F474258

General Info

Members Datasets Scaffolds Average Seq Length
672 449 556 410

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0213367|Ga0496115_0213367_30_1214
Length 394
Sequence MLSGAAYAQETVKIGYIDPLSGGGASVGEGGLKTFQYLADELNAKGGILGHKVEILPLDNKTNPQESLIQAQKAIDAGAHYITQGNGSSVGAALADFVTKHNTRNPGKEVLYFNYAAVDPSMTNEKCSFWHFRWDANSDIKMEALTNYMKDHESIKKVYQDYSFGQSVRTQARKMLGDKRPDVQIVGDELHPLLKITDFSPYIAKIKASGADSVVTGNWGQDFALLLKAAADAGLKVNWYTYYAGGAGGPTAIKQTNLDHQVFQISEGIPNSDNPAAMEFEKAFRAKVGLSLWYPRAVNEMRMFKAAAEKANSIDPVKVAAALEDLKFDVLDGGSGVMRKDDHQFLQPIYISSFGARSEKEPFDEENTGWGWRLVAKVDTPQTVLPTTCKMTRP

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
6 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
7 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
8 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
9 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
10 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
11 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
12 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2643221651 Afipia sp. Root123D2 Isolate Unclassified
15 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
16 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
17 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
18 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
19 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
20 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
27 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
28 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
29 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
30 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
31 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
32 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
33 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
34 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
35 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
36 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
37 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
38 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
39 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
40 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
41 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
42 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
43 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
44 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
45 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
46 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
47 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
48 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
49 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
50 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
51 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
52 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
53 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
54 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
55 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
56 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
57 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
58 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
59 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
60 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
61 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
62 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
63 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
64 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
65 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
66 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
67 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
68 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
69 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
70 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
71 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
72 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
73 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
74 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
75 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
76 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
77 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
78 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
79 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
80 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
81 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
82 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
83 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
84 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
85 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
86 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
87 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
88 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
89 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
90 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
91 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
92 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
93 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
94 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
95 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
96 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
97 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
98 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
99 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
100 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
101 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
103 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
104 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
105 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
109 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
110 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
111 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
112 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
113 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
116 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
117 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
118 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
119 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
120 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
121 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
122 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
123 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
124 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
125 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
126 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
127 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
128 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
129 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
130 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
131 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
132 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
133 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
134 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
135 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
136 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
137 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
138 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
139 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
140 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
141 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
142 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
143 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
144 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
145 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
146 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
147 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
148 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
149 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
150 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
155 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
156 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
157 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
158 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
159 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
160 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
161 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
162 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
163 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
164 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
165 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
166 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
167 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
168 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
169 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
170 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
171 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
175 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
176 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
177 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
178 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
179 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
180 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
181 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
182 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
183 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
184 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
185 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
186 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
187 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
188 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
189 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
190 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
191 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
192 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
193 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
194 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
195 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
196 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
197 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
198 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
199 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
200 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
201 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
202 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
206 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
209 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
250 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
251 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
252 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
258 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
259 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
260 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
261 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
262 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
263 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
264 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
265 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
266 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
267 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
268 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
269 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
273 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
274 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
275 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
276 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
277 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
283 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
284 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
285 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
286 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
287 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
288 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
289 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
290 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
291 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
292 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
293 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
294 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
295 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
296 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
297 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
298 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
299 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
300 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
303 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
304 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
305 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
306 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
307 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
308 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
313 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
325 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
326 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
327 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
332 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
333 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
334 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
335 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
336 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
337 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
338 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
339 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
340 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
341 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
342 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
343 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
344 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
348 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
349 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
350 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
351 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
352 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
353 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
354 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
355 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
359 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
360 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
