_11394689
1027 Ga0307413_10062950
1028 Ga0307406_10022349
1029 Ga0307406_11036168
1030 Ga0307407_10037396
1031 Ga0307407_10530132
1032 Ga0307412_10014555
1033 Ga0307409_100018049
1034 Ga0307409_100051879
1035 Ga0307409_100438726
1036 Ga0307416_100010762
1037 Ga0307416_100013384
1038 Ga0307416_100260906
1039 Ga0307416_100341565
1040 Ga0307416_100666768
1041 Ga0307416_101146924
1042 Ga0307411_10063089
1043 Ga0307411_10191263
1044 Ga0307411_10247845
1045 Ga0307411_10306219
1046 Ga0307415_100002350
1047 Ga0307415_100016067
1048 Ga0307415_100020058
1049 Ga0307415_100807280
1050 Ga0373959_0041106
1051 Ga0373938_0060010
1052 Ga0373951_0023687
1053 Ga0373962_0032445
1054 Ga0373931_0004718
1055 Ga0373931_0030414
1056 Ga0373931_1008580
1057 Ga0373935_0759957
1058 Ga0373927_0044475
1059 Ga0395900_0006424
1060 Ga0395900_0043674
1061 Ga0395900_0314909
1062 Ga0395900_0524444
1063 Ga0395898_0027941
1064 Ga0395898_1294969
1065 Ga0395905_0074719
1066 Ga0395901_0400623
1067 Ga0242420_003631
1068 Ga0242420_015431
1069 Ga0436360_0371304
1070 Ga0436361_0311917
1071 Ga0436361_0824920
1072 Ga0436363_0721721
1073 Ga0436362_0731238
1074 Ga0439439_0122896
1075 Ga0439443_004230
1076 Ga0439448_0018455
1077 Ga0439448_0027000
1078 Ga0439450_001039
1079 Ga0439450_009361
1080 Ga0439456_084961
1081 Ga0439463_034297
1082 Ga0439463_072105
1083 Ga0450922_005047
1084 Ga0450900_043678
1085 Ga0439458_0025493
1086 Ga0439458_0184514
1087 Ga0439435_0040939
1088 Ga0439444_0007403
1089 Ga0439464_0019267
1090 Ga0439464_0021841
1091 Ga0439464_0051038
1092 Ga0439460_0003521
1093 Ga0450893_0045953
1094 Ga0451577_0024310
1095 Ga0451577_0038516
1096 Ga0451577_0415437
1097 Ga0439440_0018994
1098 Ga0439440_0020036
1099 Ga0453683_0003814
1100 Ga0453683_0020419
1101 Ga0453683_0023298
1102 Ga0453684_0030167
1103 Ga0453684_0144846
1104 Ga0453684_1215027
1105 Ga0451576_0061992
1106 Ga0451576_0139132
1107 Ga0451576_0208021
1108 Ga0451576_0666082
1109 Ga0495603_0185256
1110 Ga0495584_0436053
1111 Ga0495663_0007917
1112 Ga0495642_0015821
1113 Ga0495642_0047293
1114 Ga0495598_0055454
1115 Ga0495621_0031870
1116 Ga0495656_0002492
1117 Ga0495656_0100328
1118 Ga0495668_0118667
1119 Ga0495589_0119602
1120 Ga0495636_0373686
1121 Ga0495615_0027462
1122 Ga0496102_0007903
1123 Ga0496102_0534780
1124 Ga0496102_0949291
1125 Ga0496108_0191014
1126 Ga0496108_1122912
1127 Ga0496109_0165207
1128 Ga0496109_0482247
1129 Ga0496110_0044005
1130 Ga0496110_1592184
1131 Ga0496111_0529948
1132 Ga0496114_0704794
1133 Ga0501031_0002154
1134 Ga0501033_0019653
1135 Ga0501036_0002244
1136 Ga0501036_0078571
1137 Ga0501036_0293255
1138 Ga0501036_1085895
1139 Ga0501037_0065066
1140 Ga0501038_0001978
1141 Ga0501038_0112287
1142 Ga0501038_0179221
1143 Ga0501038_0541369
1144 Ga0501039_0007573
1145 Ga0501039_0009933
1146 Ga0501039_0230390
1147 Ga0501039_0546214
1148 Ga0501039_0843615
1149 Ga0501040_0003789
1150 Ga0501040_0012388
1151 Ga0501040_0119333
1152 Ga0501040_0340492
1153 Ga0501041_0000162
1154 Ga0501041_0002997
1155 Ga0501041_0152185
1156 Ga0501041_0188627
1157 Ga0501042_0000967
1158 Ga0501042_0023379
1159 Ga0501042_0329440
