F474258
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 672 | 449 | 556 | 410 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0213367|Ga0496115_0213367_30_1214 |
| Length | 394 |
| Sequence | MLSGAAYAQETVKIGYIDPLSGGGASVGEGGLKTFQYLADELNAKGGILGHKVEILPLDNKTNPQESLIQAQKAIDAGAHYITQGNGSSVGAALADFVTKHNTRNPGKEVLYFNYAAVDPSMTNEKCSFWHFRWDANSDIKMEALTNYMKDHESIKKVYQDYSFGQSVRTQARKMLGDKRPDVQIVGDELHPLLKITDFSPYIAKIKASGADSVVTGNWGQDFALLLKAAADAGLKVNWYTYYAGGAGGPTAIKQTNLDHQVFQISEGIPNSDNPAAMEFEKAFRAKVGLSLWYPRAVNEMRMFKAAAEKANSIDPVKVAAALEDLKFDVLDGGSGVMRKDDHQFLQPIYISSFGARSEKEPFDEENTGWGWRLVAKVDTPQTVLPTTCKMTRP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 5 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 6 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 7 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 8 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 9 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 10 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 11 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 12 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 13 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 14 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 15 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 16 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 17 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 18 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 19 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 20 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 21 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 22 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 23 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 24 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 25 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 26 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 27 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 28 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 29 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 30 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 31 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 32 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 33 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 34 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 35 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 36 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 37 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 38 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 39 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 40 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 41 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 42 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 43 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 44 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 45 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 46 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 47 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 48 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 49 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 50 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 51 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 52 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 53 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 54 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 55 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 56 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 57 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 58 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 59 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 60 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 61 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 62 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 63 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 64 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 65 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 66 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 67 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 68 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 69 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 70 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 71 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 72 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 73 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 74 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 75 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 76 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 77 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 78 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 79 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 80 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 81 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 82 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 83 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 84 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 85 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 86 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 87 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 88 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 89 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 90 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 91 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 92 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 93 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 94 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 95 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 96 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 97 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 98 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 99 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 100 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 101 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 103 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 104 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 105 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 107 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 108 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 109 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 112 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 113 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 127 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 131 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 133 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 135 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 136 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 137 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 138 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 141 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 142 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 144 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 145 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 147 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 148 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 149 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 150 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 151 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 152 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 153 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 154 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 155 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 156 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 158 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 