361 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
362 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
379 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
380 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
383 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
393 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
394 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
395 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
396 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
397 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
398 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
399 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
400 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
401 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
402 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
403 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
404 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
405 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
406 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
407 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
408 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
409 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
410 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
411 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
412 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
413 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
414 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
415 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
416 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
417 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
418 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
419 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
420 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
421 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
422 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
423 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
424 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
425 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
426 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
429 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
430 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
431 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
432 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
433 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
435 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
436 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
437 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
438 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
439 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
440 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
441 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
442 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
443 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
444 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
445 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
446 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
447 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
448 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
449 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.81
Metatranscriptomes 0.3
Isolates 16.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.78
Nodule 12.8
Rhizoplane 9.38
Rhizosphere 58.33
Stem 0
Stem Tuber 0
Unclassified 10.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10008041 3300002077 Bacteria 2177
2 JGI24742J22300_10000509 3300002244 Bacteria 5791
3 JGI25406J46586_10000014 3300003203 Bacteria 93855
4 JGI25153J46596_10038702 3300003215 Bacteria 1499
5 JGI25160J50197_1001954 3300003354 Bacteria 9837
6 JGI25160J50197_1011003 3300003354 Bacteria 3237
7 Ga0007429J51699_1095660 3300003579 Bacteria 1383
8 JGI25404J52841_10000057 3300003659 Bacteria 9569
9 Ga0065165_1000054 3300005262 Bacteria 187351
10 Ga0065165_1003837 3300005262 Bacteria 10008
11 Ga0065704_10110842 3300005289 Bacteria 1971
12 Ga0065707_10004110 3300005295 Bacteria 5458
13 Ga0070658_10039816 3300005327 Bacteria 3792
14 Ga0070658_10055874 3300005327 Bacteria 3208
15 Ga0070676_10008312 3300005328 Bacteria 5591
16 Ga0070676_10032947 3300005328 Bacteria 2971
17 Ga0070690_100002327 3300005330 Bacteria 10210
18 Ga0070680_100093318 3300005336 Bacteria 2494
19 Ga0070660_100041577 3300005339 Bacteria 3504
20 Ga0070660_100091512 3300005339 Bacteria 2399
21 Ga0070661_100116406 3300005344 Bacteria 1999
22 Ga0070668_100015142 3300005347 Bacteria 5762
23 Ga0070669_100011384 3300005353 Bacteria 6316
24 Ga0070675_100090215 3300005354 Bacteria 2567
25 Ga0070674_100000485 3300005356 Bacteria 19967
26 Ga0070673_100028812 3300005364 Bacteria 4135
27 Ga0070659_100261343 3300005366 Bacteria 1436
28 Ga0070667_100081235 3300005367 Bacteria 2774
29 Ga0070714_100022799 3300005435 Bacteria 5136
30 Ga0070713_100128209 3300005436 Bacteria 2235
31 Ga0070710_10006621 3300005437 Bacteria 5571
32 Ga0070701_10035060 3300005438 Bacteria 2518
33 Ga0070700_100003300 3300005441 Bacteria 8321
34 Ga0070700_100033409 3300005441 Bacteria 3098
35 Ga0070663_100023267 3300005455 Bacteria 4150
36 Ga0070663_100051334 3300005455 Bacteria 2937
37 Ga0070678_100060893 3300005456 Bacteria 2780
38 Ga0070662_100022601 3300005457 Bacteria 4308
39 Ga0068867_100004714 3300005459 Bacteria 9597
40 Ga0070685_10014233 3300005466 Bacteria 4209
41 Ga0070707_100103748 3300005468 Bacteria 2756
42 Ga0070699_100022502 3300005518 Bacteria 5433
43 Ga0070679_100064934 3300005530 Bacteria 3638
44 Ga0070697_100102688 3300005536 Bacteria 2376
45 Ga0070672_100077955 3300005543 Bacteria 2651
46 Ga0070686_100006029 3300005544 Bacteria 6726
47 Ga0070695_100001037 3300005545 Bacteria 15205
48 Ga0070665_100007932 3300005548 Bacteria 10762
49 Ga0070704_100066334 3300005549 Bacteria 2602
50 Ga0068855_100080870 3300005563 Bacteria 3767
51 Ga0068855_100115745 3300005563 Bacteria 3073
52 Ga0070664_100058436 3300005564 Unclassified 3280
53 Ga0068854_100003638 3300005578 Bacteria 9648
54 Ga0068856_100000560 3300005614 Bacteria 40848
55 Ga0068856_100095555 3300005614 Bacteria 2960
56 Ga0070702_100021652 3300005615 Bacteria 3387
57 Ga0068852_100163403 3300005616 Bacteria 2081
58 Ga0068866_10002087 3300005718 Bacteria 8310
59 Ga0068861_100011596 3300005719 Bacteria 6132
60 Ga0068870_10085315 3300005840 Bacteria 1755
61 Ga0068858_100027398 3300005842 Bacteria 5294
62 Ga0068858_100193876 3300005842 Bacteria 1920
63 Ga0068860_100011821 3300005843 Bacteria 8603
64 Ga0068862_100016806 3300005844 Bacteria 6092
65 Ga0068862_100018037 3300005844 Bacteria 5879
66 Ga0081455_10003143 3300005937 Bacteria 19203
67 Ga0081540_1000370 3300005983 Bacteria 45002
68 Ga0081540_1000371 3300005983 Bacteria 44977
69 Ga0081540_1015080 3300005983 Bacteria 4904
70 Ga0081539_10000008 3300005985 Bacteria 525071
71 Ga0070717_10040726 3300006028 Bacteria 3785
72 Ga0070717_10152489 3300006028 Unclassified 2000
73 Ga0070715_10040732 3300006163 Bacteria 1943
74 Ga0070716_100024268 3300006173 Bacteria 3226
75 Ga0070712_100012336 3300006175 Bacteria 5431
76 Ga0070712_100126315 3300006175 Bacteria 1932
77 Ga0075428_100002097 3300006844 Bacteria 21505
78 Ga0075428_100069782 3300006844 Bacteria 3841
79 Ga0075431_100000059 3300006847 Bacteria 61740
80 Ga0075433_10002766 3300006852 Bacteria 13422
81 Ga0075434_100002045 3300006871 Bacteria 17515
82 Ga0075429_100001315 3300006880 Bacteria 20255
83 Ga0068865_100003839 3300006881 Bacteria 9010
84 Ga0075436_100015484 3300006914 Bacteria 5221
85 Ga0099824_1016218 3300006942 Bacteria 6814
86 Ga0099822_1007626 3300006943 Bacteria 13973
87 Ga0075435_100009873 3300007076 Bacteria 6947
88 Ga0075435_100084285 3300007076 Bacteria 2615
89 Ga0099794_10044444 3300007265 Bacteria 2123
90 Ga0099795_10026058 3300007788 Bacteria 1966
91 Ga0105240_10080600 3300009093 Bacteria 4003
92 Ga0111539_10001296 3300009094 Bacteria 33381
93 Ga0111539_10027399 3300009094 Bacteria 6960
94 Ga0111539_10124052 3300009094 Bacteria 3027
95 Ga0111539_10146002 3300009094 Bacteria 2770
96 Ga0105245_10031810 3300009098 Bacteria 4672
97 Ga0105245_10073745 3300009098 Bacteria 3104
98 Ga0114129_10001483 3300009147 Bacteria 31789
99 Ga0105243_10258730 3300009148 Bacteria 1557
100 Ga0105241_10059531 3300009174 Bacteria 2937
101 Ga0105242_10031596 3300009176 Bacteria 4231
102 Ga0105242_10095018 3300009176 Bacteria 2516
103 Ga0105248_10422605 3300009177 Bacteria 1501
104 Ga0105238_10102762 3300009551 Bacteria 2839
105 Ga0105238_10182664 3300009551 Bacteria 2074
106 Ga0105238_10184941 3300009551 Bacteria 2060
107 Ga0105249_10001730 3300009553 Bacteria 19091
108 Ga0105249_10018210 3300009553 Bacteria 6243
109 Ga0105249_10227807 3300009553 Bacteria 1837
110 Ga0099796_10025130 3300010159 Bacteria 1877
111 Ga0105239_10056173 3300010375 Bacteria 4318
112 Ga0105239_10088243 3300010375 Bacteria 3420
113 Ga0157373_10096779 3300013100 Bacteria 2078
114 Ga0157373_10136218 3300013100 Bacteria 1726
115 Ga0157371_10076826 3300013102 Bacteria 2365
116 Ga0157370_10025911 3300013104 Bacteria 5797
117 Ga0157374_10378168 3300013296 Bacteria 1410
118 Ga0157378_10008838 3300013297 Bacteria 8766
119 Ga0163162_10009472 3300013306 Bacteria 9469
120 Ga0163162_10031313 3300013306 Bacteria 5276
121 Ga0157375_10459051 3300013308 Bacteria 1439
122 Ga0163163_10008715 3300014325 Bacteria 9022
123 Ga0163163_10064017 3300014325 Unclassified 3648
124 Ga0163163_10066025 3300014325 Bacteria 3593
125 Ga0163163_10109568 3300014325 Bacteria 2789
126 Ga0163163_10254404 3300014325 Bacteria 1807
127 Ga0157380_10104532 3300014326 Bacteria 2365
128 Ga0157379_10019649 3300014968 Bacteria 5969
129 Ga0157379_10139631 3300014968 Bacteria 2184
130 Ga0157376_10015348 3300014969 Bacteria 5784
131 Ga0157376_10125653 3300014969 Bacteria 2281
132 Ga0163161_10001515 3300017792 Bacteria 17196
133 Ga0214544_1014838 3300021320 Bacteria 8469
134 Ga0214542_1014570 3300021321 Bacteria 8700
135 Ga0214545_1014326 3300021324 Bacteria 9276
136 Ga0214543_1015412 3300021327 Bacteria 8466
137 Ga0213873_10015801 3300021358 Bacteria 1698
138 Ga0213875_10045581 3300021388 Bacteria 2058
139 Ga0209563_101910 3300025230 Bacteria 5038
140 Ga0209677_101648 3300025253 Bacteria 9393
141 Ga0209677_103715 3300025253 Bacteria 4776
142 Ga0209148_1008198 3300025254 Bacteria 2113
143 Ga0209233_1000794 3300025261 Bacteria 14173
144 Ga0209233_1002869 3300025261 Bacteria 6174
145 Ga0209233_1009444 3300025261 Bacteria 2968
146 Ga0209455_1002569 3300025272 Bacteria 6929
147 Ga0209455_1008997 3300025272 Bacteria 2658
148 Ga0209564_1014386 3300025295 Bacteria 3296
149 Ga0209758_1009026 3300025297 Bacteria 6301
150 Ga0209758_1010412 3300025297 Bacteria 5567
151 Ga0209758_1022843 3300025297 Bacteria 2851
152 Ga0209758_1033486 3300025297 Bacteria 2061
153 Ga0207426_1002185 3300025302 Bacteria 13211
154 Ga0207426_1004331 3300025302 Bacteria 6992
155 Ga0207426_1015910 3300025302 Bacteria 2716
156 Ga0207697_10005623 3300025315 Bacteria 5794
157 Ga0207647_10043910 3300025904 Bacteria 2794
158 Ga0207647_10068296 3300025904 Bacteria 2152
159 Ga0207685_10004384 3300025905 Bacteria 3581
160 Ga0207699_10023803 3300025906 Bacteria 3338
161 Ga0207645_10027154 3300025907 Bacteria 3698
162 Ga0207645_10042359 3300025907 Bacteria 2913
163 Ga0207705_10071624 3300025909 Bacteria 2513
164 Ga0207705_10087565 3300025909 Bacteria 2277
165 Ga0207654_10110763 3300025911 Bacteria 1708
166 Ga0207695_10062132 3300025913 Bacteria 3858
167 Ga0207671_10126548 3300025914 Bacteria 1958
168 Ga0207693_10001764 3300025915 Bacteria 18977
169 Ga0207663_10003842 3300025916 Bacteria 7414
170 Ga0207663_10006336 3300025916 Bacteria 6047
171 Ga0207663_10032363 3300025916 Bacteria 3103
172 Ga0207657_10012891 3300025919 Bacteria 8220
173 Ga0207657_10041949 3300025919 Bacteria 4041
174 Ga0207652_10259920 3300025921 Bacteria 1566
175 Ga0207681_10021473 3300025923 Bacteria 4104
176 Ga0207694_10280679 3300025924 Bacteria 1368
177 Ga0207650_10051893 3300025925 Bacteria 3036
178 Ga0207687_10056044 3300025927 Bacteria 2764
179 Ga0207700_10093042 3300025928 Bacteria 2385
180 Ga0207700_10117579 3300025928 Bacteria 2150
181 Ga0207664_10045707 3300025929 Bacteria 3434
182 Ga0207664_10047126 3300025929 Bacteria 3385
183 Ga0207706_10001763 3300025933 Bacteria 21239
184 Ga0207706_10114790 3300025933 Bacteria 2369
185 Ga0207686_10048052 3300025934 Bacteria 2641
186 Ga0207709_10006083 3300025935 Bacteria 6803
187 Ga0207669_10006404 3300025937 Bacteria 5378
188 Ga0207704_10009774 3300025938 Bacteria 4645
189 Ga0207665_10012045 3300025939 Bacteria 5677
190 Ga0207665_10220773 3300025939 Bacteria 1389
191 Ga0207691_10011336 3300025940 Bacteria 8555
192 Ga0207691_10075120 3300025940 Bacteria 3048
193 Ga0207711_10048746 3300025941 Bacteria 3624
194 Ga0207651_10008687 3300025960 Bacteria 5505
195 Ga0207651_10016646 3300025960 Bacteria 4315
196 Ga0207712_10037133 3300025961 Bacteria 3322
197 Ga0207712_10148937 3300025961 Bacteria 1806
198 Ga0207668_10002534 3300025972 Bacteria 10671
199 Ga0207640_10008142 3300025981 Bacteria 5807
200 Ga0207703_10176745 3300026035 Bacteria 1881
201 Ga0207678_10004912 3300026067 Bacteria 12012
202 Ga0207678_10037942 3300026067 Bacteria 4188
203 Ga0207708_10004920 3300026075 Bacteria 9851
204 Ga0207702_10000101 3300026078 Bacteria 99845
205 Ga0207702_10151066 3300026078 Bacteria 2113
206 Ga0207702_10162401 3300026078 Bacteria 2041
207 Ga0207648_10006487 3300026089 Bacteria 11621
208 Ga0207648_10271244 3300026089 Bacteria 1516
209 Ga0207675_100054595 3300026118 Bacteria 3727
210 Ga0207683_10014299 3300026121 Bacteria 6761
211 Ga0207698_10016038 3300026142 Bacteria 5038
212 Ga0207698_10112487 3300026142 Bacteria 2285
213 Ga0209589_1000005 3300027357 Bacteria 530958
214 Ga0209489_100005 3300027361 Bacteria 530958
215 Ga0209700_100006 3300027363 Bacteria 530958
216 Ga0209588_1040481 3300027671 Bacteria 1504
217 Ga0207428_10020197 3300027907 Bacteria 5663
218 Ga0207428_10075775 3300027907 Bacteria 2636
219 Ga0268266_10109475 3300028379 Bacteria 2446
220 Ga0268265_10040171 3300028380 Bacteria 3453
221 Ga0268265_10056168 3300028380 Bacteria 2994
222 Ga0268264_10232828 3300028381 Bacteria 1702
223 Ga0265330_10043124 3300031235 Bacteria 1997
224 Ga0265340_10029973 3300031247 Bacteria 2730
225 Ga0265339_10008632 3300031249 Bacteria 6466
226 Ga0265316_10064870 3300031344 Bacteria 2829
227 Ga0307513_10169321 3300031456 Bacteria 2064
228 Ga0307408_100067541 3300031548 Bacteria 2630
229 Ga0265314_10013066 3300031711 Bacteria 6734
230 Ga0307510_10000928 3300033180 Bacteria 31078
231 Ga0315911_1000005 3300033442 Bacteria 426255
232 Ga0373934_0026456 3300035086 Bacteria 2251
233 Ga0373939_0041104 3300035114 Bacteria 1392
234 Ga0373956_0032329 3300035119 Bacteria 2295
235 Ga0373957_0006832 3300035120 Bacteria 3617
236 Ga0373955_0032409 3300035172 Bacteria 2742
237 Ga0373962_0015111 3300035242 Bacteria 1975
238 Ga0373931_0007660 3300035691 Bacteria 5093