1160 Ga0501042_0534334
1161 Ga0501042_1136795
1162 Ga0501043_0011157
1163 Ga0501046_0001555
1164 Ga0501046_0009547
1165 Ga0501046_0109568
1166 Ga0501046_0123144
1167 Ga0501047_0007515
1168 Ga0501048_0000372
1169 Ga0501048_0000666
1170 Ga0501048_0536918
1171 Ga0501048_0604890
1172 Ga0501048_0612426
1173 Ga0501048_1111506
1174 Ga0501068_0023985
1175 Ga0501068_0027628
1176 Ga0501068_0116148
1177 Ga0501068_0607373
1178 Ga0501068_0643337
1179 Ga0501069_0300276
1180 Ga0501070_0199197
1181 Ga0501070_0333599
1182 Ga0501071_0000563
1183 Ga0501071_0056813
1184 Ga0501071_0382774
1185 Ga0501071_0660284
1186 Ga0501072_0001594
1187 Ga0501072_0025291
1188 Ga0501072_0057909
1189 Ga0501072_0073680
1190 Ga0501072_0149015
1191 Ga0501072_0345975
1192 Ga0501072_0624805
1193 Ga0501073_0826338
1194 Ga0501074_0001088
1195 Ga0501074_0007731
1196 Ga0501074_0076811
1197 Ga0501074_0243217
1198 Ga0501074_0869240
1199 Ga0501075_0002091
1200 Ga0501075_0024672
1201 Ga0501075_0168081
1202 Ga0501075_0178349
1203 Ga0501075_0237523
1204 Ga0501076_0000307
1205 Ga0501076_0005167
1206 Ga0501076_0006304
1207 Ga0501076_0006750
1208 Ga0501076_0010385
1209 Ga0501076_0356484
1210 Ga0501076_0362532
1211 Ga0501077_0007697
1212 Ga0501077_0011959
1213 Ga0501077_0030710
1214 Ga0501077_0031851
1215 Ga0501077_0037156
1216 Ga0501077_0151034
1217 Ga0501077_0213885
1218 Ga0501077_0408188
1219 Ga0501079_0000457
1220 Ga0501079_0001157
1221 Ga0501079_0015025
1222 Ga0501079_0110927
1223 Ga0501080_0006353
1224 Ga0501080_0110553
1225 Ga0501080_0115648
1226 Ga0501081_0000462
1227 Ga0501081_0004539
1228 Ga0501081_0032494
1229 Ga0501081_0032564
1230 Ga0501081_0054888
1231 Ga0501081_0144025
1232 Ga0501081_0151763
1233 Ga0501081_0216312
1234 Ga0501081_0444434
1235 Ga0501083_0009083
1236 Ga0501083_0036862
1237 Ga0501083_0287815
1238 Ga0501035_0016481
1239 Ga0501035_0082571
1240 Ga0501035_0275593
1241 Ga0501035_1034220
1242 Ga0501044_0189832
1243 Ga0501045_0000116
1244 Ga0501045_0000181
1245 Ga0501045_0086350
1246 Ga0501045_0091024
1247 Ga0501045_0237681
1248 Ga0501045_0307735
1249 Ga0501045_0374134
1250 Ga0501045_0451264
1251 nmdc:mga05p37_1081756_c1
1252 nmdc:mga05p37_1199_c1
1253 nmdc:mga05p37_13526_c1
1254 nmdc:mga05p37_203547_c1
1255 nmdc:mga05p37_234621_c1
1256 nmdc:mga05p37_239287_c1
1257 nmdc:mga05p37_26122_c1
1258 nmdc:mga05p37_31915_c1
1259 nmdc:mga05p37_387164_c1
1260 nmdc:mga05p37_413177_c1
1261 nmdc:mga05p37_4708_c1
1262 nmdc:mga05p37_565184_c1
1263 nmdc:mga05p37_59432_c1
1264 nmdc:mga05p37_6557_c1
1265 nmdc:mga05p37_7161_c1
1266 nmdc:mga05p37_783_c1
1267 nmdc:mga09592_19506_c1
1268 nmdc:mga09592_21636_c1
1269 nmdc:mga09592_3254_c1
1270 nmdc:mga09592_336339_c1
1271 nmdc:mga09592_55793_c1
1272 nmdc:mga09592_62674_c1
1273 nmdc:mga09592_9626_c1
1274 nmdc:mga0qj67_10866_c1
1275 nmdc:mga0qj67_15682_c1
1276 nmdc:mga0qj67_177381_c1
1277 nmdc:mga0qj67_409425_c1
1278 nmdc:mga0qj67_4757_c1
1279 nmdc:mga0qj67_78950_c1
1280 nmdc:mga0qj67_9657_c1
1281 nmdc:mga06r32_1103_c1
1282 nmdc:mga06r32_124009_c1
1283 nmdc:mga06r32_15600_c1
1284 nmdc:mga06r32_1561_c1
1285 nmdc:mga06r32_208233_c1
1286 nmdc:mga06r32_226319_c1