159 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 161 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 162 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 163 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 164 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 165 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 166 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 167 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 168 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 169 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 170 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 171 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 172 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 183 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 184 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 193 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 194 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 195 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 197 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 198 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 199 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 200 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 201 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 202 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 250 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 251 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 252 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 254 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 258 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 259 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 260 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 261 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 262 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 263 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 264 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 265 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 266 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 267 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 268 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 269 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 270 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 271 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 272 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 273 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 274 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 275 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 276 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 283 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 284 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 285 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 291 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 358 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 364 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 405 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 406 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 407 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 408 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 409 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 410 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 411 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 412 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 413 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 414 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 416 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 417 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 418 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 419 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 420 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 421 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 422 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 423 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 424 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 425 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 426 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 427 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 428 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 429 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 430 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 431 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 432 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 433 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 434 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 435 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 436 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 437 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 438 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 439 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 440 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 441 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 442 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 443 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 444 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 445 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 446 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 447 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 448 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 449 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.81 |
| Metatranscriptomes | 0.3 |
| Isolates | 16.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.78 |
| Nodule | 12.8 |
| Rhizoplane | 9.38 |
| Rhizosphere | 58.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10008041 | 3300002077 | Bacteria | 2177 |
| 2 | JGI24742J22300_10000509 | 3300002244 | Bacteria | 5791 |
| 3 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 4 | JGI25153J46596_10038702 | 3300003215 | Bacteria | 1499 |
| 5 | JGI25160J50197_1001954 | 3300003354 | Bacteria | 9837 |
| 6 | JGI25160J50197_1011003 | 3300003354 | Bacteria | 3237 |
| 7 | Ga0007429J51699_1095660 | 3300003579 | Bacteria | 1383 |
| 8 | JGI25404J52841_10000057 | 3300003659 | Bacteria | 9569 |
| 9 | Ga0065165_1000054 | 3300005262 | Bacteria | 187351 |
| 10 | Ga0065165_1003837 | 3300005262 | Bacteria | 10008 |
| 11 | Ga0065704_10110842 | 3300005289 | Bacteria | 1971 |
| 12 | Ga0065707_10004110 | 3300005295 | Bacteria | 5458 |
| 13 | Ga0070658_10039816 | 3300005327 | Bacteria | 3792 |
| 14 | Ga0070658_10055874 | 3300005327 | Bacteria | 3208 |
| 15 | Ga0070676_10008312 | 3300005328 | Bacteria | 5591 |
| 16 | Ga0070676_10032947 | 3300005328 | Bacteria | 2971 |
| 17 | Ga0070690_100002327 | 3300005330 | Bacteria | 10210 |
| 18 | Ga0070680_100093318 | 3300005336 | Bacteria | 2494 |
| 19 | Ga0070660_100041577 | 3300005339 | Bacteria | 3504 |
| 20 | Ga0070660_100091512 | 3300005339 | Bacteria | 2399 |
| 21 | Ga0070661_100116406 | 3300005344 | Bacteria | 1999 |
| 22 | Ga0070668_100015142 | 3300005347 | Bacteria | 5762 |
| 23 | Ga0070669_100011384 | 3300005353 | Bacteria | 6316 |
| 24 | Ga0070675_100090215 | 3300005354 | Bacteria | 2567 |
| 25 | Ga0070674_100000485 | 3300005356 | Bacteria | 19967 |
| 26 | Ga0070673_100028812 | 3300005364 | Bacteria | 4135 |
| 27 | Ga0070659_100261343 | 3300005366 | Bacteria | 1436 |
| 28 | Ga0070667_100081235 | 3300005367 | Bacteria | 2774 |
| 29 | Ga0070714_100022799 | 3300005435 | Bacteria | 5136 |
| 30 | Ga0070713_100128209 | 3300005436 | Bacteria | 2235 |
| 31 | Ga0070710_10006621 | 3300005437 | Bacteria | 5571 |
| 32 | Ga0070701_10035060 | 3300005438 | Bacteria | 2518 |
| 33 | Ga0070700_100003300 | 3300005441 | Bacteria | 8321 |
| 34 | Ga0070700_100033409 | 3300005441 | Bacteria | 3098 |
| 35 | Ga0070663_100023267 | 3300005455 | Bacteria | 4150 |