239 Ga0373935_0001026 3300035692 Bacteria 15187
240 Ga0373927_0002601 3300035695 Bacteria 13156
241 Ga0373927_0006364 3300035695 Bacteria 8045
242 Ga0373947_0013236 3300035725 Bacteria 4728
243 Ga0373937_0060793 3300036401 Bacteria 3472
244 Ga0373937_0074985 3300036401 Bacteria 3123
245 Ga0373937_0201078 3300036401 Bacteria 1873
246 Ga0373937_0334996 3300036401 Bacteria 1432
247 Ga0373925_0021692 3300037068 Bacteria 4681
248 Ga0395900_0009417 3300037418 Bacteria 10014
249 Ga0395898_0010330 3300037466 Bacteria 9767
250 Ga0436364_0718622 3300037853 Bacteria 2862
251 Ga0436364_1447887 3300037853 Bacteria 2428
252 Ga0395901_0013474 3300038443 Bacteria 8313
253 Ga0436365_1039966 3300039437 Bacteria 3205
254 Ga0436360_0127194 3300039438 Bacteria 7015
255 Ga0436361_0171734 3300039447 Bacteria 7756
256 Ga0436361_0436460 3300039447 Bacteria 4680
257 Ga0436361_0516035 3300039447 Bacteria 1732
258 Ga0466965_0017517 3300044683 Bacteria 3425
259 Ga0466966_0012155 3300044684 Bacteria 5703
260 Ga0466961_0000528 3300044693 Bacteria 24250
261 Ga0466957_0070987 3300044842 Bacteria 2153
262 Ga0466959_0006894 3300045049 Bacteria 7931
263 Ga0466967_0066335 3300045976 Bacteria 3216
264 Ga0495592_0037547 3300046454 Bacteria 3647
265 Ga0495603_0001156 3300046455 Bacteria 15378
266 Ga0495629_0007329 3300046459 Bacteria 8129
267 Ga0495629_0020961 3300046459 Bacteria 4665
268 Ga0495629_0122769 3300046459 Bacteria 1809
269 Ga0495629_0208273 3300046459 Bacteria 1351
270 Ga0495638_0003384 3300046460 Bacteria 12564
271 Ga0495651_0005551 3300046462 Bacteria 9619
272 Ga0495651_0009663 3300046462 Bacteria 7417
273 Ga0495651_0074760 3300046462 Bacteria 2570
274 Ga0495653_0012628 3300046463 Bacteria 6899
275 Ga0495653_0066838 3300046463 Bacteria 2702
276 Ga0495582_0003642 3300046473 Bacteria 8675
277 Ga0495639_0001339 3300046475 Bacteria 11056
278 Ga0495662_0002101 3300046476 Bacteria 9986
279 Ga0495664_0014611 3300046477 Bacteria 4453
280 Ga0495664_0047664 3300046477 Bacteria 2543
281 Ga0495606_0001096 3300046507 Bacteria 38817
282 Ga0495610_0093762 3300046512 Bacteria 1356
283 Ga0495618_0017747 3300046514 Bacteria 4367
284 Ga0495618_0046041 3300046514 Bacteria 2753
285 Ga0495628_0166628 3300046516 Bacteria 1672
286 Ga0495630_0034020 3300046517 Bacteria 3802
287 Ga0495630_0064323 3300046517 Bacteria 2756
288 Ga0495630_0089315 3300046517 Bacteria 2328
289 Ga0495637_0045528 3300046520 Bacteria 1861
290 Ga0495643_0087506 3300046522 Bacteria 1612
291 Ga0495666_0037853 3300046526 Bacteria 2346
292 Ga0495652_0002553 3300046529 Bacteria 18651
293 Ga0495652_0019981 3300046529 Bacteria 5957
294 Ga0495665_0005946 3300046531 Bacteria 6572
295 Ga0495640_0042702 3300046533 Bacteria 3161
296 Ga0495587_0001810 3300046536 Bacteria 14259
297 Ga0495587_0016248 3300046536 Bacteria 4634
298 Ga0495587_0018343 3300046536 Bacteria 4340
299 Ga0495609_0057831 3300046538 Bacteria 1716
300 Ga0495645_0010090 3300046543 Bacteria 6617
301 Ga0495645_0044294 3300046543 Bacteria 3246
302 Ga0495645_0104685 3300046543 Bacteria 2009
303 Ga0495645_0110659 3300046543 Bacteria 1944
304 Ga0495622_0002979 3300046557 Bacteria 8050
305 Ga0495622_0027566 3300046557 Bacteria 2651
306 Ga0495622_0050711 3300046557 Bacteria 1925
307 Ga0495667_0158588 3300046559 Bacteria 1455
308 Ga0495656_0014767 3300046615 Bacteria 2935
309 Ga0495668_0028463 3300046616 Bacteria 3160
310 Ga0495634_0010428 3300046642 Bacteria 6808
311 Ga0495634_0013199 3300046642 Bacteria 5971
312 Ga0495634_0058285 3300046642 Bacteria 2574
313 Ga0495625_0026215 3300046660 Bacteria 4407
314 Ga0495635_0016026 3300046663 Bacteria 5234
315 Ga0495635_0017508 3300046663 Bacteria 5003
316 Ga0495635_0020906 3300046663 Bacteria 4560
317 Ga0495635_0055049 3300046663 Bacteria 2740
318 Ga0495635_0166509 3300046663 Bacteria 1500
319 Ga0495661_0111234 3300046665 Bacteria 1526
320 Ga0495588_0000856 3300046674 Bacteria 13487
321 Ga0495657_0006245 3300046675 Bacteria 9343
322 Ga0495657_0121133 3300046675 Bacteria 1647
323 Ga0495623_0024653 3300046679 Bacteria 3873
324 Ga0495623_0047849 3300046679 Bacteria 2714
325 Ga0495646_0008841 3300046680 Bacteria 6396
326 Ga0495646_0024264 3300046680 Bacteria 3819
327 Ga0495646_0114377 3300046680 Bacteria 1533
328 Ga0495646_0127115 3300046680 Bacteria 1437
329 Ga0495647_0023164 3300046681 Bacteria 2250
330 Ga0495669_0007372 3300046684 Bacteria 4611
331 Ga0495669_0072861 3300046684 Bacteria 1568
332 Ga0495613_0161163 3300046689 Bacteria 1596
333 Ga0495613_0165111 3300046689 Bacteria 1573
334 Ga0495624_0005387 3300046690 Bacteria 9229
335 Ga0495671_0035040 3300046692 Bacteria 2551
336 Ga0495649_0054242 3300046694 Bacteria 2168
337 Ga0495600_0006953 3300046809 Bacteria 6901
338 Ga0495600_0038790 3300046809 Bacteria 3101
339 Ga0495600_0060206 3300046809 Bacteria 2479
340 Ga0495581_0004974 3300047315 Bacteria 7692
341 Ga0495604_0005799 3300047317 Bacteria 9797
342 Ga0495604_0025841 3300047317 Bacteria 4676
343 Ga0495604_0036801 3300047317 Bacteria 3857
344 Ga0495604_0054723 3300047317 Bacteria 3078
345 Ga0495604_0083370 3300047317 Bacteria 2389
346 Ga0495604_0112144 3300047317 Bacteria 1987
347 Ga0495674_0003716 3300047319 Bacteria 14839
348 Ga0495674_0010575 3300047319 Bacteria 8734
349 Ga0495674_0015066 3300047319 Bacteria 7236
350 Ga0495674_0060065 3300047319 Bacteria 3318
351 Ga0495672_0044824 3300047320 Bacteria 2650
352 Ga0495672_0055278 3300047320 Bacteria 2317
353 Ga0495676_0016703 3300047321 Bacteria 6500
354 Ga0495676_0076004 3300047321 Bacteria 2566
355 Ga0495676_0095338 3300047321 Bacteria 2214
356 Ga0495680_0002657 3300047322 Bacteria 18096
357 Ga0495680_0028899 3300047322 Bacteria 4543
358 Ga0495680_0047336 3300047322 Bacteria 3383
359 Ga0495675_0112860 3300047444 Bacteria 1695
360 Ga0495684_0011768 3300047471 Bacteria 6751
361 Ga0495684_0091269 3300047471 Bacteria 2307
362 Ga0495686_0111169 3300047472 Bacteria 1643
363 Ga0495593_0004447 3300047673 Bacteria 8326
364 Ga0495593_0046164 3300047673 Bacteria 2323
365 Ga0495602_0004838 3300048088 Bacteria 14088
366 Ga0495602_0005315 3300048088 Bacteria 13515
367 Ga0495602_0039952 3300048088 Bacteria 4312
368 Ga0495602_0115252 3300048088 Bacteria 2174
369 Ga0496101_0028077 3300048904 Bacteria 3926
370 Ga0496101_0056378 3300048904 Bacteria 2841
371 Ga0496101_0177223 3300048904 Bacteria 1640
372 Ga0496102_0211291 3300048905 Bacteria 1829
373 Ga0496104_0006383 3300048907 Bacteria 10368
374 Ga0496104_0008771 3300048907 Bacteria 8990
375 Ga0496104_0009093 3300048907 Bacteria 8836
376 Ga0496104_0011052 3300048907 Bacteria 8078
377 Ga0496104_0016813 3300048907 Bacteria 6648
378 Ga0496104_0019057 3300048907 Bacteria 6270
379 Ga0496104_0019891 3300048907 Bacteria 6148
380 Ga0496104_0037785 3300048907 Bacteria 4514
381 Ga0496104_0101045 3300048907 Bacteria 2761
382 Ga0496104_0141974 3300048907 Bacteria 2307
383 Ga0496105_0004710 3300048908 Bacteria 10290
384 Ga0496105_0006043 3300048908 Bacteria 9260
385 Ga0496105_0029844 3300048908 Bacteria 4465
386 Ga0496105_0029961 3300048908 Bacteria 4456
387 Ga0496105_0052643 3300048908 Bacteria 3362
388 Ga0496105_0079787 3300048908 Bacteria 2703
389 Ga0496106_0063814 3300048909 Bacteria 2800
390 Ga0496107_0171948 3300048910 Bacteria 1608
391 Ga0496108_0000684 3300048911 Bacteria 26239
392 Ga0496108_0014365 3300048911 Bacteria 6465
393 Ga0496108_0022159 3300048911 Bacteria 5222
394 Ga0496108_0022357 3300048911 Bacteria 5199
395 Ga0496108_0023629 3300048911 Bacteria 5059
396 Ga0496108_0214454 3300048911 Bacteria 1671
397 Ga0496109_0003041 3300048912 Bacteria 13980
398 Ga0496109_0008138 3300048912 Bacteria 8891
399 Ga0496109_0020657 3300048912 Bacteria 5817
400 Ga0496109_0030071 3300048912 Bacteria 4867
401 Ga0496109_0033235 3300048912 Bacteria 4640
402 Ga0496110_0017354 3300048913 Bacteria 6020
403 Ga0496110_0018064 3300048913 Bacteria 5907
404 Ga0496110_0034774 3300048913 Bacteria 4368
405 Ga0496110_0058186 3300048913 Bacteria 3404
406 Ga0496110_0067116 3300048913 Bacteria 3173
407 Ga0496110_0087033 3300048913 Bacteria 2790
408 Ga0496111_0003992 3300048914 Bacteria 9258
409 Ga0496111_0016232 3300048914 Bacteria 5131
410 Ga0496111_0021209 3300048914 Bacteria 4533
411 Ga0496111_0060491 3300048914 Bacteria 2745
412 Ga0496111_0090142 3300048914 Unclassified 2246
413 Ga0496112_0000008 3300048915 Bacteria 310323
414 Ga0496112_0005031 3300048915 Bacteria 11350
415 Ga0496112_0009344 3300048915 Bacteria 8825
416 Ga0496112_0022886 3300048915 Bacteria 5961
417 Ga0496112_0025283 3300048915 Bacteria 5701
418 Ga0496112_0035694 3300048915 Bacteria 4846
419 Ga0496112_0068510 3300048915 Bacteria 3504
420 Ga0496113_0005682 3300048916 Bacteria 7813
421 Ga0496113_0007895 3300048916 Bacteria 6884
422 Ga0496113_0013688 3300048916 Bacteria 5508
423 Ga0496113_0035430 3300048916 Bacteria 3649
424 Ga0496113_0039673 3300048916 Bacteria 3467
425 Ga0496113_0058773 3300048916 Unclassified 2894
426 Ga0496115_0049809 3300048918 Bacteria 3354
427 Ga0496115_0083572 3300048918 Bacteria 2603
428 Ga0496115_0213367 3300048918 Bacteria 1594
429 Ga0496115_0263974 3300048918 Bacteria 1416
430 Ga0496116_0039775 3300048919 Bacteria 3246
431 Ga0496118_0011588 3300048921 Bacteria 8585
432 Ga0496118_0053761 3300048921 Bacteria 3057
433 Ga0496118_0057863 3300048921 Bacteria 2902
434 Ga0496118_0104305 3300048921 Bacteria 1904
435 Ga0496118_0142342 3300048921 Bacteria 1517
436 Ga0496119_0015262 3300048922 Bacteria 5933
437 Ga0496120_0016389 3300048923 Bacteria 4843
438 Ga0496121_0000774 3300048924 Bacteria 58528
439 Ga0496121_0001681 3300048924 Bacteria 36391
440 Ga0496121_0004204 3300048924 Bacteria 19648
441 Ga0496121_0031816 3300048924 Bacteria 4811
442 Ga0496121_0058085 3300048924 Bacteria 3201
443 Ga0496121_0084150 3300048924 Bacteria 2509
444 Ga0496121_0134213 3300048924 Bacteria 1846
445 Ga0496123_0081115 3300048926 Bacteria 1973
446 Ga0496124_0072981 3300048927 Bacteria 2841
447 Ga0496125_0000063 3300048928 Bacteria 250260
448 Ga0496125_0020683 3300048928 Bacteria 6171
449 Ga0496125_0021892 3300048928 Bacteria 5948
450 Ga0496125_0035456 3300048928 Bacteria 4374
451 Ga0496126_0003851 3300048929 Bacteria 18556
452 Ga0496126_0004139 3300048929 Bacteria 17539
453 Ga0496126_0017838 3300048929 Bacteria 7063
454 Ga0496126_0026816 3300048929 Bacteria 5516
455 Ga0496126_0046515 3300048929 Bacteria 3979
456 Ga0496126_0072722 3300048929 Bacteria 3058
457 Ga0496126_0134983 3300048929 Bacteria 2129
458 Ga0501031_0011778 3300049568 Bacteria 5705
459 Ga0501032_0000030 3300049569 Bacteria 130405
460 Ga0501032_0128828 3300049569 Bacteria 1670
461 Ga0501033_0000111 3300049570 Bacteria 78688
462 Ga0501034_0000072 3300049571 Bacteria 179824
463 Ga0501036_0000033 3300049572 Bacteria 88546
464 Ga0501036_0128260 3300049572 Bacteria 2142
465 Ga0501036_0139834 3300049572 Bacteria 2043
466 Ga0501037_0000090 3300049573 Bacteria 85021
467 Ga0501037_0018343 3300049573 Bacteria 5157
468 Ga0501038_0000060 3300049574 Bacteria 92314
469 Ga0501038_0044937 3300049574 Bacteria 3835
470 Ga0501039_0001633 3300049575 Bacteria 16530
471 Ga0501043_0000258 3300049579 Bacteria 48131
472 Ga0501043_0063609 3300049579 Bacteria 2897
473 Ga0501043_0136863 3300049579 Bacteria 1918
474 Ga0501046_0000078 3300049580 Bacteria 102826
475 Ga0501046_0028253 3300049580 Bacteria 4570
476 Ga0501047_0000140 3300049581 Bacteria 88265
477 Ga0501047_0035648 3300049581 Bacteria 4806
478 Ga0501067_0000150 3300049583 Bacteria 38434
479 Ga0501068_0000292 3300049584 Bacteria 24928
480 Ga0501070_0062674 3300049586 Bacteria 3080
481 Ga0501070_0080128 3300049586 Bacteria 2702
482 Ga0501072_0000476 3300049588 Bacteria 28786
483 Ga0501073_0000009 3300049589 Bacteria 195649
484 Ga0501074_0000100 3300049590 Bacteria 41920
485 Ga0501079_0002676 3300049741 Bacteria 12956
486 Ga0501080_0000088 3300049742 Bacteria 61753
487 Ga0501035_0000302 3300049822 Bacteria 58095
488 Ga0501035_0055116 3300049822 Bacteria 3550
489 Ga0501035_0207527 3300049822 Bacteria 1677
490 Ga0501035_0252120 3300049822 Bacteria 1498
491 Ga0501044_0000438 3300049823 Bacteria 51173
492 Ga0501044_0059192 3300049823 Bacteria 3926
493 Ga0501045_0002548 3300049824 Bacteria 12424
494 nmdc:mga0yw44_4052_c1 3300050492 Bacteria 6632
495 nmdc:mga0yw44_72733_c1 3300050492 Bacteria 2138
496 nmdc:mga07m45_56664_c1 3300050496 Bacteria 2215
497 nmdc:mga05p37_285_c1 3300050507 Bacteria 52916
498 nmdc:mga09592_664_c1 3300050508 Bacteria 24142
499 nmdc:mga0qj67_22598_c1 3300050509 Bacteria 4831
500 nmdc:mga0qj67_296904_c1 3300050509 Bacteria 1309
501 nmdc:mga06r32_118_c1 3300050510 Bacteria 56778
502 nmdc:mga08y16_28203_c1 3300050511 Bacteria 5918
503 nmdc:mga08y16_87820_c1 3300050511 Bacteria 3240
504 nmdc:mga08y16_89_c1 3300050511 Bacteria 76793
505 nmdc:mga0n895_361601_c1 3300050512 Bacteria 1469
506 nmdc:mga0n895_7091_c1 3300050512 Bacteria 9579
507 nmdc:mga0rr50_68429_c1 3300050513 Bacteria 2700
508 nmdc:mga08x19_35_c1 3300050514 Bacteria 185171
509 nmdc:mga0a205_17237_c1 3300050515 Bacteria 6766
510 Ga0495601_0075102 3300053077 Bacteria 2163
511 Ga0495601_0116640 3300053077 Bacteria 1732
512 Ga0495612_0002674 3300053078 Bacteria 7356
513 Ga0495612_0008890 3300053078 Bacteria 4070
514 Ga0495612_0009604 3300053078 Bacteria 3918
515 Ga0495595_0025822 3300053084 Bacteria 2605
516 Ga0495619_0001881 3300053085 Bacteria 13975
517 Ga0495619_0012259 3300053085 Bacteria 5393
518 Ga0495619_0014546 3300053085 Bacteria 4971
519 Ga0495619_0022363 3300053085 Bacteria 4046
520 Ga0500578_0075375 3300053086 Bacteria 2149
521 Ga0500581_067905 3300053089 Bacteria 1797
522 Ga0500646_0009652 3300053090 Bacteria 2470
523 Ga0500651_0107527 3300053093 Bacteria 1705
524 Ga0500566_0034377 3300053094 Bacteria 2949
525 Ga0500641_0043983 3300053096 Bacteria 1815
526 Ga0500650_0014918 3300053098 Bacteria 3299
527 Ga0500554_002276 3300053102 Bacteria 3753
528 Ga0500556_0001087 3300053104 Bacteria 13707
529 Ga0500562_035914 3300053108 Bacteria 1313
530 Ga0500572_000168 3300053111 Bacteria 22927
531 Ga0500595_001683 3300053119 Bacteria 11615
532 Ga0500595_006519 3300053119 Bacteria 4941
533 Ga0500595_011091 3300053119 Bacteria 3546
534 Ga0500595_023075 3300053119 Bacteria 2191
535 Ga0500642_0000026 3300053130 Bacteria 127731
536 Ga0500652_000882 3300053131 Bacteria 9939
537 Ga0500658_0016838 3300053134 Bacteria 2726
538 Ga0500559_0001562 3300053136 Bacteria 12815
539 Ga0500559_0002898 3300053136 Bacteria 8636
540 Ga0500568_0002271 3300053139 Bacteria 11457
541 Ga0500577_0000744 3300053142 Bacteria 8361
542 Ga0500588_0048594 3300053146 Bacteria 1313
543 Ga0500603_001339 3300053150 Bacteria 5643
544 Ga0500604_0001713 3300053151 Bacteria 6145
545 Ga0500616_0000031 3300053153 Bacteria 415013
546 Ga0500616_0000034 3300053153 Bacteria 396651
547 Ga0500622_0000112 3300053156 Bacteria 83558
548 Ga0500634_0040622 3300053161 Bacteria 2528
549 Ga0500639_029111 3300053163 Bacteria 2919
550 Ga0500636_0005679 3300053177 Bacteria 7134
551 Ga0500636_0041200 3300053177 Bacteria 2731
552 Ga0500637_0003548 3300053178 Bacteria 7231
553 Ga0500601_000034 3300053737 Bacteria 28953
554 Ga0501084_0005330 3300054114 Bacteria 10530
555 Ga0587072_009788 3300059643 Bacteria 1537
556 Ga0501082_0206809 3300060353 Bacteria 1708