1287 nmdc:mga06r32_281077_c1
1288 nmdc:mga06r32_289996_c1
1289 nmdc:mga06r32_53677_c1
1290 nmdc:mga06r32_8266_c1
1291 nmdc:mga08y16_16120_c1
1292 nmdc:mga08y16_244452_c1
1293 nmdc:mga08y16_24631_c1
1294 nmdc:mga08y16_441662_c1
1295 nmdc:mga08y16_779026_c1
1296 nmdc:mga0n895_10405_c1
1297 nmdc:mga0n895_1195835_c1
1298 nmdc:mga0n895_14226_c1
1299 nmdc:mga0n895_1884560_c1
1300 nmdc:mga0n895_280348_c1
1301 nmdc:mga0n895_850_c1
1302 nmdc:mga0rr50_171691_c1
1303 nmdc:mga0rr50_275275_c1
1304 nmdc:mga0rr50_3850_c1
1305 nmdc:mga0rr50_49690_c1
1306 nmdc:mga08x19_3779_c1
1307 nmdc:mga0a205_1030517_c1
1308 nmdc:mga0a205_11616_c1
1309 nmdc:mga0a205_1270032_c1
1310 nmdc:mga0a205_15730_c1
1311 nmdc:mga0a205_185605_c1
1312 nmdc:mga0a205_2289_c1
1313 nmdc:mga0a205_2402_c1
1314 nmdc:mga0a205_2646_c1
1315 nmdc:mga0a205_346655_c1
1316 nmdc:mga0a205_56713_c1
1317 Ga0495612_0237827
1318 Ga0500552_000761
1319 Ga0501084_0001554
1320 Ga0501084_0005963
1321 Ga0501084_0012131
1322 Ga0501084_0043160
1323 Ga0501084_0253659
1324 Ga0501084_0344782
1325 Ga0590071_007535
1326 Ga0590074_001878
1327 Ga0590074_006378
1328 Ga0590075_004351
1329 Ga0590075_021655
1330 Ga0590077_004179
1331 Ga0590077_058472
1332 Ga0501082_0000316
1333 Ga0501082_0003085
1334 Ga0501082_0033762
1335 Ga0501082_0088542
1336 Ga0501082_0223741
1337 Ga0501082_0271092
1338 Ga0501082_0807146
1339 Ga0530510_0000623
1340 Ga0530510_0019795
1341 Ga0530510_0020260
1342 Ga0530510_0021493
1343 Ga0530510_0026412
1344 Ga0530510_0054445
1345 Ga0530510_0171567
1346 Ga0530510_0372785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m21-assembly1.cif.gz_C crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.9354 6 166
4zxa-assembly1.cif.gz_B crystal structure of hydroquinone 1,2-dioxygenase pnpcd in complex with cd2+ and 4-hydroxybenzonitrile 0.9212 6 166
5m21-assembly1.cif.gz_C crystal structure of hydroquinone 1,2-dioxygenase from sphingomonas sp. ttnp3 with 4-hydroxybenzoate bound 0.8984 6 166
3nl1-assembly1.cif.gz_A crystal structure of salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans adducts with gentisate 0.8912 55 150
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.8895 55 150
ID Description Score Start End Superfamily
3nvcA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8874 55 150 2.60.120.10
af_Q5U3F8_5_287_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8795 56 152 2.60.120.10
1zx5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8477 51 151 2.60.120.10
af_P02858_394_558_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8302 55 153 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8249 49 152 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2G4J352-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9832 32 166 GO:0051213
AF-A0A2G4J352-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.976 32 166 GO:0051213
AF-A0A1E1F8Y1-F1-model_v4 Hydroquinone dioxygenase small subunit 0.9337 6 166 GO:0051213
AF-A0A6L8EH21-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9315 6 166 GO:0051213
AF-A0A3N8LUD3-F1-model_v4 Hydroxyquinol 1,2-dioxygenase 0.9264 6 166 GO:0051213

Map