| 36 | Ga0070663_100051334 | 3300005455 | Bacteria | 2937 |
| 37 | Ga0070678_100060893 | 3300005456 | Bacteria | 2780 |
| 38 | Ga0070662_100022601 | 3300005457 | Bacteria | 4308 |
| 39 | Ga0068867_100004714 | 3300005459 | Bacteria | 9597 |
| 40 | Ga0070685_10014233 | 3300005466 | Bacteria | 4209 |
| 41 | Ga0070707_100103748 | 3300005468 | Bacteria | 2756 |
| 42 | Ga0070699_100022502 | 3300005518 | Bacteria | 5433 |
| 43 | Ga0070679_100064934 | 3300005530 | Bacteria | 3638 |
| 44 | Ga0070697_100102688 | 3300005536 | Bacteria | 2376 |
| 45 | Ga0070672_100077955 | 3300005543 | Bacteria | 2651 |
| 46 | Ga0070686_100006029 | 3300005544 | Bacteria | 6726 |
| 47 | Ga0070695_100001037 | 3300005545 | Bacteria | 15205 |
| 48 | Ga0070665_100007932 | 3300005548 | Bacteria | 10762 |
| 49 | Ga0070704_100066334 | 3300005549 | Bacteria | 2602 |
| 50 | Ga0068855_100080870 | 3300005563 | Bacteria | 3767 |
| 51 | Ga0068855_100115745 | 3300005563 | Bacteria | 3073 |
| 52 | Ga0070664_100058436 | 3300005564 | Unclassified | 3280 |
| 53 | Ga0068854_100003638 | 3300005578 | Bacteria | 9648 |
| 54 | Ga0068856_100000560 | 3300005614 | Bacteria | 40848 |
| 55 | Ga0068856_100095555 | 3300005614 | Bacteria | 2960 |
| 56 | Ga0070702_100021652 | 3300005615 | Bacteria | 3387 |
| 57 | Ga0068852_100163403 | 3300005616 | Bacteria | 2081 |
| 58 | Ga0068866_10002087 | 3300005718 | Bacteria | 8310 |
| 59 | Ga0068861_100011596 | 3300005719 | Bacteria | 6132 |
| 60 | Ga0068870_10085315 | 3300005840 | Bacteria | 1755 |
| 61 | Ga0068858_100027398 | 3300005842 | Bacteria | 5294 |
| 62 | Ga0068858_100193876 | 3300005842 | Bacteria | 1920 |
| 63 | Ga0068860_100011821 | 3300005843 | Bacteria | 8603 |
| 64 | Ga0068862_100016806 | 3300005844 | Bacteria | 6092 |
| 65 | Ga0068862_100018037 | 3300005844 | Bacteria | 5879 |
| 66 | Ga0081455_10003143 | 3300005937 | Bacteria | 19203 |
| 67 | Ga0081540_1000370 | 3300005983 | Bacteria | 45002 |
| 68 | Ga0081540_1000371 | 3300005983 | Bacteria | 44977 |
| 69 | Ga0081540_1015080 | 3300005983 | Bacteria | 4904 |
| 70 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 71 | Ga0070717_10040726 | 3300006028 | Bacteria | 3785 |
| 72 | Ga0070717_10152489 | 3300006028 | Unclassified | 2000 |
| 73 | Ga0070715_10040732 | 3300006163 | Bacteria | 1943 |
| 74 | Ga0070716_100024268 | 3300006173 | Bacteria | 3226 |
| 75 | Ga0070712_100012336 | 3300006175 | Bacteria | 5431 |
| 76 | Ga0070712_100126315 | 3300006175 | Bacteria | 1932 |
| 77 | Ga0075428_100002097 | 3300006844 | Bacteria | 21505 |
| 78 | Ga0075428_100069782 | 3300006844 | Bacteria | 3841 |
| 79 | Ga0075431_100000059 | 3300006847 | Bacteria | 61740 |
| 80 | Ga0075433_10002766 | 3300006852 | Bacteria | 13422 |
| 81 | Ga0075434_100002045 | 3300006871 | Bacteria | 17515 |
| 82 | Ga0075429_100001315 | 3300006880 | Bacteria | 20255 |
| 83 | Ga0068865_100003839 | 3300006881 | Bacteria | 9010 |
| 84 | Ga0075436_100015484 | 3300006914 | Bacteria | 5221 |
| 85 | Ga0099824_1016218 | 3300006942 | Bacteria | 6814 |
| 86 | Ga0099822_1007626 | 3300006943 | Bacteria | 13973 |
| 87 | Ga0075435_100009873 | 3300007076 | Bacteria | 6947 |
| 88 | Ga0075435_100084285 | 3300007076 | Bacteria | 2615 |
| 89 | Ga0099794_10044444 | 3300007265 | Bacteria | 2123 |
| 90 | Ga0099795_10026058 | 3300007788 | Bacteria | 1966 |
| 91 | Ga0105240_10080600 | 3300009093 | Bacteria | 4003 |
| 92 | Ga0111539_10001296 | 3300009094 | Bacteria | 33381 |
| 93 | Ga0111539_10027399 | 3300009094 | Bacteria | 6960 |
| 94 | Ga0111539_10124052 | 3300009094 | Bacteria | 3027 |
| 95 | Ga0111539_10146002 | 3300009094 | Bacteria | 2770 |
| 96 | Ga0105245_10031810 | 3300009098 | Bacteria | 4672 |
| 97 | Ga0105245_10073745 | 3300009098 | Bacteria | 3104 |
| 98 | Ga0114129_10001483 | 3300009147 | Bacteria | 31789 |
| 99 | Ga0105243_10258730 | 3300009148 | Bacteria | 1557 |
| 100 | Ga0105241_10059531 | 3300009174 | Bacteria | 2937 |
| 101 | Ga0105242_10031596 | 3300009176 | Bacteria | 4231 |
| 102 | Ga0105242_10095018 | 3300009176 | Bacteria | 2516 |
| 103 | Ga0105248_10422605 | 3300009177 | Bacteria | 1501 |
| 104 | Ga0105238_10102762 | 3300009551 | Bacteria | 2839 |
| 105 | Ga0105238_10182664 | 3300009551 | Bacteria | 2074 |
| 106 | Ga0105238_10184941 | 3300009551 | Bacteria | 2060 |
| 107 | Ga0105249_10001730 | 3300009553 | Bacteria | 19091 |
| 108 | Ga0105249_10018210 | 3300009553 | Bacteria | 6243 |
| 109 | Ga0105249_10227807 | 3300009553 | Bacteria | 1837 |
| 110 | Ga0099796_10025130 | 3300010159 | Bacteria | 1877 |
| 111 | Ga0105239_10056173 | 3300010375 | Bacteria | 4318 |
| 112 | Ga0105239_10088243 | 3300010375 | Bacteria | 3420 |
| 113 | Ga0157373_10096779 | 3300013100 | Bacteria | 2078 |
| 114 | Ga0157373_10136218 | 3300013100 | Bacteria | 1726 |
| 115 | Ga0157371_10076826 | 3300013102 | Bacteria | 2365 |
| 116 | Ga0157370_10025911 | 3300013104 | Bacteria | 5797 |
| 117 | Ga0157374_10378168 | 3300013296 | Bacteria | 1410 |
| 118 | Ga0157378_10008838 | 3300013297 | Bacteria | 8766 |
| 119 | Ga0163162_10009472 | 3300013306 | Bacteria | 9469 |
| 120 | Ga0163162_10031313 | 3300013306 | Bacteria | 5276 |
| 121 | Ga0157375_10459051 | 3300013308 | Bacteria | 1439 |
| 122 | Ga0163163_10008715 | 3300014325 | Bacteria | 9022 |
| 123 | Ga0163163_10064017 | 3300014325 | Unclassified | 3648 |
| 124 | Ga0163163_10066025 | 3300014325 | Bacteria | 3593 |
| 125 | Ga0163163_10109568 | 3300014325 | Bacteria | 2789 |
| 126 | Ga0163163_10254404 | 3300014325 | Bacteria | 1807 |
| 127 | Ga0157380_10104532 | 3300014326 | Bacteria | 2365 |
| 128 | Ga0157379_10019649 | 3300014968 | Bacteria | 5969 |
| 129 | Ga0157379_10139631 | 3300014968 | Bacteria | 2184 |
| 130 | Ga0157376_10015348 | 3300014969 | Bacteria | 5784 |
| 131 | Ga0157376_10125653 | 3300014969 | Bacteria | 2281 |
| 132 | Ga0163161_10001515 | 3300017792 | Bacteria | 17196 |
| 133 | Ga0214544_1014838 | 3300021320 | Bacteria | 8469 |
| 134 | Ga0214542_1014570 | 3300021321 | Bacteria | 8700 |
| 135 | Ga0214545_1014326 | 3300021324 | Bacteria | 9276 |
| 136 | Ga0214543_1015412 | 3300021327 | Bacteria | 8466 |
| 137 | Ga0213873_10015801 | 3300021358 | Bacteria | 1698 |
| 138 | Ga0213875_10045581 | 3300021388 | Bacteria | 2058 |
| 139 | Ga0209563_101910 | 3300025230 | Bacteria | 5038 |
| 140 | Ga0209677_101648 | 3300025253 | Bacteria | 9393 |
| 141 | Ga0209677_103715 | 3300025253 | Bacteria | 4776 |
| 142 | Ga0209148_1008198 | 3300025254 | Bacteria | 2113 |
| 143 | Ga0209233_1000794 | 3300025261 | Bacteria | 14173 |
| 144 | Ga0209233_1002869 | 3300025261 | Bacteria | 6174 |
| 145 | Ga0209233_1009444 | 3300025261 | Bacteria | 2968 |
| 146 | Ga0209455_1002569 | 3300025272 | Bacteria | 6929 |
| 147 | Ga0209455_1008997 | 3300025272 | Bacteria | 2658 |
| 148 | Ga0209564_1014386 | 3300025295 | Bacteria | 3296 |
| 149 | Ga0209758_1009026 | 3300025297 | Bacteria | 6301 |
| 150 | Ga0209758_1010412 | 3300025297 | Bacteria | 5567 |
| 151 | Ga0209758_1022843 | 3300025297 | Bacteria | 2851 |
| 152 | Ga0209758_1033486 | 3300025297 | Bacteria | 2061 |
| 153 | Ga0207426_1002185 | 3300025302 | Bacteria | 13211 |
| 154 | Ga0207426_1004331 | 3300025302 | Bacteria | 6992 |
| 155 | Ga0207426_1015910 | 3300025302 | Bacteria | 2716 |
| 156 | Ga0207697_10005623 | 3300025315 | Bacteria | 5794 |
| 157 | Ga0207647_10043910 | 3300025904 | Bacteria | 2794 |
| 158 | Ga0207647_10068296 | 3300025904 | Bacteria | 2152 |
| 159 | Ga0207685_10004384 | 3300025905 | Bacteria | 3581 |
| 160 | Ga0207699_10023803 | 3300025906 | Bacteria | 3338 |
| 161 | Ga0207645_10027154 | 3300025907 | Bacteria | 3698 |
| 162 | Ga0207645_10042359 | 3300025907 | Bacteria | 2913 |
| 163 | Ga0207705_10071624 | 3300025909 | Bacteria | 2513 |
| 164 | Ga0207705_10087565 | 3300025909 | Bacteria | 2277 |
| 165 | Ga0207654_10110763 | 3300025911 | Bacteria | 1708 |
| 166 | Ga0207695_10062132 | 3300025913 | Bacteria | 3858 |
| 167 | Ga0207671_10126548 | 3300025914 | Bacteria | 1958 |