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0090142 Ga0496111_0090142_1106_2191 361
2 3300048921 Ga0496118_0104305 Ga0496118_0104305_190_1290 364
3 3300046689 Ga0495613_0161163 Ga0495613_0161163_408_1577 370
4 3300014325 Ga0163163_10109568 Ga0163163_101095682 385
5 3300006943 Ga0099822_1007626 Ga0099822_100762614 386
6 3300048908 Ga0496105_0029844 Ga0496105_0029844_227_1558 388
7 3300048911 Ga0496108_0022159 Ga0496108_0022159_1209_2540 388
8 3300048912 Ga0496109_0033235 Ga0496109_0033235_234_1565 388
9 3300048913 Ga0496110_0087033 Ga0496110_0087033_556_1887 388
10 3300048914 Ga0496111_0016232 Ga0496111_0016232_3312_4643 388
11 3300048915 Ga0496112_0035694 Ga0496112_0035694_3063_4394 388
12 3300048916 Ga0496113_0039673 Ga0496113_0039673_970_2301 388
13 3300036401 Ga0373937_0074985 Ga0373937_0074985_1684_2862 392
14 3300025261 Ga0209233_1009444 Ga0209233_10094441 393
15 3300048918 Ga0496115_0213367 Ga0496115_0213367_30_1214 394
16 3300033442 Ga0315911_1000005 Ga0315911_1000005337 395
17 3300036401 Ga0373937_0334996 Ga0373937_0334996_214_1407 397
18 3300048929 Ga0496126_0072722 Ga0496126_0072722_1307_2590 397
19 3300053153 Ga0500616_0000034 Ga0500616_0000034_56618_57850 397
20 3300046507 Ga0495606_0001096 Ga0495606_0001096_37552_38748 398
21 3300047317 Ga0495604_0054723 Ga0495604_0054723_718_1959 399
22 3300048088 Ga0495602_0115252 Ga0495602_0115252_140_1381 399
23 3300049569 Ga0501032_0128828 Ga0501032_0128828_169_1413 399
24 3300049572 Ga0501036_0128260 Ga0501036_0128260_91_1335 399
25 3300049573 Ga0501037_0018343 Ga0501037_0018343_714_1916 399
26 3300049579 Ga0501043_0063609 Ga0501043_0063609_171_1415 399
27 3300049579 Ga0501043_0136863 Ga0501043_0136863_342_1544 399
28 3300049586 Ga0501070_0062674 Ga0501070_0062674_1271_2473 399
29 3300049822 Ga0501035_0055116 Ga0501035_0055116_1776_3020 399
30 3300036401 Ga0373937_0060793 Ga0373937_0060793_1041_2288 400
31 3300039437 Ga0436365_1039966 Ga0436365_1039966_155_1366 400
32 3300039447 Ga0436361_0516035 Ga0436361_0516035_513_1718 400
33 3300046454 Ga0495592_0037547 Ga0495592_0037547_2220_3467 400
34 3300046517 Ga0495630_0064323 Ga0495630_0064323_569_1816 400
35 3300046536 Ga0495587_0016248 Ga0495587_0016248_373_1620 400
36 3300046642 Ga0495634_0013199 Ga0495634_0013199_1130_2377 400
37 3300046663 Ga0495635_0016026 Ga0495635_0016026_2236_3483 400
38 3300046809 Ga0495600_0038790 Ga0495600_0038790_1556_2803 400
39 3300047317 Ga0495604_0005799 Ga0495604_0005799_5785_7032 400
40 3300047319 Ga0495674_0010575 Ga0495674_0010575_2530_3777 400
41 3300047321 Ga0495676_0076004 Ga0495676_0076004_745_1992 400
42 3300048088 Ga0495602_0004838 Ga0495602_0004838_5224_6471 400
43 3300053078 Ga0495612_0002674 Ga0495612_0002674_4250_5497 400
44 3300053085 Ga0495619_0001881 Ga0495619_0001881_6460_7707 400
45 3300005344 Ga0070661_100116406 Ga0070661_1001164062 401
46 3300006028 Ga0070717_10152489 Ga0070717_101524892 401
47 3300009177 Ga0105248_10422605 Ga0105248_104226051 401
48 3300014325 Ga0163163_10008715 Ga0163163_100087158 401
49 3300048904 Ga0496101_0056378 Ga0496101_0056378_171_1406 401
50 3300048907 Ga0496104_0011052 Ga0496104_0011052_5603_6838 401
51 3300048908 Ga0496105_0052643 Ga0496105_0052643_1544_2779 401
52 3300048911 Ga0496108_0023629 Ga0496108_0023629_2266_3501 401
53 3300048912 Ga0496109_0030071 Ga0496109_0030071_1968_3203 401
54 3300048913 Ga0496110_0067116 Ga0496110_0067116_762_1997 401
55 3300048916 Ga0496113_0058773 Ga0496113_0058773_270_1505 401
56 3300049823 Ga0501044_0059192 Ga0501044_0059192_603_1835 401
57 3300006942 Ga0099824_1016218 Ga0099824_10162185 402
58 3300027357 Ga0209589_1000005 Ga0209589_1000005352 402
59 3300027361 Ga0209489_100005 Ga0209489_100005352 402
60 3300027363 Ga0209700_100006 Ga0209700_100006352 402
61 3300053136 Ga0500559_0002898 Ga0500559_0002898_4565_5776 402
62 iso_pu_bacteria 2728368998 2728749161 402
63 3300005435 Ga0070714_100022799 Ga0070714_1000227994 403
64 3300005437 Ga0070710_10006621 Ga0070710_100066213 403
65 3300006028 Ga0070717_10040726 Ga0070717_100407262 403
66 3300006163 Ga0070715_10040732 Ga0070715_100407321 403
67 3300006173 Ga0070716_100024268 Ga0070716_1000242683 403
68 3300006175 Ga0070712_100012336 Ga0070712_1000123363 403
69 3300025905 Ga0207685_10004384 Ga0207685_100043841 403
70 3300025906 Ga0207699_10023803 Ga0207699_100238033 403
71 3300025915 Ga0207693_10001764 Ga0207693_1000176415 403
72 3300025916 Ga0207663_10006336 Ga0207663_100063365 403
73 3300025928 Ga0207700_10093042 Ga0207700_100930422 403
74 3300025929 Ga0207664_10047126 Ga0207664_100471262 403
75 3300025939 Ga0207665_10012045 Ga0207665_100120454 403
76 3300037853 Ga0436364_1447887 Ga0436364_1447887_113_1336 404
77 3300039438 Ga0436360_0127194 Ga0436360_0127194_1454_2677 404
78 3300046514 Ga0495618_0046041 Ga0495618_0046041_463_1725 404
79 3300046543 Ga0495645_0110659 Ga0495645_0110659_575_1837 404
80 3300047471 Ga0495684_0091269 Ga0495684_0091269_560_1822 404
81 3300048907 Ga0496104_0101045 Ga0496104_0101045_19_1245 404
82 3300048910 Ga0496107_0171948 Ga0496107_0171948_231_1448 404
83 3300048924 Ga0496121_0058085 Ga0496121_0058085_1938_3155 404
84 3300053077 Ga0495601_0075102 Ga0495601_0075102_760_2022 404
85 3300053078 Ga0495612_0009604 Ga0495612_0009604_399_1661 404
86 iso_pu_bacteria 2513237141 2513889590 404
87 iso_pu_bacteria 2841957949 2841959490 404
88 3300005366 Ga0070659_100261343 Ga0070659_1002613431 405
89 3300005530 Ga0070679_100064934 Ga0070679_1000649343 405
90 3300005563 Ga0068855_100080870 Ga0068855_1000808702 405
91 3300005842 Ga0068858_100193876 Ga0068858_1001938762 405
92 3300009098 Ga0105245_10073745 Ga0105245_100737453 405
93 3300009551 Ga0105238_10184941 Ga0105238_101849412 405
94 3300013100 Ga0157373_10136218 Ga0157373_101362182 405
95 3300014325 Ga0163163_10066025 Ga0163163_100660253 405
96 3300014969 Ga0157376_10125653 Ga0157376_101256532 405
97 3300025919 Ga0207657_10012891 Ga0207657_100128916 405
98 3300025921 Ga0207652_10259920 Ga0207652_102599201 405
99 3300025925 Ga0207650_10051893 Ga0207650_100518932 405
100 3300025933 Ga0207706_10114790 Ga0207706_101147902 405
101 3300025960 Ga0207651_10016646 Ga0207651_100166462 405
102 3300046522 Ga0495643_0087506 Ga0495643_0087506_324_1595 405
103 3300046543 Ga0495645_0104685 Ga0495645_0104685_189_1409 405
104 3300046679 Ga0495623_0047849 Ga0495623_0047849_240_1460 405
105 3300046680 Ga0495646_0114377 Ga0495646_0114377_147_1367 405
106 3300047317 Ga0495604_0112144 Ga0495604_0112144_626_1846 405
107 3300053119 Ga0500595_001683 Ga0500595_001683_8546_9766 405
108 iso_pu_bacteria 2508501128 2509149950 405
109 iso_pu_bacteria 2513237094 2513641448 405
110 iso_pu_bacteria 2513237096 2513655466 405
111 iso_pu_bacteria 2513237098 2513678534 405
112 iso_pu_bacteria 2513237137 2513859984 405
113 iso_pu_bacteria 2513237145 2513916456 405
114 iso_pu_bacteria 2517572143 2517889933 405
115 iso_pu_bacteria 2524023210 2524468842 405
116 iso_pu_bacteria 2524023228 2524535023 405
117 iso_pu_bacteria 2528768022 2528852185 405
118 iso_pu_bacteria 2602042107 2603861332 405
119 iso_pu_bacteria 2617270741 2617372525 405
120 iso_pu_bacteria 2643221651 2644287521 405
121 iso_pu_bacteria 2667528175 2671121039 405
122 iso_pu_bacteria 2791355197 2793068113 405
123 iso_pu_bacteria 2824600985 2824602043 405
124 iso_pu_bacteria 2824609381 2824610031 405
125 iso_pu_bacteria 2824617872 2824620287 405
126 iso_pu_bacteria 2824626560 2824629552 405
127 iso_pu_bacteria 2824635225 2824635872 405
128 iso_pu_bacteria 2824644064 2824646174 405
129 iso_pu_bacteria 2824653114 2824654887 405
130 iso_pu_bacteria 2824661429 2824665503 405
131 iso_pu_bacteria 2824704595 2824710823 405
132 iso_pu_bacteria 2824714736 2824721325 405
133 iso_pu_bacteria 2824723954 2824731300 405
134 iso_pu_bacteria 2824732956 2824738992 405
135 iso_pu_bacteria 2824746037 2824747045 405
136 iso_pu_bacteria 2824753945 2824757539 405
137 iso_pu_bacteria 2824763712 2824764129 405
138 iso_pu_bacteria 2849076700 2849077545 405
139 iso_pu_bacteria 2857509624 2857510161 405
140 iso_pu_bacteria 2857524615 2857530099 405
141 iso_pu_bacteria 2879099564 2879106235 405
142 iso_pu_bacteria 2881364244 2881365211 405
143 iso_pu_bacteria 2885374607 2885376530 405
144 iso_pu_bacteria 2885383462 2885387149 405
145 iso_pu_bacteria 2885409591 2885410679 405
146 iso_pu_bacteria 2888388044 2888392067 405
147 iso_pu_bacteria 2888419890 2888423224 405
148 iso_pu_bacteria 2893066018 2893071700 405
149 iso_pu_bacteria 2903748898 2903755358 405
150 iso_pu_bacteria 2903768456 2903772023 405
151 iso_pu_bacteria 2904711408 2904713356 405
152 iso_pu_bacteria 2906610324 2906612319 405
153 iso_pu_bacteria 2906635258 2906638344 405
154 iso_pu_bacteria 2906660503 2906663371 405
155 iso_pu_bacteria 2908739725 2908739805 405
156 iso_pu_bacteria 2908775508 2908780972 405
157 iso_pu_bacteria 2919073203 2919076895 405
158 iso_pu_bacteria 2922368715 2922376830 405
159 iso_pu_bacteria 2922425934 2922426980 405
160 iso_pu_bacteria 2929615660 2929621486 405
161 iso_pu_bacteria 2929624759 2929631699 405
162 iso_pu_bacteria 2932784394 2932790211 405
163 iso_pu_bacteria 2932794094 2932798723 405
164 iso_pu_bacteria 2932801729 2932806625 405
165 iso_pu_bacteria 2932809354 2932815883 405
166 iso_pu_bacteria 2932818245 2932824771 405
167 iso_pu_bacteria 2932828146 2932833330 405
168 iso_pu_bacteria 2933577622 2933583489 405
169 iso_pu_bacteria 2935616580 2935621395 405
170 iso_pu_bacteria 2935630451 2935633129 405
171 iso_pu_bacteria 2935638405 2935644745 405
172 iso_pu_bacteria 2935665750 2935672349 405
173 iso_pu_bacteria 2935675223 2935682788 405
174 iso_pu_bacteria 2935684952 2935693305 405
175 iso_pu_bacteria 2935694250 2935702193 405
176 iso_pu_bacteria 2935703347 2935710888 405
177 iso_pu_bacteria 2935713505 2935720906 405
178 iso_pu_bacteria 2935722832 2935730607 405
179 iso_pu_bacteria 2935732158 2935740628 405
180 iso_pu_bacteria 2935741537 2935749898 405
181 iso_pu_bacteria 2935750917 2935759282 405
182 iso_pu_bacteria 2935760218 2935767268 405
183 iso_pu_bacteria 2935801545 2935808838 405
184 iso_pu_bacteria 2935810662 2935817635 405
185 iso_pu_bacteria 2935827899 2935833995 405
186 iso_pu_bacteria 2935837841 2935845514 405
187 iso_pu_bacteria 2935855204 2935859412 405
188 iso_pu_bacteria 2935864058 2935869945 405
189 iso_pu_bacteria 2935873716 2935880907 405
190 iso_pu_bacteria 2935883170 2935889411 405
191 iso_pu_bacteria 2935959822 2935964730 405
192 iso_pu_bacteria 2935992306 2935998318 405
193 iso_pu_bacteria 2936002035 2936009219 405
194 iso_pu_bacteria 2936037263 2936044464 405
195 iso_pu_bacteria 2940556831 2940565192 405
196 iso_pu_bacteria 2941507105 2941509569 405
197 iso_pu_bacteria 2941515067 2941517398 405
198 iso_pu_bacteria 2941523033 2941526649 405
199 iso_pu_bacteria 2941531003 2941536620 405
200 iso_pu_bacteria 2941538514 2941542882 405
201 iso_pu_bacteria 3005474847 3005476162 405
202 iso_pu_bacteria 3005594810 3005601136 405
203 iso_pu_bacteria 3005710791 3005716596 405
204 iso_pu_bacteria 8006933436 8006937467 405
205 iso_pu_bacteria 8006973647 8006977496 405
206 iso_pu_bacteria 8016511872 8016519773 405
207 iso_pu_bacteria 8017057580 8017065765 405
208 iso_pu_bacteria 8019555841 8019561154 405
209 iso_pu_bacteria 8019565922 8019571241 405
210 iso_pu_bacteria 8019576017 8019585196 405
211 iso_pu_bacteria 8019586578 8019593167 405
212 iso_pu_bacteria 8019597564 8019598298 405
213 iso_pu_bacteria 8019608314 8019610080 405
214 iso_pu_bacteria 8019648815 8019655177 405
215 iso_pu_bacteria 8055742211 8055744311 405
216 iso_pu_bacteria 8056681323 8056682342 405
217 iso_pu_bacteria 8056689827 8056691959 405
218 3300005564 Ga0070664_100058436 Ga0070664_1000584362 406
219 3300005840 Ga0068870_10085315 Ga0068870_100853152 406
220 3300006844 Ga0075428_100002097 Ga0075428_10000209713 406
221 3300006847 Ga0075431_100000059 Ga0075431_10000005947 406
222 3300006880 Ga0075429_100001315 Ga0075429_1000013155 406
223 3300006914 Ga0075436_100015484 Ga0075436_1000154843 406
224 3300007076 Ga0075435_100009873 Ga0075435_1000098732 406
225 3300009094 Ga0111539_10001296 Ga0111539_100012963 406
226 3300009147 Ga0114129_10001483 Ga0114129_100014833 406
227 3300010159 Ga0099796_10025130 Ga0099796_100251301 406
228 3300013308 Ga0157375_10459051 Ga0157375_104590511 406
229 3300014325 Ga0163163_10064017 Ga0163163_100640173 406
230 3300027907 Ga0207428_10020197 Ga0207428_100201974 406
231 3300031235 Ga0265330_10043124 Ga0265330_100431242 406
232 3300031247 Ga0265340_10029973 Ga0265340_100299731 406
233 3300031344 Ga0265316_10064870 Ga0265316_100648702 406
234 3300039447 Ga0436361_0436460 Ga0436361_0436460_2880_4208 406
235 3300046684 Ga0495669_0072861 Ga0495669_0072861_43_1266 406
236 3300048907 Ga0496104_0016813 Ga0496104_0016813_613_1845 406
237 3300048907 Ga0496104_0019891 Ga0496104_0019891_2519_3748 406
238 3300048908 Ga0496105_0079787 Ga0496105_0079787_1353_2576 406
239 3300048911 Ga0496108_0014365 Ga0496108_0014365_4083_5312 406
240 3300048911 Ga0496108_0022357 Ga0496108_0022357_3120_4352 406
241 3300048912 Ga0496109_0008138 Ga0496109_0008138_3382_4614 406
242 3300048912 Ga0496109_0020657 Ga0496109_0020657_2635_3864 406
243 3300048913 Ga0496110_0017354 Ga0496110_0017354_4358_5590 406
244 3300048913 Ga0496110_0018064 Ga0496110_0018064_2244_3473 406
245 3300048914 Ga0496111_0060491 Ga0496111_0060491_1188_2417 406
246 3300048915 Ga0496112_0005031 Ga0496112_0005031_5481_6713 406
247 3300048915 Ga0496112_0022886 Ga0496112_0022886_2587_3816 406
248 3300048916 Ga0496113_0005682 Ga0496113_0005682_4587_5819 406
249 3300048916 Ga0496113_0013688 Ga0496113_0013688_1884_3113 406
250 3300048918 Ga0496115_0083572 Ga0496115_0083572_246_1466 406
251 3300050507 nmdc:mga05p37_285_c1 nmdc:mga05p37_285_c1_29280_30524 406
252 3300050508 nmdc:mga09592_664_c1 nmdc:mga09592_664_c1_15353_16597 406
253 3300050509 nmdc:mga0qj67_22598_c1 nmdc:mga0qj67_22598_c1_1584_2828 406
254 3300050509 nmdc:mga0qj67_296904_c1 nmdc:mga0qj67_296904_c1_45_1268 406
255 3300050510 nmdc:mga06r32_118_c1 nmdc:mga06r32_118_c1_15944_17188 406
256 3300050511 nmdc:mga08y16_89_c1 nmdc:mga08y16_89_c1_14133_15377 406
257 3300050513 nmdc:mga0rr50_68429_c1 nmdc:mga0rr50_68429_c1_811_2067 406
258 3300050514 nmdc:mga08x19_35_c1 nmdc:mga08x19_35_c1_122852_124108 406
259 3300053119 Ga0500595_023075 Ga0500595_023075_752_1975 406
260 3300053146 Ga0500588_0048594 Ga0500588_0048594_70_1293 406
261 3300060353 Ga0501082_0206809 Ga0501082_0206809_172_1395 406
262 iso_pu_bacteria 2721755755 2723847412 406
263 iso_pu_bacteria 2889033259 2889037458 406
264 iso_pu_bacteria 8006984368 8006990484 406
265 3300003579 Ga0007429J51699_1095660 Ga0007429J51699_10956601 407
266 3300021388 Ga0213875_10045581 Ga0213875_100455812 407
267 3300037853 Ga0436364_0718622 Ga0436364_0718622_1161_2396 407
268 3300046462 Ga0495651_0074760 Ga0495651_0074760_38_1270 407
269 3300048907 Ga0496104_0009093 Ga0496104_0009093_7510_8757 407
270 3300048907 Ga0496104_0037785 Ga0496104_0037785_678_1913 407
271 3300048908 Ga0496105_0006043 Ga0496105_0006043_730_1965 407
272 3300048911 Ga0496108_0214454 Ga0496108_0214454_179_1414 407
273 3300048912 Ga0496109_0003041 Ga0496109_0003041_7050_8285 407
274 3300048913 Ga0496110_0034774 Ga0496110_0034774_952_2187 407
275 3300048914 Ga0496111_0003992 Ga0496111_0003992_5346_6581 407
276 3300048915 Ga0496112_0009344 Ga0496112_0009344_7393_8628 407
277 3300048916 Ga0496113_0007895 Ga0496113_0007895_5267_6502 407
278 3300048918 Ga0496115_0049809 Ga0496115_0049809_611_1846 407
279 3300005327 Ga0070658_10039816 Ga0070658_100398162 408
280 3300005441 Ga0070700_100033409 Ga0070700_1000334092 408
281 3300005545 Ga0070695_100001037 Ga0070695_1000010377 408
282 3300005937 Ga0081455_10003143 Ga0081455_100031439 408
283 3300005983 Ga0081540_1000371 Ga0081540_10003717 408
284 3300006852 Ga0075433_10002766 Ga0075433_100027663 408
285 3300006871 Ga0075434_100002045 Ga0075434_1000020459 408
286 3300007076 Ga0075435_100084285 Ga0075435_1000842853 408
287 3300009094 Ga0111539_10124052 Ga0111539_101240521 408
288 3300009094 Ga0111539_10146002 Ga0111539_101460022 408
289 3300025253 Ga0209677_101648 Ga0209677_1016483 408
290 3300025909 Ga0207705_10071624 Ga0207705_100716242 408
291 3300025924 Ga0207694_10280679 Ga0207694_102806791 408
292 3300031249 Ga0265339_10008632 Ga0265339_100086324 408
293 3300031456 Ga0307513_10169321 Ga0307513_101693212 408
294 3300035114 Ga0373939_0041104 Ga0373939_0041104_119_1360 408
295 3300035242 Ga0373962_0015111 Ga0373962_0015111_208_1449 408
296 3300035691 Ga0373931_0007660 Ga0373931_0007660_2457_3698 408
297 3300045976 Ga0466967_0066335 Ga0466967_0066335_625_1860 408
298 3300048907 Ga0496104_0006383 Ga0496104_0006383_8430_9671 408