| 168 | Ga0207693_10001764 | 3300025915 | Bacteria | 18977 |
| 169 | Ga0207663_10003842 | 3300025916 | Bacteria | 7414 |
| 170 | Ga0207663_10006336 | 3300025916 | Bacteria | 6047 |
| 171 | Ga0207663_10032363 | 3300025916 | Bacteria | 3103 |
| 172 | Ga0207657_10012891 | 3300025919 | Bacteria | 8220 |
| 173 | Ga0207657_10041949 | 3300025919 | Bacteria | 4041 |
| 174 | Ga0207652_10259920 | 3300025921 | Bacteria | 1566 |
| 175 | Ga0207681_10021473 | 3300025923 | Bacteria | 4104 |
| 176 | Ga0207694_10280679 | 3300025924 | Bacteria | 1368 |
| 177 | Ga0207650_10051893 | 3300025925 | Bacteria | 3036 |
| 178 | Ga0207687_10056044 | 3300025927 | Bacteria | 2764 |
| 179 | Ga0207700_10093042 | 3300025928 | Bacteria | 2385 |
| 180 | Ga0207700_10117579 | 3300025928 | Bacteria | 2150 |
| 181 | Ga0207664_10045707 | 3300025929 | Bacteria | 3434 |
| 182 | Ga0207664_10047126 | 3300025929 | Bacteria | 3385 |
| 183 | Ga0207706_10001763 | 3300025933 | Bacteria | 21239 |
| 184 | Ga0207706_10114790 | 3300025933 | Bacteria | 2369 |
| 185 | Ga0207686_10048052 | 3300025934 | Bacteria | 2641 |
| 186 | Ga0207709_10006083 | 3300025935 | Bacteria | 6803 |
| 187 | Ga0207669_10006404 | 3300025937 | Bacteria | 5378 |
| 188 | Ga0207704_10009774 | 3300025938 | Bacteria | 4645 |
| 189 | Ga0207665_10012045 | 3300025939 | Bacteria | 5677 |
| 190 | Ga0207665_10220773 | 3300025939 | Bacteria | 1389 |
| 191 | Ga0207691_10011336 | 3300025940 | Bacteria | 8555 |
| 192 | Ga0207691_10075120 | 3300025940 | Bacteria | 3048 |
| 193 | Ga0207711_10048746 | 3300025941 | Bacteria | 3624 |
| 194 | Ga0207651_10008687 | 3300025960 | Bacteria | 5505 |
| 195 | Ga0207651_10016646 | 3300025960 | Bacteria | 4315 |
| 196 | Ga0207712_10037133 | 3300025961 | Bacteria | 3322 |
| 197 | Ga0207712_10148937 | 3300025961 | Bacteria | 1806 |
| 198 | Ga0207668_10002534 | 3300025972 | Bacteria | 10671 |
| 199 | Ga0207640_10008142 | 3300025981 | Bacteria | 5807 |
| 200 | Ga0207703_10176745 | 3300026035 | Bacteria | 1881 |
| 201 | Ga0207678_10004912 | 3300026067 | Bacteria | 12012 |
| 202 | Ga0207678_10037942 | 3300026067 | Bacteria | 4188 |
| 203 | Ga0207708_10004920 | 3300026075 | Bacteria | 9851 |
| 204 | Ga0207702_10000101 | 3300026078 | Bacteria | 99845 |
| 205 | Ga0207702_10151066 | 3300026078 | Bacteria | 2113 |
| 206 | Ga0207702_10162401 | 3300026078 | Bacteria | 2041 |
| 207 | Ga0207648_10006487 | 3300026089 | Bacteria | 11621 |
| 208 | Ga0207648_10271244 | 3300026089 | Bacteria | 1516 |
| 209 | Ga0207675_100054595 | 3300026118 | Bacteria | 3727 |
| 210 | Ga0207683_10014299 | 3300026121 | Bacteria | 6761 |
| 211 | Ga0207698_10016038 | 3300026142 | Bacteria | 5038 |
| 212 | Ga0207698_10112487 | 3300026142 | Bacteria | 2285 |
| 213 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 214 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 215 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 216 | Ga0209588_1040481 | 3300027671 | Bacteria | 1504 |
| 217 | Ga0207428_10020197 | 3300027907 | Bacteria | 5663 |
| 218 | Ga0207428_10075775 | 3300027907 | Bacteria | 2636 |
| 219 | Ga0268266_10109475 | 3300028379 | Bacteria | 2446 |
| 220 | Ga0268265_10040171 | 3300028380 | Bacteria | 3453 |
| 221 | Ga0268265_10056168 | 3300028380 | Bacteria | 2994 |
| 222 | Ga0268264_10232828 | 3300028381 | Bacteria | 1702 |
| 223 | Ga0265330_10043124 | 3300031235 | Bacteria | 1997 |
| 224 | Ga0265340_10029973 | 3300031247 | Bacteria | 2730 |
| 225 | Ga0265339_10008632 | 3300031249 | Bacteria | 6466 |
| 226 | Ga0265316_10064870 | 3300031344 | Bacteria | 2829 |
| 227 | Ga0307513_10169321 | 3300031456 | Bacteria | 2064 |
| 228 | Ga0307408_100067541 | 3300031548 | Bacteria | 2630 |
| 229 | Ga0265314_10013066 | 3300031711 | Bacteria | 6734 |
| 230 | Ga0307510_10000928 | 3300033180 | Bacteria | 31078 |
| 231 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 232 | Ga0373934_0026456 | 3300035086 | Bacteria | 2251 |
| 233 | Ga0373939_0041104 | 3300035114 | Bacteria | 1392 |
| 234 | Ga0373956_0032329 | 3300035119 | Bacteria | 2295 |
| 235 | Ga0373957_0006832 | 3300035120 | Bacteria | 3617 |
| 236 | Ga0373955_0032409 | 3300035172 | Bacteria | 2742 |
| 237 | Ga0373962_0015111 | 3300035242 | Bacteria | 1975 |
| 238 | Ga0373931_0007660 | 3300035691 | Bacteria | 5093 |
| 239 | Ga0373935_0001026 | 3300035692 | Bacteria | 15187 |
| 240 | Ga0373927_0002601 | 3300035695 | Bacteria | 13156 |
| 241 | Ga0373927_0006364 | 3300035695 | Bacteria | 8045 |
| 242 | Ga0373947_0013236 | 3300035725 | Bacteria | 4728 |
| 243 | Ga0373937_0060793 | 3300036401 | Bacteria | 3472 |
| 244 | Ga0373937_0074985 | 3300036401 | Bacteria | 3123 |
| 245 | Ga0373937_0201078 | 3300036401 | Bacteria | 1873 |
| 246 | Ga0373937_0334996 | 3300036401 | Bacteria | 1432 |
| 247 | Ga0373925_0021692 | 3300037068 | Bacteria | 4681 |
| 248 | Ga0395900_0009417 | 3300037418 | Bacteria | 10014 |
| 249 | Ga0395898_0010330 | 3300037466 | Bacteria | 9767 |
| 250 | Ga0436364_0718622 | 3300037853 | Bacteria | 2862 |
| 251 | Ga0436364_1447887 | 3300037853 | Bacteria | 2428 |
| 252 | Ga0395901_0013474 | 3300038443 | Bacteria | 8313 |
| 253 | Ga0436365_1039966 | 3300039437 | Bacteria | 3205 |
| 254 | Ga0436360_0127194 | 3300039438 | Bacteria | 7015 |
| 255 | Ga0436361_0171734 | 3300039447 | Bacteria | 7756 |
| 256 | Ga0436361_0436460 | 3300039447 | Bacteria | 4680 |
| 257 | Ga0436361_0516035 | 3300039447 | Bacteria | 1732 |
| 258 | Ga0466965_0017517 | 3300044683 | Bacteria | 3425 |
| 259 | Ga0466966_0012155 | 3300044684 | Bacteria | 5703 |
| 260 | Ga0466961_0000528 | 3300044693 | Bacteria | 24250 |
| 261 | Ga0466957_0070987 | 3300044842 | Bacteria | 2153 |
| 262 | Ga0466959_0006894 | 3300045049 | Bacteria | 7931 |
| 263 | Ga0466967_0066335 | 3300045976 | Bacteria | 3216 |
| 264 | Ga0495592_0037547 | 3300046454 | Bacteria | 3647 |
| 265 | Ga0495603_0001156 | 3300046455 | Bacteria | 15378 |
| 266 | Ga0495629_0007329 | 3300046459 | Bacteria | 8129 |
| 267 | Ga0495629_0020961 | 3300046459 | Bacteria | 4665 |
| 268 | Ga0495629_0122769 | 3300046459 | Bacteria | 1809 |
| 269 | Ga0495629_0208273 | 3300046459 | Bacteria | 1351 |
| 270 | Ga0495638_0003384 | 3300046460 | Bacteria | 12564 |
| 271 | Ga0495651_0005551 | 3300046462 | Bacteria | 9619 |
| 272 | Ga0495651_0009663 | 3300046462 | Bacteria | 7417 |
| 273 | Ga0495651_0074760 | 3300046462 | Bacteria | 2570 |
| 274 | Ga0495653_0012628 | 3300046463 | Bacteria | 6899 |
| 275 | Ga0495653_0066838 | 3300046463 | Bacteria | 2702 |
| 276 | Ga0495582_0003642 | 3300046473 | Bacteria | 8675 |
| 277 | Ga0495639_0001339 | 3300046475 | Bacteria | 11056 |
| 278 | Ga0495662_0002101 | 3300046476 | Bacteria | 9986 |
| 279 | Ga0495664_0014611 | 3300046477 | Bacteria | 4453 |
| 280 | Ga0495664_0047664 | 3300046477 | Bacteria | 2543 |
| 281 | Ga0495606_0001096 | 3300046507 | Bacteria | 38817 |
| 282 | Ga0495610_0093762 | 3300046512 | Bacteria | 1356 |
| 283 | Ga0495618_0017747 | 3300046514 | Bacteria | 4367 |
| 284 | Ga0495618_0046041 | 3300046514 | Bacteria | 2753 |
| 285 | Ga0495628_0166628 | 3300046516 | Bacteria | 1672 |
| 286 | Ga0495630_0034020 | 3300046517 | Bacteria | 3802 |
| 287 | Ga0495630_0064323 | 3300046517 | Bacteria | 2756 |
| 288 | Ga0495630_0089315 | 3300046517 | Bacteria | 2328 |
| 289 | Ga0495637_0045528 | 3300046520 | Bacteria | 1861 |
| 290 | Ga0495643_0087506 | 3300046522 | Bacteria | 1612 |
| 291 | Ga0495666_0037853 | 3300046526 | Bacteria | 2346 |
| 292 | Ga0495652_0002553 | 3300046529 | Bacteria | 18651 |
| 293 | Ga0495652_0019981 | 3300046529 | Bacteria | 5957 |
| 294 | Ga0495665_0005946 | 3300046531 | Bacteria | 6572 |
| 295 | Ga0495640_0042702 | 3300046533 | Bacteria | 3161 |
| 296 | Ga0495587_0001810 | 3300046536 | Bacteria | 14259 |
| 297 | Ga0495587_0016248 | 3300046536 | Bacteria | 4634 |
| 298 | Ga0495587_0018343 | 3300046536 | Bacteria | 4340 |
| 299 | Ga0495609_0057831 | 3300046538 | Bacteria | 1716 |
| 300 | Ga0495645_0010090 | 3300046543 | Bacteria | 6617 |
| 301 | Ga0495645_0044294 | 3300046543 | Bacteria | 3246 |
| 302 | Ga0495645_0104685 | 3300046543 | Bacteria | 2009 |
| 303 | Ga0495645_0110659 | 3300046543 | Bacteria | 1944 |
| 304 | Ga0495622_0002979 | 3300046557 | Bacteria | 8050 |
| 305 | Ga0495622_0027566 | 3300046557 | Bacteria | 2651 |
| 306 | Ga0495622_0050711 | 3300046557 | Bacteria | 1925 |
| 307 | Ga0495667_0158588 | 3300046559 | Bacteria | 1455 |
| 308 | Ga0495656_0014767 | 3300046615 | Bacteria | 2935 |
| 309 | Ga0495668_0028463 | 3300046616 | Bacteria | 3160 |
| 310 | Ga0495634_0010428 | 3300046642 | Bacteria | 6808 |
| 311 | Ga0495634_0013199 | 3300046642 | Bacteria | 5971 |
| 312 | Ga0495634_0058285 | 3300046642 | Bacteria | 2574 |
| 313 | Ga0495625_0026215 | 3300046660 | Bacteria | 4407 |
| 314 | Ga0495635_0016026 | 3300046663 | Bacteria | 5234 |
| 315 | Ga0495635_0017508 | 3300046663 | Bacteria | 5003 |
| 316 | Ga0495635_0020906 | 3300046663 | Bacteria | 4560 |
| 317 | Ga0495635_0055049 | 3300046663 | Bacteria | 2740 |
| 318 | Ga0495635_0166509 | 3300046663 | Bacteria | 1500 |
| 319 | Ga0495661_0111234 | 3300046665 | Bacteria | 1526 |
| 320 | Ga0495588_0000856 | 3300046674 | Bacteria | 13487 |
| 321 | Ga0495657_0006245 | 3300046675 | Bacteria | 9343 |
| 322 | Ga0495657_0121133 | 3300046675 | Bacteria | 1647 |
| 323 | Ga0495623_0024653 | 3300046679 | Bacteria | 3873 |
| 324 | Ga0495623_0047849 | 3300046679 | Bacteria | 2714 |
| 325 | Ga0495646_0008841 | 3300046680 | Bacteria | 6396 |
| 326 | Ga0495646_0024264 | 3300046680 | Bacteria | 3819 |
| 327 | Ga0495646_0114377 | 3300046680 | Bacteria | 1533 |
| 328 | Ga0495646_0127115 | 3300046680 | Bacteria | 1437 |
| 329 | Ga0495647_0023164 | 3300046681 | Bacteria | 2250 |
| 330 | Ga0495669_0007372 | 3300046684 | Bacteria | 4611 |
| 331 | Ga0495669_0072861 | 3300046684 | Bacteria | 1568 |
| 332 | Ga0495613_0161163 | 3300046689 | Bacteria | 1596 |
| 333 | Ga0495613_0165111 | 3300046689 | Bacteria | 1573 |
| 334 | Ga0495624_0005387 | 3300046690 | Bacteria | 9229 |
| 335 | Ga0495671_0035040 | 3300046692 | Bacteria | 2551 |
| 336 | Ga0495649_0054242 | 3300046694 | Bacteria | 2168 |
| 337 | Ga0495600_0006953 | 3300046809 | Bacteria | 6901 |
| 338 | Ga0495600_0038790 | 3300046809 | Bacteria | 3101 |
| 339 | Ga0495600_0060206 | 3300046809 | Bacteria | 2479 |
| 340 | Ga0495581_0004974 | 3300047315 | Bacteria | 7692 |
| 341 | Ga0495604_0005799 | 3300047317 | Bacteria | 9797 |
| 342 | Ga0495604_0025841 | 3300047317 | Bacteria | 4676 |
| 343 | Ga0495604_0036801 | 3300047317 | Bacteria | 3857 |
| 344 | Ga0495604_0054723 | 3300047317 | Bacteria | 3078 |
| 345 | Ga0495604_0083370 | 3300047317 | Bacteria | 2389 |
| 346 | Ga0495604_0112144 | 3300047317 | Bacteria | 1987 |
| 347 | Ga0495674_0003716 | 3300047319 | Bacteria | 14839 |
| 348 | Ga0495674_0010575 | 3300047319 | Bacteria | 8734 |
| 349 | Ga0495674_0015066 | 3300047319 | Bacteria | 7236 |
| 350 | Ga0495674_0060065 | 3300047319 | Bacteria | 3318 |
| 351 | Ga0495672_0044824 | 3300047320 | Bacteria | 2650 |
| 352 | Ga0495672_0055278 | 3300047320 | Bacteria | 2317 |
| 353 | Ga0495676_0016703 | 3300047321 | Bacteria | 6500 |
| 354 | Ga0495676_0076004 | 3300047321 | Bacteria | 2566 |
| 355 | Ga0495676_0095338 | 3300047321 | Bacteria | 2214 |
| 356 | Ga0495680_0002657 | 3300047322 | Bacteria | 18096 |
| 357 | Ga0495680_0028899 | 3300047322 | Bacteria | 4543 |
| 358 | Ga0495680_0047336 | 3300047322 | Bacteria | 3383 |
| 359 | Ga0495675_0112860 | 3300047444 | Bacteria | 1695 |
| 360 | Ga0495684_0011768 | 3300047471 | Bacteria | 6751 |
| 361 | Ga0495684_0091269 | 3300047471 | Bacteria | 2307 |
| 362 | Ga0495686_0111169 | 3300047472 | Bacteria | 1643 |
| 363 | Ga0495593_0004447 | 3300047673 | Bacteria | 8326 |
| 364 | Ga0495593_0046164 | 3300047673 | Bacteria | 2323 |
| 365 | Ga0495602_0004838 | 3300048088 | Bacteria | 14088 |
| 366 | Ga0495602_0005315 | 3300048088 | Bacteria | 13515 |
| 367 | Ga0495602_0039952 | 3300048088 | Bacteria | 4312 |
| 368 | Ga0495602_0115252 | 3300048088 | Bacteria | 2174 |
| 369 | Ga0496101_0028077 | 3300048904 | Bacteria | 3926 |
| 370 | Ga0496101_0056378 | 3300048904 | Bacteria | 2841 |
| 371 | Ga0496101_0177223 | 3300048904 | Bacteria | 1640 |
| 372 | Ga0496102_0211291 | 3300048905 | Bacteria | 1829 |
| 373 | Ga0496104_0006383 | 3300048907 | Bacteria | 10368 |
| 374 | Ga0496104_0008771 | 3300048907 | Bacteria | 8990 |
| 375 | Ga0496104_0009093 | 3300048907 | Bacteria | 8836 |
| 376 | Ga0496104_0011052 | 3300048907 | Bacteria | 8078 |
| 377 | Ga0496104_0016813 | 3300048907 | Bacteria | 6648 |
| 378 | Ga0496104_0019057 | 3300048907 | Bacteria | 6270 |
| 379 | Ga0496104_0019891 | 3300048907 | Bacteria | 6148 |
| 380 | Ga0496104_0037785 | 3300048907 | Bacteria | 4514 |
| 381 | Ga0496104_0101045 | 3300048907 | Bacteria | 2761 |
| 382 | Ga0496104_0141974 | 3300048907 | Bacteria | 2307 |
| 383 | Ga0496105_0004710 | 3300048908 | Bacteria | 10290 |
| 384 | Ga0496105_0006043 | 3300048908 | Bacteria | 9260 |
| 385 | Ga0496105_0029844 | 3300048908 | Bacteria | 4465 |
| 386 | Ga0496105_0029961 | 3300048908 | Bacteria | 4456 |
| 387 | Ga0496105_0052643 | 3300048908 | Bacteria | 3362 |
| 388 | Ga0496105_0079787 | 3300048908 | Bacteria | 2703 |
| 389 | Ga0496106_0063814 | 3300048909 | Bacteria | 2800 |
| 390 | Ga0496107_0171948 | 3300048910 | Bacteria | 1608 |
| 391 | Ga0496108_0000684 | 3300048911 | Bacteria | 26239 |
| 392 | Ga0496108_0014365 | 3300048911 | Bacteria | 6465 |
| 393 | Ga0496108_0022159 | 3300048911 | Bacteria | 5222 |
| 394 | Ga0496108_0022357 | 3300048911 | Bacteria | 5199 |
| 395 | Ga0496108_0023629 | 3300048911 | Bacteria | 5059 |
| 396 | Ga0496108_0214454 | 3300048911 | Bacteria | 1671 |
| 397 | Ga0496109_0003041 | 3300048912 | Bacteria | 13980 |
| 398 | Ga0496109_0008138 | 3300048912 | Bacteria | 8891 |
| 399 | Ga0496109_0020657 | 3300048912 | Bacteria | 5817 |
| 400 | Ga0496109_0030071 | 3300048912 | Bacteria | 4867 |
| 401 | Ga0496109_0033235 | 3300048912 | Bacteria | 4640 |
| 402 | Ga0496110_0017354 | 3300048913 | Bacteria | 6020 |
| 403 | Ga0496110_0018064 | 3300048913 | Bacteria | 5907 |
| 404 | Ga0496110_0034774 | 3300048913 | Bacteria | 4368 |
| 405 | Ga0496110_0058186 | 3300048913 | Bacteria | 3404 |
| 406 | Ga0496110_0067116 | 3300048913 | Bacteria | 3173 |
| 407 | Ga0496110_0087033 | 3300048913 | Bacteria | 2790 |
| 408 | Ga0496111_0003992 | 3300048914 | Bacteria | 9258 |
| 409 | Ga0496111_0016232 | 3300048914 | Bacteria | 5131 |
| 410 | Ga0496111_0021209 | 3300048914 | Bacteria | 4533 |
| 411 | Ga0496111_0060491 | 3300048914 | Bacteria | 2745 |
| 412 | Ga0496111_0090142 | 3300048914 | Unclassified | 2246 |
| 413 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 414 | Ga0496112_0005031 | 3300048915 | Bacteria | 11350 |
| 415 | Ga0496112_0009344 | 3300048915 | Bacteria | 8825 |
| 416 | Ga0496112_0022886 | 3300048915 | Bacteria | 5961 |
| 417 | Ga0496112_0025283 | 3300048915 | Bacteria | 5701 |
| 418 | Ga0496112_0035694 | 3300048915 | Bacteria | 4846 |
| 419 | Ga0496112_0068510 | 3300048915 | Bacteria | 3504 |
| 420 | Ga0496113_0005682 | 3300048916 | Bacteria | 7813 |
| 421 | Ga0496113_0007895 | 3300048916 | Bacteria | 6884 |
| 422 | Ga0496113_0013688 | 3300048916 | Bacteria | 5508 |
| 423 | Ga0496113_0035430 | 3300048916 | Bacteria | 3649 |
| 424 | Ga0496113_0039673 | 3300048916 | Bacteria | 3467 |
| 425 | Ga0496113_0058773 | 3300048916 | Unclassified | 2894 |
| 426 | Ga0496115_0049809 | 3300048918 | Bacteria | 3354 |
| 427 | Ga0496115_0083572 | 3300048918 | Bacteria | 2603 |
| 428 | Ga0496115_0213367 | 3300048918 | Bacteria | 1594 |
| 429 | Ga0496115_0263974 | 3300048918 | Bacteria | 1416 |
| 430 | Ga0496116_0039775 | 3300048919 | Bacteria | 3246 |
| 431 | Ga0496118_0011588 | 3300048921 | Bacteria | 8585 |
| 432 | Ga0496118_0053761 | 3300048921 | Bacteria | 3057 |
| 433 | Ga0496118_0057863 | 3300048921 | Bacteria | 2902 |
| 434 | Ga0496118_0104305 | 3300048921 | Bacteria | 1904 |