299 3300048911 Ga0496108_0000684 Ga0496108_0000684_12961_14202 408
300 3300048913 Ga0496110_0058186 Ga0496110_0058186_2111_3352 408
301 3300048914 Ga0496111_0021209 Ga0496111_0021209_1858_3099 408
302 3300048915 Ga0496112_0025283 Ga0496112_0025283_1760_3001 408
303 3300048916 Ga0496113_0035430 Ga0496113_0035430_182_1423 408
304 3300048921 Ga0496118_0011588 Ga0496118_0011588_2360_3595 408
305 3300050511 nmdc:mga08y16_87820_c1 nmdc:mga08y16_87820_c1_1382_2623 408
306 3300050512 nmdc:mga0n895_7091_c1 nmdc:mga0n895_7091_c1_6618_7859 408
307 3300050515 nmdc:mga0a205_17237_c1 nmdc:mga0a205_17237_c1_4234_5475 408
308 3300053111 Ga0500572_000168 Ga0500572_000168_8651_9913 408
309 3300053136 Ga0500559_0001562 Ga0500559_0001562_1153_2415 408
310 3300053163 Ga0500639_029111 Ga0500639_029111_1115_2377 408
311 3300003354 JGI25160J50197_1001954 JGI25160J50197_100195412 409
312 3300003354 JGI25160J50197_1011003 JGI25160J50197_10110033 409
313 3300003659 JGI25404J52841_10000057 JGI25404J52841_100000578 409
314 3300005262 Ga0065165_1000054 Ga0065165_100005425 409
315 3300005262 Ga0065165_1003837 Ga0065165_10038377 409
316 3300005289 Ga0065704_10110842 Ga0065704_101108423 409
317 3300005295 Ga0065707_10004110 Ga0065707_100041102 409
318 3300005327 Ga0070658_10055874 Ga0070658_100558742 409
319 3300005328 Ga0070676_10032947 Ga0070676_100329472 409
320 3300005336 Ga0070680_100093318 Ga0070680_1000933182 409
321 3300005339 Ga0070660_100041577 Ga0070660_1000415771 409
322 3300005339 Ga0070660_100091512 Ga0070660_1000915122 409
323 3300005353 Ga0070669_100011384 Ga0070669_1000113846 409
324 3300005354 Ga0070675_100090215 Ga0070675_1000902152 409
325 3300005455 Ga0070663_100023267 Ga0070663_1000232673 409
326 3300005466 Ga0070685_10014233 Ga0070685_100142332 409
327 3300005563 Ga0068855_100115745 Ga0068855_1001157452 409
328 3300005578 Ga0068854_100003638 Ga0068854_1000036384 409
329 3300005614 Ga0068856_100000560 Ga0068856_10000056031 409
330 3300005844 Ga0068862_100016806 Ga0068862_1000168065 409
331 3300005983 Ga0081540_1000370 Ga0081540_100037016 409
332 3300006844 Ga0075428_100069782 Ga0075428_1000697822 409
333 3300009094 Ga0111539_10027399 Ga0111539_100273992 409
334 3300009176 Ga0105242_10095018 Ga0105242_100950182 409
335 3300009551 Ga0105238_10102762 Ga0105238_101027622 409
336 3300009551 Ga0105238_10182664 Ga0105238_101826642 409
337 3300009553 Ga0105249_10018210 Ga0105249_100182105 409
338 3300009553 Ga0105249_10227807 Ga0105249_102278072 409
339 3300010375 Ga0105239_10088243 Ga0105239_100882433 409
340 3300013100 Ga0157373_10096779 Ga0157373_100967792 409
341 3300013102 Ga0157371_10076826 Ga0157371_100768262 409
342 3300013104 Ga0157370_10025911 Ga0157370_100259112 409
343 3300013306 Ga0163162_10031313 Ga0163162_100313131 409
344 3300021320 Ga0214544_1014838 Ga0214544_10148383 409
345 3300021321 Ga0214542_1014570 Ga0214542_10145706 409
346 3300021324 Ga0214545_1014326 Ga0214545_10143267 409
347 3300021327 Ga0214543_1015412 Ga0214543_10154126 409
348 3300021358 Ga0213873_10015801 Ga0213873_100158012 409
349 3300025230 Ga0209563_101910 Ga0209563_1019104 409
350 3300025253 Ga0209677_103715 Ga0209677_1037153 409
351 3300025254 Ga0209148_1008198 Ga0209148_10081981 409
352 3300025261 Ga0209233_1000794 Ga0209233_10007944 409
353 3300025261 Ga0209233_1002869 Ga0209233_10028694 409
354 3300025272 Ga0209455_1002569 Ga0209455_10025691 409
355 3300025272 Ga0209455_1008997 Ga0209455_10089972 409
356 3300025295 Ga0209564_1014386 Ga0209564_10143862 409
357 3300025297 Ga0209758_1009026 Ga0209758_10090263 409
358 3300025297 Ga0209758_1010412 Ga0209758_10104125 409
359 3300025297 Ga0209758_1033486 Ga0209758_10334862 409
360 3300025302 Ga0207426_1002185 Ga0207426_10021853 409
361 3300025302 Ga0207426_1004331 Ga0207426_10043317 409
362 3300025302 Ga0207426_1015910 Ga0207426_10159102 409
363 3300025904 Ga0207647_10043910 Ga0207647_100439103 409
364 3300025904 Ga0207647_10068296 Ga0207647_100682961 409
365 3300025907 Ga0207645_10042359 Ga0207645_100423591 409
366 3300025909 Ga0207705_10087565 Ga0207705_100875652 409
367 3300025911 Ga0207654_10110763 Ga0207654_101107631 409
368 3300025914 Ga0207671_10126548 Ga0207671_101265482 409
369 3300025919 Ga0207657_10041949 Ga0207657_100419492 409
370 3300025923 Ga0207681_10021473 Ga0207681_100214733 409
371 3300025929 Ga0207664_10045707 Ga0207664_100457072 409
372 3300025939 Ga0207665_10220773 Ga0207665_102207731 409
373 3300025940 Ga0207691_10075120 Ga0207691_100751202 409
374 3300025961 Ga0207712_10148937 Ga0207712_101489371 409
375 3300025981 Ga0207640_10008142 Ga0207640_100081423 409
376 3300026067 Ga0207678_10037942 Ga0207678_100379423 409
377 3300026078 Ga0207702_10000101 Ga0207702_100001013 409
378 3300026078 Ga0207702_10162401 Ga0207702_101624012 409
379 3300026089 Ga0207648_10271244 Ga0207648_102712441 409
380 3300026142 Ga0207698_10112487 Ga0207698_101124872 409
381 3300027907 Ga0207428_10075775 Ga0207428_100757753 409
382 3300028379 Ga0268266_10109475 Ga0268266_101094752 409
383 3300028380 Ga0268265_10056168 Ga0268265_100561681 409
384 3300033180 Ga0307510_10000928 Ga0307510_1000092811 409
385 3300035086 Ga0373934_0026456 Ga0373934_0026456_929_2161 409
386 3300037418 Ga0395900_0009417 Ga0395900_0009417_6321_7553 409
387 3300037466 Ga0395898_0010330 Ga0395898_0010330_4359_5591 409
388 3300038443 Ga0395901_0013474 Ga0395901_0013474_2489_3721 409
389 3300039447 Ga0436361_0171734 Ga0436361_0171734_726_1994 409
390 3300044683 Ga0466965_0017517 Ga0466965_0017517_276_1508 409
391 3300044684 Ga0466966_0012155 Ga0466966_0012155_1818_3050 409
392 3300044693 Ga0466961_0000528 Ga0466961_0000528_2706_3938 409
393 3300044842 Ga0466957_0070987 Ga0466957_0070987_71_1309 409
394 3300045049 Ga0466959_0006894 Ga0466959_0006894_4909_6141 409
395 3300046459 Ga0495629_0020961 Ga0495629_0020961_1494_2726 409
396 3300046459 Ga0495629_0122769 Ga0495629_0122769_463_1695 409
397 3300046459 Ga0495629_0208273 Ga0495629_0208273_72_1304 409
398 3300046460 Ga0495638_0003384 Ga0495638_0003384_10605_11837 409
399 3300046462 Ga0495651_0005551 Ga0495651_0005551_6084_7319 409
400 3300046462 Ga0495651_0009663 Ga0495651_0009663_4909_6141 409
401 3300046463 Ga0495653_0012628 Ga0495653_0012628_1775_3010 409
402 3300046477 Ga0495664_0014611 Ga0495664_0014611_1693_2928 409
403 3300046516 Ga0495628_0166628 Ga0495628_0166628_143_1378 409
404 3300046517 Ga0495630_0089315 Ga0495630_0089315_116_1348 409
405 3300046529 Ga0495652_0002553 Ga0495652_0002553_8738_9973 409
406 3300046533 Ga0495640_0042702 Ga0495640_0042702_1162_2394 409
407 3300046536 Ga0495587_0001810 Ga0495587_0001810_12078_13313 409
408 3300046536 Ga0495587_0018343 Ga0495587_0018343_2812_4044 409
409 3300046538 Ga0495609_0057831 Ga0495609_0057831_421_1653 409
410 3300046543 Ga0495645_0044294 Ga0495645_0044294_422_1657 409
411 3300046557 Ga0495622_0002979 Ga0495622_0002979_6655_7887 409
412 3300046557 Ga0495622_0027566 Ga0495622_0027566_1011_2243 409
413 3300046559 Ga0495667_0158588 Ga0495667_0158588_117_1349 409
414 3300046660 Ga0495625_0026215 Ga0495625_0026215_2027_3259 409
415 3300046663 Ga0495635_0017508 Ga0495635_0017508_402_1634 409
416 3300046663 Ga0495635_0020906 Ga0495635_0020906_701_1933 409
417 3300046665 Ga0495661_0111234 Ga0495661_0111234_256_1488 409
418 3300046674 Ga0495588_0000856 Ga0495588_0000856_12001_13233 409
419 3300046675 Ga0495657_0006245 Ga0495657_0006245_6016_7251 409
420 3300046675 Ga0495657_0121133 Ga0495657_0121133_128_1360 409
421 3300046680 Ga0495646_0008841 Ga0495646_0008841_596_1831 409
422 3300046689 Ga0495613_0165111 Ga0495613_0165111_331_1563 409
423 3300046692 Ga0495671_0035040 Ga0495671_0035040_906_2138 409
424 3300046694 Ga0495649_0054242 Ga0495649_0054242_834_2066 409
425 3300046809 Ga0495600_0006953 Ga0495600_0006953_5475_6707 409
426 3300047317 Ga0495604_0025841 Ga0495604_0025841_2061_3296 409
427 3300047317 Ga0495604_0036801 Ga0495604_0036801_1676_2908 409
428 3300047319 Ga0495674_0003716 Ga0495674_0003716_3155_4390 409
429 3300047319 Ga0495674_0060065 Ga0495674_0060065_1560_2792 409
430 3300047320 Ga0495672_0044824 Ga0495672_0044824_1076_2353 409
431 3300047321 Ga0495676_0016703 Ga0495676_0016703_3011_4243 409
432 3300047322 Ga0495680_0002657 Ga0495680_0002657_13830_15065 409
433 3300047322 Ga0495680_0047336 Ga0495680_0047336_1489_2721 409