| 435 | Ga0496118_0142342 | 3300048921 | Bacteria | 1517 |
| 436 | Ga0496119_0015262 | 3300048922 | Bacteria | 5933 |
| 437 | Ga0496120_0016389 | 3300048923 | Bacteria | 4843 |
| 438 | Ga0496121_0000774 | 3300048924 | Bacteria | 58528 |
| 439 | Ga0496121_0001681 | 3300048924 | Bacteria | 36391 |
| 440 | Ga0496121_0004204 | 3300048924 | Bacteria | 19648 |
| 441 | Ga0496121_0031816 | 3300048924 | Bacteria | 4811 |
| 442 | Ga0496121_0058085 | 3300048924 | Bacteria | 3201 |
| 443 | Ga0496121_0084150 | 3300048924 | Bacteria | 2509 |
| 444 | Ga0496121_0134213 | 3300048924 | Bacteria | 1846 |
| 445 | Ga0496123_0081115 | 3300048926 | Bacteria | 1973 |
| 446 | Ga0496124_0072981 | 3300048927 | Bacteria | 2841 |
| 447 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 448 | Ga0496125_0020683 | 3300048928 | Bacteria | 6171 |
| 449 | Ga0496125_0021892 | 3300048928 | Bacteria | 5948 |
| 450 | Ga0496125_0035456 | 3300048928 | Bacteria | 4374 |
| 451 | Ga0496126_0003851 | 3300048929 | Bacteria | 18556 |
| 452 | Ga0496126_0004139 | 3300048929 | Bacteria | 17539 |
| 453 | Ga0496126_0017838 | 3300048929 | Bacteria | 7063 |
| 454 | Ga0496126_0026816 | 3300048929 | Bacteria | 5516 |
| 455 | Ga0496126_0046515 | 3300048929 | Bacteria | 3979 |
| 456 | Ga0496126_0072722 | 3300048929 | Bacteria | 3058 |
| 457 | Ga0496126_0134983 | 3300048929 | Bacteria | 2129 |
| 458 | Ga0501031_0011778 | 3300049568 | Bacteria | 5705 |
| 459 | Ga0501032_0000030 | 3300049569 | Bacteria | 130405 |
| 460 | Ga0501032_0128828 | 3300049569 | Bacteria | 1670 |
| 461 | Ga0501033_0000111 | 3300049570 | Bacteria | 78688 |
| 462 | Ga0501034_0000072 | 3300049571 | Bacteria | 179824 |
| 463 | Ga0501036_0000033 | 3300049572 | Bacteria | 88546 |
| 464 | Ga0501036_0128260 | 3300049572 | Bacteria | 2142 |
| 465 | Ga0501036_0139834 | 3300049572 | Bacteria | 2043 |
| 466 | Ga0501037_0000090 | 3300049573 | Bacteria | 85021 |
| 467 | Ga0501037_0018343 | 3300049573 | Bacteria | 5157 |
| 468 | Ga0501038_0000060 | 3300049574 | Bacteria | 92314 |
| 469 | Ga0501038_0044937 | 3300049574 | Bacteria | 3835 |
| 470 | Ga0501039_0001633 | 3300049575 | Bacteria | 16530 |
| 471 | Ga0501043_0000258 | 3300049579 | Bacteria | 48131 |
| 472 | Ga0501043_0063609 | 3300049579 | Bacteria | 2897 |
| 473 | Ga0501043_0136863 | 3300049579 | Bacteria | 1918 |
| 474 | Ga0501046_0000078 | 3300049580 | Bacteria | 102826 |
| 475 | Ga0501046_0028253 | 3300049580 | Bacteria | 4570 |
| 476 | Ga0501047_0000140 | 3300049581 | Bacteria | 88265 |
| 477 | Ga0501047_0035648 | 3300049581 | Bacteria | 4806 |
| 478 | Ga0501067_0000150 | 3300049583 | Bacteria | 38434 |
| 479 | Ga0501068_0000292 | 3300049584 | Bacteria | 24928 |
| 480 | Ga0501070_0062674 | 3300049586 | Bacteria | 3080 |
| 481 | Ga0501070_0080128 | 3300049586 | Bacteria | 2702 |
| 482 | Ga0501072_0000476 | 3300049588 | Bacteria | 28786 |
| 483 | Ga0501073_0000009 | 3300049589 | Bacteria | 195649 |
| 484 | Ga0501074_0000100 | 3300049590 | Bacteria | 41920 |
| 485 | Ga0501079_0002676 | 3300049741 | Bacteria | 12956 |
| 486 | Ga0501080_0000088 | 3300049742 | Bacteria | 61753 |
| 487 | Ga0501035_0000302 | 3300049822 | Bacteria | 58095 |
| 488 | Ga0501035_0055116 | 3300049822 | Bacteria | 3550 |
| 489 | Ga0501035_0207527 | 3300049822 | Bacteria | 1677 |
| 490 | Ga0501035_0252120 | 3300049822 | Bacteria | 1498 |
| 491 | Ga0501044_0000438 | 3300049823 | Bacteria | 51173 |
| 492 | Ga0501044_0059192 | 3300049823 | Bacteria | 3926 |
| 493 | Ga0501045_0002548 | 3300049824 | Bacteria | 12424 |
| 494 | nmdc:mga0yw44_4052_c1 | 3300050492 | Bacteria | 6632 |
| 495 | nmdc:mga0yw44_72733_c1 | 3300050492 | Bacteria | 2138 |
| 496 | nmdc:mga07m45_56664_c1 | 3300050496 | Bacteria | 2215 |
| 497 | nmdc:mga05p37_285_c1 | 3300050507 | Bacteria | 52916 |
| 498 | nmdc:mga09592_664_c1 | 3300050508 | Bacteria | 24142 |
| 499 | nmdc:mga0qj67_22598_c1 | 3300050509 | Bacteria | 4831 |
| 500 | nmdc:mga0qj67_296904_c1 | 3300050509 | Bacteria | 1309 |
| 501 | nmdc:mga06r32_118_c1 | 3300050510 | Bacteria | 56778 |
| 502 | nmdc:mga08y16_28203_c1 | 3300050511 | Bacteria | 5918 |
| 503 | nmdc:mga08y16_87820_c1 | 3300050511 | Bacteria | 3240 |
| 504 | nmdc:mga08y16_89_c1 | 3300050511 | Bacteria | 76793 |
| 505 | nmdc:mga0n895_361601_c1 | 3300050512 | Bacteria | 1469 |
| 506 | nmdc:mga0n895_7091_c1 | 3300050512 | Bacteria | 9579 |
| 507 | nmdc:mga0rr50_68429_c1 | 3300050513 | Bacteria | 2700 |
| 508 | nmdc:mga08x19_35_c1 | 3300050514 | Bacteria | 185171 |
| 509 | nmdc:mga0a205_17237_c1 | 3300050515 | Bacteria | 6766 |
| 510 | Ga0495601_0075102 | 3300053077 | Bacteria | 2163 |
| 511 | Ga0495601_0116640 | 3300053077 | Bacteria | 1732 |
| 512 | Ga0495612_0002674 | 3300053078 | Bacteria | 7356 |
| 513 | Ga0495612_0008890 | 3300053078 | Bacteria | 4070 |
| 514 | Ga0495612_0009604 | 3300053078 | Bacteria | 3918 |
| 515 | Ga0495595_0025822 | 3300053084 | Bacteria | 2605 |
| 516 | Ga0495619_0001881 | 3300053085 | Bacteria | 13975 |
| 517 | Ga0495619_0012259 | 3300053085 | Bacteria | 5393 |
| 518 | Ga0495619_0014546 | 3300053085 | Bacteria | 4971 |
| 519 | Ga0495619_0022363 | 3300053085 | Bacteria | 4046 |
| 520 | Ga0500578_0075375 | 3300053086 | Bacteria | 2149 |
| 521 | Ga0500581_067905 | 3300053089 | Bacteria | 1797 |
| 522 | Ga0500646_0009652 | 3300053090 | Bacteria | 2470 |
| 523 | Ga0500651_0107527 | 3300053093 | Bacteria | 1705 |
| 524 | Ga0500566_0034377 | 3300053094 | Bacteria | 2949 |
| 525 | Ga0500641_0043983 | 3300053096 | Bacteria | 1815 |
| 526 | Ga0500650_0014918 | 3300053098 | Bacteria | 3299 |
| 527 | Ga0500554_002276 | 3300053102 | Bacteria | 3753 |
| 528 | Ga0500556_0001087 | 3300053104 | Bacteria | 13707 |
| 529 | Ga0500562_035914 | 3300053108 | Bacteria | 1313 |
| 530 | Ga0500572_000168 | 3300053111 | Bacteria | 22927 |
| 531 | Ga0500595_001683 | 3300053119 | Bacteria | 11615 |
| 532 | Ga0500595_006519 | 3300053119 | Bacteria | 4941 |
| 533 | Ga0500595_011091 | 3300053119 | Bacteria | 3546 |
| 534 | Ga0500595_023075 | 3300053119 | Bacteria | 2191 |
| 535 | Ga0500642_0000026 | 3300053130 | Bacteria | 127731 |
| 536 | Ga0500652_000882 | 3300053131 | Bacteria | 9939 |
| 537 | Ga0500658_0016838 | 3300053134 | Bacteria | 2726 |
| 538 | Ga0500559_0001562 | 3300053136 | Bacteria | 12815 |
| 539 | Ga0500559_0002898 | 3300053136 | Bacteria | 8636 |
| 540 | Ga0500568_0002271 | 3300053139 | Bacteria | 11457 |
| 541 | Ga0500577_0000744 | 3300053142 | Bacteria | 8361 |
| 542 | Ga0500588_0048594 | 3300053146 | Bacteria | 1313 |
| 543 | Ga0500603_001339 | 3300053150 | Bacteria | 5643 |
| 544 | Ga0500604_0001713 | 3300053151 | Bacteria | 6145 |
| 545 | Ga0500616_0000031 | 3300053153 | Bacteria | 415013 |
| 546 | Ga0500616_0000034 | 3300053153 | Bacteria | 396651 |
| 547 | Ga0500622_0000112 | 3300053156 | Bacteria | 83558 |
| 548 | Ga0500634_0040622 | 3300053161 | Bacteria | 2528 |
| 549 | Ga0500639_029111 | 3300053163 | Bacteria | 2919 |
| 550 | Ga0500636_0005679 | 3300053177 | Bacteria | 7134 |
| 551 | Ga0500636_0041200 | 3300053177 | Bacteria | 2731 |
| 552 | Ga0500637_0003548 | 3300053178 | Bacteria | 7231 |
| 553 | Ga0500601_000034 | 3300053737 | Bacteria | 28953 |
| 554 | Ga0501084_0005330 | 3300054114 | Bacteria | 10530 |
| 555 | Ga0587072_009788 | 3300059643 | Bacteria | 1537 |
| 556 | Ga0501082_0206809 | 3300060353 | Bacteria | 1708 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048914 | Ga0496111_0090142 | Ga0496111_0090142_1106_2191 | 361 |
| 2 | 3300048921 | Ga0496118_0104305 | Ga0496118_0104305_190_1290 | 364 |
| 3 | 3300046689 | Ga0495613_0161163 | Ga0495613_0161163_408_1577 | 370 |
| 4 | 3300014325 | Ga0163163_10109568 | Ga0163163_101095682 | 385 |
| 5 | 3300006943 | Ga0099822_1007626 | Ga0099822_100762614 | 386 |
| 6 | 3300048908 | Ga0496105_0029844 | Ga0496105_0029844_227_1558 | 388 |
| 7 | 3300048911 | Ga0496108_0022159 | Ga0496108_0022159_1209_2540 | 388 |
| 8 | 3300048912 | Ga0496109_0033235 | Ga0496109_0033235_234_1565 | 388 |