434 3300047444 Ga0495675_0112860 Ga0495675_0112860_80_1312 409
435 3300047472 Ga0495686_0111169 Ga0495686_0111169_381_1613 409
436 3300047673 Ga0495593_0046164 Ga0495593_0046164_82_1314 409
437 3300048088 Ga0495602_0005315 Ga0495602_0005315_5373_6608 409
438 3300048904 Ga0496101_0177223 Ga0496101_0177223_245_1477 409
439 3300048905 Ga0496102_0211291 Ga0496102_0211291_282_1514 409
440 3300048907 Ga0496104_0008771 Ga0496104_0008771_6518_7750 409
441 3300048907 Ga0496104_0019057 Ga0496104_0019057_2977_4209 409
442 3300048908 Ga0496105_0004710 Ga0496105_0004710_656_1888 409
443 3300048908 Ga0496105_0029961 Ga0496105_0029961_2973_4205 409
444 3300048909 Ga0496106_0063814 Ga0496106_0063814_758_1990 409
445 3300048915 Ga0496112_0068510 Ga0496112_0068510_41_1273 409
446 3300048919 Ga0496116_0039775 Ga0496116_0039775_864_2096 409
447 3300048921 Ga0496118_0053761 Ga0496118_0053761_286_1518 409
448 3300048921 Ga0496118_0057863 Ga0496118_0057863_754_1986 409
449 3300048921 Ga0496118_0142342 Ga0496118_0142342_240_1472 409
450 3300048922 Ga0496119_0015262 Ga0496119_0015262_4174_5406 409
451 3300048923 Ga0496120_0016389 Ga0496120_0016389_2251_3483 409
452 3300048924 Ga0496121_0004204 Ga0496121_0004204_3917_5149 409
453 3300048924 Ga0496121_0031816 Ga0496121_0031816_2229_3461 409
454 3300048924 Ga0496121_0084150 Ga0496121_0084150_1267_2499 409
455 3300048924 Ga0496121_0134213 Ga0496121_0134213_327_1562 409
456 3300048926 Ga0496123_0081115 Ga0496123_0081115_132_1364 409
457 3300048927 Ga0496124_0072981 Ga0496124_0072981_209_1441 409
458 3300048928 Ga0496125_0000063 Ga0496125_0000063_248943_250175 409
459 3300048928 Ga0496125_0020683 Ga0496125_0020683_4191_5423 409
460 3300048928 Ga0496125_0021892 Ga0496125_0021892_771_2003 409
461 3300048928 Ga0496125_0035456 Ga0496125_0035456_2636_3868 409
462 3300048929 Ga0496126_0003851 Ga0496126_0003851_1026_2264 409
463 3300048929 Ga0496126_0004139 Ga0496126_0004139_13285_14517 409
464 3300048929 Ga0496126_0017838 Ga0496126_0017838_2808_4040 409
465 3300048929 Ga0496126_0026816 Ga0496126_0026816_2697_3929 409
466 3300048929 Ga0496126_0134983 Ga0496126_0134983_727_1962 409
467 3300049568 Ga0501031_0011778 Ga0501031_0011778_2544_3782 409
468 3300049569 Ga0501032_0000030 Ga0501032_0000030_30874_32112 409
469 3300049570 Ga0501033_0000111 Ga0501033_0000111_21770_23008 409
470 3300049571 Ga0501034_0000072 Ga0501034_0000072_166710_167948 409
471 3300049572 Ga0501036_0000033 Ga0501036_0000033_46199_47437 409
472 3300049572 Ga0501036_0139834 Ga0501036_0139834_671_1903 409
473 3300049573 Ga0501037_0000090 Ga0501037_0000090_8790_10028 409
474 3300049574 Ga0501038_0000060 Ga0501038_0000060_73509_74747 409
475 3300049574 Ga0501038_0044937 Ga0501038_0044937_1904_3136 409
476 3300049575 Ga0501039_0001633 Ga0501039_0001633_3349_4587 409
477 3300049579 Ga0501043_0000258 Ga0501043_0000258_45900_47138 409
478 3300049580 Ga0501046_0000078 Ga0501046_0000078_61712_62950 409
479 3300049580 Ga0501046_0028253 Ga0501046_0028253_2907_4139 409
480 3300049581 Ga0501047_0000140 Ga0501047_0000140_55681_56919 409
481 3300049581 Ga0501047_0035648 Ga0501047_0035648_863_2233 409
482 3300049583 Ga0501067_0000150 Ga0501067_0000150_8121_9359 409
483 3300049584 Ga0501068_0000292 Ga0501068_0000292_9513_10751 409
484 3300049586 Ga0501070_0080128 Ga0501070_0080128_505_1737 409
485 3300049588 Ga0501072_0000476 Ga0501072_0000476_18465_19703 409
486 3300049589 Ga0501073_0000009 Ga0501073_0000009_182535_183773 409
487 3300049590 Ga0501074_0000100 Ga0501074_0000100_22671_23909 409
488 3300049741 Ga0501079_0002676 Ga0501079_0002676_9758_10996 409
489 3300049742 Ga0501080_0000088 Ga0501080_0000088_2109_3347 409
490 3300049822 Ga0501035_0000302 Ga0501035_0000302_44981_46219 409
491 3300049822 Ga0501035_0207527 Ga0501035_0207527_434_1666 409
492 3300049822 Ga0501035_0252120 Ga0501035_0252120_67_1299 409
493 3300049823 Ga0501044_0000438 Ga0501044_0000438_38059_39297 409
494 3300049824 Ga0501045_0002548 Ga0501045_0002548_6918_8156 409
495 3300050492 nmdc:mga0yw44_4052_c1 nmdc:mga0yw44_4052_c1_2142_3374 409
496 3300050496 nmdc:mga07m45_56664_c1 nmdc:mga07m45_56664_c1_962_2194 409
497 3300050511 nmdc:mga08y16_28203_c1 nmdc:mga08y16_28203_c1_206_1453 409
498 3300053085 Ga0495619_0022363 Ga0495619_0022363_2597_3832 409
499 3300053086 Ga0500578_0075375 Ga0500578_0075375_638_1870 409
500 3300053089 Ga0500581_067905 Ga0500581_067905_433_1665 409
501 3300053090 Ga0500646_0009652 Ga0500646_0009652_1117_2352 409
502 3300053093 Ga0500651_0107527 Ga0500651_0107527_201_1433 409
503 3300053094 Ga0500566_0034377 Ga0500566_0034377_1637_2872 409
504 3300053096 Ga0500641_0043983 Ga0500641_0043983_123_1391 409
505 3300053098 Ga0500650_0014918 Ga0500650_0014918_1219_2451 409
506 3300053102 Ga0500554_002276 Ga0500554_002276_1840_3081 409
507 3300053104 Ga0500556_0001087 Ga0500556_0001087_4062_5294 409
508 3300053108 Ga0500562_035914 Ga0500562_035914_49_1281 409
509 3300053119 Ga0500595_006519 Ga0500595_006519_1955_3187 409
510 3300053130 Ga0500642_0000026 Ga0500642_0000026_144_1376 409
511 3300053131 Ga0500652_000882 Ga0500652_000882_4252_5484 409
512 3300053134 Ga0500658_0016838 Ga0500658_0016838_116_1348 409
513 3300053139 Ga0500568_0002271 Ga0500568_0002271_3275_4507 409
514 3300053142 Ga0500577_0000744 Ga0500577_0000744_6956_8248 409
515 3300053150 Ga0500603_001339 Ga0500603_001339_1896_3137 409
516 3300053151 Ga0500604_0001713 Ga0500604_0001713_552_1784 409
517 3300053153 Ga0500616_0000031 Ga0500616_0000031_183532_184764 409
518 3300053156 Ga0500622_0000112 Ga0500622_0000112_7932_9164 409
519 3300053161 Ga0500634_0040622 Ga0500634_0040622_365_1600 409
520 3300053177 Ga0500636_0005679 Ga0500636_0005679_5134_6375 409
521 3300053177 Ga0500636_0041200 Ga0500636_0041200_437_1672 409
522 3300053178 Ga0500637_0003548 Ga0500637_0003548_2334_3575 409
523 3300053737 Ga0500601_000034 Ga0500601_000034_5865_7097 409
524 3300054114 Ga0501084_0005330 Ga0501084_0005330_2577_3815 409
525 3300059643 Ga0587072_009788 Ga0587072_009788_241_1473 409
526 3300002077 JGI24744J21845_10008041 JGI24744J21845_100080411 410
527 3300002244 JGI24742J22300_10000509 JGI24742J22300_100005096 410
528 3300003203 JGI25406J46586_10000014 JGI25406J46586_100000147 410
529 3300003215 JGI25153J46596_10038702 JGI25153J46596_100387021 410
530 3300005328 Ga0070676_10008312 Ga0070676_100083124 410
531 3300005330 Ga0070690_100002327 Ga0070690_1000023277 410
532 3300005347 Ga0070668_100015142 Ga0070668_1000151426 410
533 3300005356 Ga0070674_100000485 Ga0070674_10000048510 410
534 3300005364 Ga0070673_100028812 Ga0070673_1000288121 410
535 3300005367 Ga0070667_100081235 Ga0070667_1000812353 410
536 3300005436 Ga0070713_100128209 Ga0070713_1001282092 410
537 3300005438 Ga0070701_10035060 Ga0070701_100350601 410
538 3300005441 Ga0070700_100003300 Ga0070700_1000033007 410
539 3300005455 Ga0070663_100051334 Ga0070663_1000513341 410
540 3300005456 Ga0070678_100060893 Ga0070678_1000608933 410
541 3300005457 Ga0070662_100022601 Ga0070662_1000226012 410
542 3300005459 Ga0068867_100004714 Ga0068867_1000047147 410
543 3300005468 Ga0070707_100103748 Ga0070707_1001037481 410
544 3300005518 Ga0070699_100022502 Ga0070699_1000225025 410
545 3300005536 Ga0070697_100102688 Ga0070697_1001026882 410
546 3300005543 Ga0070672_100077955 Ga0070672_1000779552 410
547 3300005544 Ga0070686_100006029 Ga0070686_1000060292 410
548 3300005548 Ga0070665_100007932 Ga0070665_1000079324 410
549 3300005549 Ga0070704_100066334 Ga0070704_1000663343 410
550 3300005614 Ga0068856_100095555 Ga0068856_1000955553 410
551 3300005615 Ga0070702_100021652 Ga0070702_1000216523 410
552 3300005616 Ga0068852_100163403 Ga0068852_1001634032 410
553 3300005718 Ga0068866_10002087 Ga0068866_100020874 410
554 3300005719 Ga0068861_100011596 Ga0068861_1000115964 410
555 3300005842 Ga0068858_100027398 Ga0068858_1000273985 410
556 3300005843 Ga0068860_100011821 Ga0068860_1000118212 410
557 3300005844 Ga0068862_100018037 Ga0068862_1000180373 410
558 3300005983 Ga0081540_1015080 Ga0081540_10150802 410
559 3300005985 Ga0081539_10000008 Ga0081539_10000008149 410
560 3300006175 Ga0070712_100126315 Ga0070712_1001263152 410
561 3300006881 Ga0068865_100003839 Ga0068865_1000038391 410
562 3300007265 Ga0099794_10044444 Ga0099794_100444442 410
563 3300007788 Ga0099795_10026058 Ga0099795_100260581 410
564 3300009093 Ga0105240_10080600 Ga0105240_100806003 410
565 3300009098 Ga0105245_10031810 Ga0105245_100318103 410
566 3300009148 Ga0105243_10258730 Ga0105243_102587301 410
567 3300009174 Ga0105241_10059531 Ga0105241_100595313 410
568 3300009176 Ga0105242_10031596 Ga0105242_100315962 410
569 3300009553 Ga0105249_10001730 Ga0105249_100017305 410
570 3300010375 Ga0105239_10056173 Ga0105239_100561732 410
571 3300013296 Ga0157374_10378168 Ga0157374_103781681 410
572 3300013297 Ga0157378_10008838 Ga0157378_100088388 410
573 3300013306 Ga0163162_10009472 Ga0163162_100094722 410
574 3300014325 Ga0163163_10254404 Ga0163163_102544042 410
575 3300014326 Ga0157380_10104532 Ga0157380_101045322 410
576 3300014968 Ga0157379_10019649 Ga0157379_100196493 410
577 3300014968 Ga0157379_10139631 Ga0157379_101396312 410
578 3300014969 Ga0157376_10015348 Ga0157376_100153483 410
579 3300017792 Ga0163161_10001515 Ga0163161_1000151515 410
580 3300025297 Ga0209758_1022843 Ga0209758_10228434 410
581 3300025315 Ga0207697_10005623 Ga0207697_100056232 410
582 3300025907 Ga0207645_10027154 Ga0207645_100271543 410
583 3300025913 Ga0207695_10062132 Ga0207695_100621323 410
584 3300025916 Ga0207663_10003842 Ga0207663_100038426 410
585 3300025916 Ga0207663_10032363 Ga0207663_100323632 410
586 3300025927 Ga0207687_10056044 Ga0207687_100560441 410
587 3300025928 Ga0207700_10117579 Ga0207700_101175792 410
588 3300025933 Ga0207706_10001763 Ga0207706_1000176311 410
589 3300025934 Ga0207686_10048052 Ga0207686_100480522 410
590 3300025935 Ga0207709_10006083 Ga0207709_100060834 410
591 3300025937 Ga0207669_10006404 Ga0207669_100064043 410
592 3300025938 Ga0207704_10009774 Ga0207704_100097744 410
593 3300025940 Ga0207691_10011336 Ga0207691_100113368 410
594 3300025941 Ga0207711_10048746 Ga0207711_100487462 410
595 3300025960 Ga0207651_10008687 Ga0207651_100086873 410
596 3300025961 Ga0207712_10037133 Ga0207712_100371333 410
597 3300025972 Ga0207668_10002534 Ga0207668_100025346 410
598 3300026035 Ga0207703_10176745 Ga0207703_101767452 410
599 3300026067 Ga0207678_10004912 Ga0207678_100049129 410
600 3300026075 Ga0207708_10004920 Ga0207708_100049207 410
601 3300026078 Ga0207702_10151066 Ga0207702_101510662 410
602 3300026089 Ga0207648_10006487 Ga0207648_1000648710 410
603 3300026118 Ga0207675_100054595 Ga0207675_1000545952 410
604 3300026121 Ga0207683_10014299 Ga0207683_100142994 410
605 3300026142 Ga0207698_10016038 Ga0207698_100160381 410
606 3300027671 Ga0209588_1040481 Ga0209588_10404811 410
607 3300028380 Ga0268265_10040171 Ga0268265_100401713 410
608 3300028381 Ga0268264_10232828 Ga0268264_102328281 410
609 3300031548 Ga0307408_100067541 Ga0307408_1000675411 410
610 3300031711 Ga0265314_10013066 Ga0265314_100130665 410
611 3300035119 Ga0373956_0032329 Ga0373956_0032329_982_2217 410
612 3300035120 Ga0373957_0006832 Ga0373957_0006832_1562_2797 410
613 3300035172 Ga0373955_0032409 Ga0373955_0032409_101_1336 410
614 3300035692 Ga0373935_0001026 Ga0373935_0001026_6478_7713 410
615 3300035695 Ga0373927_0002601 Ga0373927_0002601_10993_12228 410
616 3300035695 Ga0373927_0006364 Ga0373927_0006364_3723_4964 410
617 3300035725 Ga0373947_0013236 Ga0373947_0013236_3007_4248 410
618 3300036401 Ga0373937_0201078 Ga0373937_0201078_522_1763 410
619 3300037068 Ga0373925_0021692 Ga0373925_0021692_14_1249 410
620 3300046455 Ga0495603_0001156 Ga0495603_0001156_89_1324 410
621 3300046459 Ga0495629_0007329 Ga0495629_0007329_6827_8062 410
622 3300046463 Ga0495653_0066838 Ga0495653_0066838_277_1512 410
623 3300046473 Ga0495582_0003642 Ga0495582_0003642_6685_7920 410
624 3300046475 Ga0495639_0001339 Ga0495639_0001339_9530_10765 410
625 3300046476 Ga0495662_0002101 Ga0495662_0002101_6478_7713 410
626 3300046477 Ga0495664_0047664 Ga0495664_0047664_501_1736 410
627 3300046512 Ga0495610_0093762 Ga0495610_0093762_47_1282 410
628 3300046514 Ga0495618_0017747 Ga0495618_0017747_1269_2504 410
629 3300046517 Ga0495630_0034020 Ga0495630_0034020_1489_2724 410
630 3300046520 Ga0495637_0045528 Ga0495637_0045528_544_1779 410
631 3300046526 Ga0495666_0037853 Ga0495666_0037853_573_1808 410
632 3300046529 Ga0495652_0019981 Ga0495652_0019981_3431_4666 410
633 3300046531 Ga0495665_0005946 Ga0495665_0005946_947_2182 410
634 3300046543 Ga0495645_0010090 Ga0495645_0010090_4566_5801 410
635 3300046557 Ga0495622_0050711 Ga0495622_0050711_403_1638 410
636 3300046615 Ga0495656_0014767 Ga0495656_0014767_1294_2526 410
637 3300046616 Ga0495668_0028463 Ga0495668_0028463_1467_2699 410
638 3300046642 Ga0495634_0010428 Ga0495634_0010428_439_1674 410
639 3300046642 Ga0495634_0058285 Ga0495634_0058285_415_1650 410
640 3300046663 Ga0495635_0055049 Ga0495635_0055049_371_1606 410
641 3300046663 Ga0495635_0166509 Ga0495635_0166509_59_1294 410
642 3300046679 Ga0495623_0024653 Ga0495623_0024653_1760_2995 410
643 3300046680 Ga0495646_0024264 Ga0495646_0024264_1922_3157 410
644 3300046680 Ga0495646_0127115 Ga0495646_0127115_89_1324 410
645 3300046681 Ga0495647_0023164 Ga0495647_0023164_70_1305 410
646 3300046684 Ga0495669_0007372 Ga0495669_0007372_80_1312 410
647 3300046690 Ga0495624_0005387 Ga0495624_0005387_6735_7970 410
648 3300046809 Ga0495600_0060206 Ga0495600_0060206_87_1322 410
649 3300047315 Ga0495581_0004974 Ga0495581_0004974_652_1887 410
650 3300047317 Ga0495604_0083370 Ga0495604_0083370_844_2079 410
651 3300047319 Ga0495674_0015066 Ga0495674_0015066_348_1583 410
652 3300047320 Ga0495672_0055278 Ga0495672_0055278_834_2069 410
653 3300047321 Ga0495676_0095338 Ga0495676_0095338_492_1727 410
654 3300047322 Ga0495680_0028899 Ga0495680_0028899_1290_2525 410
655 3300047471 Ga0495684_0011768 Ga0495684_0011768_4720_5955 410
656 3300047673 Ga0495593_0004447 Ga0495593_0004447_1063_2298 410
657 3300048088 Ga0495602_0039952 Ga0495602_0039952_2911_4146 410
658 3300048904 Ga0496101_0028077 Ga0496101_0028077_2516_3748 410
659 3300048907 Ga0496104_0141974 Ga0496104_0141974_103_1365 410
660 3300048915 Ga0496112_0000008 Ga0496112_0000008_222016_223251 410
661 3300048918 Ga0496115_0263974 Ga0496115_0263974_132_1364 410
662 3300048924 Ga0496121_0000774 Ga0496121_0000774_49239_50474 410
663 3300048924 Ga0496121_0001681 Ga0496121_0001681_8389_9624 410
664 3300048929 Ga0496126_0046515 Ga0496126_0046515_1919_3154 410
665 3300050492 nmdc:mga0yw44_72733_c1 nmdc:mga0yw44_72733_c1_17_1252 410
666 3300050512 nmdc:mga0n895_361601_c1 nmdc:mga0n895_361601_c1_176_1408 410
667 3300053077 Ga0495601_0116640 Ga0495601_0116640_37_1299 410
668 3300053078 Ga0495612_0008890 Ga0495612_0008890_1618_2853 410
669 3300053084 Ga0495595_0025822 Ga0495595_0025822_80_1315 410
670 3300053085 Ga0495619_0012259 Ga0495619_0012259_3376_4611 410
671 3300053085 Ga0495619_0014546 Ga0495619_0014546_3038_4273 410
672 3300053119 Ga0500595_011091 Ga0500595_011091_272_1507 410

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

11

358

0.92

PF13433

Peripla_BP_5

Periplasmic binding protein domain

135

365

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jfn-assembly1.cif.gz_A crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation 0.9133 22 409
7jfn-assembly1.cif.gz_A crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation 0.9066 22 409
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8757 22 368
3ip9-assembly1.cif.gz_A structure of atu2422-gaba receptor in complex with gaba 0.8721 23 389
4evr-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate 0.8683 23 395
ID Description Score Start End Superfamily
3i45A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9067 149 260 3.40.50.2300
3i45A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.894 22 360 3.40.50.2300
3i45A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8727 22 360 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8675 24 360 3.40.190.10
af_Q69NA5_27_147_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8662 23 149 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A1F3YBG4-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9702 40 409
AF-A0A315BBB9-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9619 33 410
AF-A0A4Q3J205-F1-model_v4 deleted 0.9539 275 408
AF-A0A1F3YBG4-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9475 40 409
AF-A0A3S0G2G8-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9474 5 399 GO:0006865

Feature Viewer

pLDDT pTM Quality
92.13 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map