| 9 | 3300048913 | Ga0496110_0087033 | Ga0496110_0087033_556_1887 | 388 |
| 10 | 3300048914 | Ga0496111_0016232 | Ga0496111_0016232_3312_4643 | 388 |
| 11 | 3300048915 | Ga0496112_0035694 | Ga0496112_0035694_3063_4394 | 388 |
| 12 | 3300048916 | Ga0496113_0039673 | Ga0496113_0039673_970_2301 | 388 |
| 13 | 3300036401 | Ga0373937_0074985 | Ga0373937_0074985_1684_2862 | 392 |
| 14 | 3300025261 | Ga0209233_1009444 | Ga0209233_10094441 | 393 |
| 15 | 3300048918 | Ga0496115_0213367 | Ga0496115_0213367_30_1214 | 394 |
| 16 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005337 | 395 |
| 17 | 3300036401 | Ga0373937_0334996 | Ga0373937_0334996_214_1407 | 397 |
| 18 | 3300048929 | Ga0496126_0072722 | Ga0496126_0072722_1307_2590 | 397 |
| 19 | 3300053153 | Ga0500616_0000034 | Ga0500616_0000034_56618_57850 | 397 |
| 20 | 3300046507 | Ga0495606_0001096 | Ga0495606_0001096_37552_38748 | 398 |
| 21 | 3300047317 | Ga0495604_0054723 | Ga0495604_0054723_718_1959 | 399 |
| 22 | 3300048088 | Ga0495602_0115252 | Ga0495602_0115252_140_1381 | 399 |
| 23 | 3300049569 | Ga0501032_0128828 | Ga0501032_0128828_169_1413 | 399 |
| 24 | 3300049572 | Ga0501036_0128260 | Ga0501036_0128260_91_1335 | 399 |
| 25 | 3300049573 | Ga0501037_0018343 | Ga0501037_0018343_714_1916 | 399 |
| 26 | 3300049579 | Ga0501043_0063609 | Ga0501043_0063609_171_1415 | 399 |
| 27 | 3300049579 | Ga0501043_0136863 | Ga0501043_0136863_342_1544 | 399 |
| 28 | 3300049586 | Ga0501070_0062674 | Ga0501070_0062674_1271_2473 | 399 |
| 29 | 3300049822 | Ga0501035_0055116 | Ga0501035_0055116_1776_3020 | 399 |
| 30 | 3300036401 | Ga0373937_0060793 | Ga0373937_0060793_1041_2288 | 400 |
| 31 | 3300039437 | Ga0436365_1039966 | Ga0436365_1039966_155_1366 | 400 |
| 32 | 3300039447 | Ga0436361_0516035 | Ga0436361_0516035_513_1718 | 400 |
| 33 | 3300046454 | Ga0495592_0037547 | Ga0495592_0037547_2220_3467 | 400 |
| 34 | 3300046517 | Ga0495630_0064323 | Ga0495630_0064323_569_1816 | 400 |
| 35 | 3300046536 | Ga0495587_0016248 | Ga0495587_0016248_373_1620 | 400 |
| 36 | 3300046642 | Ga0495634_0013199 | Ga0495634_0013199_1130_2377 | 400 |
| 37 | 3300046663 | Ga0495635_0016026 | Ga0495635_0016026_2236_3483 | 400 |
| 38 | 3300046809 | Ga0495600_0038790 | Ga0495600_0038790_1556_2803 | 400 |
| 39 | 3300047317 | Ga0495604_0005799 | Ga0495604_0005799_5785_7032 | 400 |
| 40 | 3300047319 | Ga0495674_0010575 | Ga0495674_0010575_2530_3777 | 400 |
| 41 | 3300047321 | Ga0495676_0076004 | Ga0495676_0076004_745_1992 | 400 |
| 42 | 3300048088 | Ga0495602_0004838 | Ga0495602_0004838_5224_6471 | 400 |
| 43 | 3300053078 | Ga0495612_0002674 | Ga0495612_0002674_4250_5497 | 400 |
| 44 | 3300053085 | Ga0495619_0001881 | Ga0495619_0001881_6460_7707 | 400 |
| 45 | 3300005344 | Ga0070661_100116406 | Ga0070661_1001164062 | 401 |
| 46 | 3300006028 | Ga0070717_10152489 | Ga0070717_101524892 | 401 |
| 47 | 3300009177 | Ga0105248_10422605 | Ga0105248_104226051 | 401 |
| 48 | 3300014325 | Ga0163163_10008715 | Ga0163163_100087158 | 401 |
| 49 | 3300048904 | Ga0496101_0056378 | Ga0496101_0056378_171_1406 | 401 |
| 50 | 3300048907 | Ga0496104_0011052 | Ga0496104_0011052_5603_6838 | 401 |
| 51 | 3300048908 | Ga0496105_0052643 | Ga0496105_0052643_1544_2779 | 401 |
| 52 | 3300048911 | Ga0496108_0023629 | Ga0496108_0023629_2266_3501 | 401 |
| 53 | 3300048912 | Ga0496109_0030071 | Ga0496109_0030071_1968_3203 | 401 |
| 54 | 3300048913 | Ga0496110_0067116 | Ga0496110_0067116_762_1997 | 401 |
| 55 | 3300048916 | Ga0496113_0058773 | Ga0496113_0058773_270_1505 | 401 |
| 56 | 3300049823 | Ga0501044_0059192 | Ga0501044_0059192_603_1835 | 401 |
| 57 | 3300006942 | Ga0099824_1016218 | Ga0099824_10162185 | 402 |
| 58 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005352 | 402 |
| 59 | 3300027361 | Ga0209489_100005 | Ga0209489_100005352 | 402 |
| 60 | 3300027363 | Ga0209700_100006 | Ga0209700_100006352 | 402 |
| 61 | 3300053136 | Ga0500559_0002898 | Ga0500559_0002898_4565_5776 | 402 |
| 62 | iso_pu_bacteria | 2728368998 | 2728749161 | 402 |
| 63 | 3300005435 | Ga0070714_100022799 | Ga0070714_1000227994 | 403 |
| 64 | 3300005437 | Ga0070710_10006621 | Ga0070710_100066213 | 403 |
| 65 | 3300006028 | Ga0070717_10040726 | Ga0070717_100407262 | 403 |
| 66 | 3300006163 | Ga0070715_10040732 | Ga0070715_100407321 | 403 |
| 67 | 3300006173 | Ga0070716_100024268 | Ga0070716_1000242683 | 403 |
| 68 | 3300006175 | Ga0070712_100012336 | Ga0070712_1000123363 | 403 |
| 69 | 3300025905 | Ga0207685_10004384 | Ga0207685_100043841 | 403 |
| 70 | 3300025906 | Ga0207699_10023803 | Ga0207699_100238033 | 403 |
| 71 | 3300025915 | Ga0207693_10001764 | Ga0207693_1000176415 | 403 |
| 72 | 3300025916 | Ga0207663_10006336 | Ga0207663_100063365 | 403 |
| 73 | 3300025928 | Ga0207700_10093042 | Ga0207700_100930422 | 403 |
| 74 | 3300025929 | Ga0207664_10047126 | Ga0207664_100471262 | 403 |
| 75 | 3300025939 | Ga0207665_10012045 | Ga0207665_100120454 | 403 |
| 76 | 3300037853 | Ga0436364_1447887 | Ga0436364_1447887_113_1336 | 404 |
| 77 | 3300039438 | Ga0436360_0127194 | Ga0436360_0127194_1454_2677 | 404 |
| 78 | 3300046514 | Ga0495618_0046041 | Ga0495618_0046041_463_1725 | 404 |
| 79 | 3300046543 | Ga0495645_0110659 | Ga0495645_0110659_575_1837 | 404 |
| 80 | 3300047471 | Ga0495684_0091269 | Ga0495684_0091269_560_1822 | 404 |
| 81 | 3300048907 | Ga0496104_0101045 | Ga0496104_0101045_19_1245 | 404 |
| 82 | 3300048910 | Ga0496107_0171948 | Ga0496107_0171948_231_1448 | 404 |
| 83 | 3300048924 | Ga0496121_0058085 | Ga0496121_0058085_1938_3155 | 404 |
| 84 | 3300053077 | Ga0495601_0075102 | Ga0495601_0075102_760_2022 | 404 |
| 85 | 3300053078 | Ga0495612_0009604 | Ga0495612_0009604_399_1661 | 404 |
| 86 | iso_pu_bacteria | 2513237141 | 2513889590 | 404 |
| 87 | iso_pu_bacteria | 2841957949 | 2841959490 | 404 |
| 88 | 3300005366 | Ga0070659_100261343 | Ga0070659_1002613431 | 405 |
| 89 | 3300005530 | Ga0070679_100064934 | Ga0070679_1000649343 | 405 |
| 90 | 3300005563 | Ga0068855_100080870 | Ga0068855_1000808702 | 405 |
| 91 | 3300005842 | Ga0068858_100193876 | Ga0068858_1001938762 | 405 |
| 92 | 3300009098 | Ga0105245_10073745 | Ga0105245_100737453 | 405 |
| 93 | 3300009551 | Ga0105238_10184941 | Ga0105238_101849412 | 405 |
| 94 | 3300013100 | Ga0157373_10136218 | Ga0157373_101362182 | 405 |
| 95 | 3300014325 | Ga0163163_10066025 | Ga0163163_100660253 | 405 |
| 96 | 3300014969 | Ga0157376_10125653 | Ga0157376_101256532 | 405 |
| 97 | 3300025919 | Ga0207657_10012891 | Ga0207657_100128916 | 405 |
| 98 | 3300025921 | Ga0207652_10259920 | Ga0207652_102599201 | 405 |
| 99 | 3300025925 | Ga0207650_10051893 | Ga0207650_100518932 | 405 |
| 100 | 3300025933 | Ga0207706_10114790 | Ga0207706_101147902 | 405 |
| 101 | 3300025960 | Ga0207651_10016646 | Ga0207651_100166462 | 405 |
| 102 | 3300046522 | Ga0495643_0087506 | Ga0495643_0087506_324_1595 | 405 |
| 103 | 3300046543 | Ga0495645_0104685 | Ga0495645_0104685_189_1409 | 405 |
| 104 | 3300046679 | Ga0495623_0047849 | Ga0495623_0047849_240_1460 | 405 |
| 105 | 3300046680 | Ga0495646_0114377 | Ga0495646_0114377_147_1367 | 405 |
| 106 | 3300047317 | Ga0495604_0112144 | Ga0495604_0112144_626_1846 | 405 |
| 107 | 3300053119 | Ga0500595_001683 | Ga0500595_001683_8546_9766 | 405 |
| 108 | iso_pu_bacteria | 2508501128 | 2509149950 | 405 |
| 109 | iso_pu_bacteria | 2513237094 | 2513641448 | 405 |
| 110 | iso_pu_bacteria | 2513237096 | 2513655466 | 405 |
| 111 | iso_pu_bacteria | 2513237098 | 2513678534 | 405 |
| 112 | iso_pu_bacteria | 2513237137 | 2513859984 | 405 |
| 113 | iso_pu_bacteria | 2513237145 | 2513916456 | 405 |
| 114 | iso_pu_bacteria | 2517572143 | 2517889933 | 405 |
| 115 | iso_pu_bacteria | 2524023210 | 2524468842 | 405 |
| 116 | iso_pu_bacteria | 2524023228 | 2524535023 | 405 |
| 117 | iso_pu_bacteria | 2528768022 | 2528852185 | 405 |
| 118 | iso_pu_bacteria | 2602042107 | 2603861332 | 405 |
| 119 | iso_pu_bacteria | 2617270741 | 2617372525 | 405 |
| 120 | iso_pu_bacteria | 2643221651 | 2644287521 | 405 |
| 121 | iso_pu_bacteria | 2667528175 | 2671121039 | 405 |
| 122 | iso_pu_bacteria | 2791355197 | 2793068113 | 405 |
| 123 | iso_pu_bacteria | 2824600985 | 2824602043 | 405 |
| 124 | iso_pu_bacteria | 2824609381 | 2824610031 | 405 |
| 125 | iso_pu_bacteria | 2824617872 | 2824620287 | 405 |
| 126 | iso_pu_bacteria | 2824626560 | 2824629552 | 405 |
| 127 | iso_pu_bacteria | 2824635225 | 2824635872 | 405 |
| 128 | iso_pu_bacteria | 2824644064 | 2824646174 | 405 |
| 129 | iso_pu_bacteria | 2824653114 | 2824654887 | 405 |
| 130 | iso_pu_bacteria | 2824661429 | 2824665503 | 405 |
| 131 | iso_pu_bacteria | 2824704595 | 2824710823 | 405 |
| 132 | iso_pu_bacteria | 2824714736 | 2824721325 | 405 |
| 133 | iso_pu_bacteria | 2824723954 | 2824731300 | 405 |
| 134 | iso_pu_bacteria | 2824732956 | 2824738992 | 405 |
| 135 | iso_pu_bacteria | 2824746037 | 2824747045 | 405 |
| 136 | iso_pu_bacteria | 2824753945 | 2824757539 | 405 |
| 137 | iso_pu_bacteria | 2824763712 | 2824764129 | 405 |
| 138 | iso_pu_bacteria | 2849076700 | 2849077545 | 405 |
| 139 | iso_pu_bacteria | 2857509624 | 2857510161 | 405 |
| 140 | iso_pu_bacteria | 2857524615 | 2857530099 | 405 |
| 141 | iso_pu_bacteria | 2879099564 | 2879106235 | 405 |
| 142 | iso_pu_bacteria | 2881364244 | 2881365211 | 405 |
| 143 | iso_pu_bacteria | 2885374607 | 2885376530 | 405 |
| 144 | iso_pu_bacteria | 2885383462 | 2885387149 | 405 |
| 145 | iso_pu_bacteria | 2885409591 | 2885410679 | 405 |
| 146 | iso_pu_bacteria | 2888388044 | 2888392067 | 405 |
| 147 | iso_pu_bacteria | 2888419890 | 2888423224 | 405 |
| 148 | iso_pu_bacteria | 2893066018 | 2893071700 | 405 |
| 149 | iso_pu_bacteria | 2903748898 | 2903755358 | 405 |
| 150 | iso_pu_bacteria | 2903768456 | 2903772023 | 405 |
| 151 | iso_pu_bacteria | 2904711408 | 2904713356 | 405 |
| 152 | iso_pu_bacteria | 2906610324 | 2906612319 | 405 |
| 153 | iso_pu_bacteria | 2906635258 | 2906638344 | 405 |
| 154 | iso_pu_bacteria | 2906660503 | 2906663371 | 405 |
| 155 | iso_pu_bacteria | 2908739725 | 2908739805 | 405 |
| 156 | iso_pu_bacteria | 2908775508 | 2908780972 | 405 |
| 157 | iso_pu_bacteria | 2919073203 | 2919076895 | 405 |
| 158 | iso_pu_bacteria | 2922368715 | 2922376830 | 405 |
| 159 | iso_pu_bacteria | 2922425934 | 2922426980 | 405 |
| 160 | iso_pu_bacteria | 2929615660 | 2929621486 | 405 |
| 161 | iso_pu_bacteria | 2929624759 | 2929631699 | 405 |
| 162 | iso_pu_bacteria | 2932784394 | 2932790211 | 405 |
| 163 | iso_pu_bacteria | 2932794094 | 2932798723 | 405 |
| 164 | iso_pu_bacteria | 2932801729 | 2932806625 | 405 |
| 165 | iso_pu_bacteria | 2932809354 | 2932815883 | 405 |
| 166 | iso_pu_bacteria | 2932818245 | 2932824771 | 405 |
| 167 | iso_pu_bacteria | 2932828146 | 2932833330 | 405 |
| 168 | iso_pu_bacteria | 2933577622 | 2933583489 | 405 |
| 169 | iso_pu_bacteria | 2935616580 | 2935621395 | 405 |
| 170 | iso_pu_bacteria | 2935630451 | 2935633129 | 405 |
| 171 | iso_pu_bacteria | 2935638405 | 2935644745 | 405 |
| 172 | iso_pu_bacteria | 2935665750 | 2935672349 | 405 |
| 173 | iso_pu_bacteria | 2935675223 | 2935682788 | 405 |
| 174 | iso_pu_bacteria | 2935684952 | 2935693305 | 405 |
| 175 | iso_pu_bacteria | 2935694250 | 2935702193 | 405 |
| 176 | iso_pu_bacteria | 2935703347 | 2935710888 | 405 |
| 177 | iso_pu_bacteria | 2935713505 | 2935720906 | 405 |
| 178 | iso_pu_bacteria | 2935722832 | 2935730607 | 405 |
| 179 | iso_pu_bacteria | 2935732158 | 2935740628 | 405 |
| 180 | iso_pu_bacteria | 2935741537 | 2935749898 | 405 |
| 181 | iso_pu_bacteria | 2935750917 | 2935759282 | 405 |
| 182 | iso_pu_bacteria | 2935760218 | 2935767268 | 405 |
| 183 | iso_pu_bacteria | 2935801545 | 2935808838 | 405 |
| 184 | iso_pu_bacteria | 2935810662 | 2935817635 | 405 |
| 185 | iso_pu_bacteria | 2935827899 | 2935833995 | 405 |
| 186 | iso_pu_bacteria | 2935837841 | 2935845514 | 405 |
| 187 | iso_pu_bacteria | 2935855204 | 2935859412 | 405 |
| 188 | iso_pu_bacteria | 2935864058 | 2935869945 | 405 |
| 189 | iso_pu_bacteria | 2935873716 | 2935880907 | 405 |
| 190 | iso_pu_bacteria | 2935883170 | 2935889411 | 405 |
| 191 | iso_pu_bacteria | 2935959822 | 2935964730 | 405 |
| 192 | iso_pu_bacteria | 2935992306 | 2935998318 | 405 |
| 193 | iso_pu_bacteria | 2936002035 | 2936009219 | 405 |
| 194 | iso_pu_bacteria | 2936037263 | 2936044464 | 405 |
| 195 | iso_pu_bacteria | 2940556831 | 2940565192 | 405 |
| 196 | iso_pu_bacteria | 2941507105 | 2941509569 | 405 |
| 197 | iso_pu_bacteria | 2941515067 | 2941517398 | 405 |
| 198 | iso_pu_bacteria | 2941523033 | 2941526649 | 405 |
| 199 | iso_pu_bacteria | 2941531003 | 2941536620 | 405 |
| 200 | iso_pu_bacteria | 2941538514 | 2941542882 | 405 |
| 201 | iso_pu_bacteria | 3005474847 | 3005476162 | 405 |
| 202 | iso_pu_bacteria | 3005594810 | 3005601136 | 405 |
| 203 | iso_pu_bacteria | 3005710791 | 3005716596 | 405 |
| 204 | iso_pu_bacteria | 8006933436 | 8006937467 | 405 |
| 205 | iso_pu_bacteria | 8006973647 | 8006977496 | 405 |
| 206 | iso_pu_bacteria | 8016511872 | 8016519773 | 405 |
| 207 | iso_pu_bacteria | 8017057580 | 8017065765 | 405 |
| 208 | iso_pu_bacteria | 8019555841 | 8019561154 | 405 |
| 209 | iso_pu_bacteria | 8019565922 | 8019571241 | 405 |
| 210 | iso_pu_bacteria | 8019576017 | 8019585196 | 405 |
| 211 | iso_pu_bacteria | 8019586578 | 8019593167 | 405 |
| 212 | iso_pu_bacteria | 8019597564 | 8019598298 | 405 |
| 213 | iso_pu_bacteria | 8019608314 | 8019610080 | 405 |
| 214 | iso_pu_bacteria | 8019648815 | 8019655177 | 405 |
| 215 | iso_pu_bacteria | 8055742211 | 8055744311 | 405 |
| 216 | iso_pu_bacteria | 8056681323 | 8056682342 | 405 |
| 217 | iso_pu_bacteria | 8056689827 | 8056691959 | 405 |
| 218 | 3300005564 | Ga0070664_100058436 | Ga0070664_1000584362 | 406 |
| 219 | 3300005840 | Ga0068870_10085315 | Ga0068870_100853152 | 406 |
| 220 | 3300006844 | Ga0075428_100002097 | Ga0075428_10000209713 | 406 |
| 221 | 3300006847 | Ga0075431_100000059 | Ga0075431_10000005947 | 406 |
| 222 | 3300006880 | Ga0075429_100001315 | Ga0075429_1000013155 | 406 |
| 223 | 3300006914 | Ga0075436_100015484 | Ga0075436_1000154843 | 406 |
| 224 | 3300007076 | Ga0075435_100009873 | Ga0075435_1000098732 | 406 |
| 225 | 3300009094 | Ga0111539_10001296 | Ga0111539_100012963 | 406 |
| 226 | 3300009147 | Ga0114129_10001483 | Ga0114129_100014833 | 406 |
| 227 | 3300010159 | Ga0099796_10025130 | Ga0099796_100251301 | 406 |
| 228 | 3300013308 | Ga0157375_10459051 | Ga0157375_104590511 | 406 |
| 229 | 3300014325 | Ga0163163_10064017 | Ga0163163_100640173 | 406 |
| 230 | 3300027907 | Ga0207428_10020197 | Ga0207428_100201974 | 406 |
| 231 | 3300031235 | Ga0265330_10043124 | Ga0265330_100431242 | 406 |
| 232 | 3300031247 | Ga0265340_10029973 | Ga0265340_100299731 | 406 |
| 233 | 3300031344 | Ga0265316_10064870 | Ga0265316_100648702 | 406 |
| 234 | 3300039447 | Ga0436361_0436460 | Ga0436361_0436460_2880_4208 | 406 |
| 235 | 3300046684 | Ga0495669_0072861 | Ga0495669_0072861_43_1266 | 406 |
| 236 | 3300048907 | Ga0496104_0016813 | Ga0496104_0016813_613_1845 | 406 |
| 237 | 3300048907 | Ga0496104_0019891 | Ga0496104_0019891_2519_3748 | 406 |
| 238 | 3300048908 | Ga0496105_0079787 | Ga0496105_0079787_1353_2576 | 406 |
| 239 | 3300048911 | Ga0496108_0014365 | Ga0496108_0014365_4083_5312 | 406 |
| 240 | 3300048911 | Ga0496108_0022357 | Ga0496108_0022357_3120_4352 | 406 |
| 241 | 3300048912 | Ga0496109_0008138 | Ga0496109_0008138_3382_4614 | 406 |
| 242 | 3300048912 | Ga0496109_0020657 | Ga0496109_0020657_2635_3864 | 406 |
| 243 | 3300048913 | Ga0496110_0017354 | Ga0496110_0017354_4358_5590 | 406 |
| 244 | 3300048913 | Ga0496110_0018064 | Ga0496110_0018064_2244_3473 | 406 |
| 245 | 3300048914 | Ga0496111_0060491 | Ga0496111_0060491_1188_2417 | 406 |
| 246 | 3300048915 | Ga0496112_0005031 | Ga0496112_0005031_5481_6713 | 406 |
| 247 | 3300048915 | Ga0496112_0022886 | Ga0496112_0022886_2587_3816 | 406 |
| 248 | 3300048916 | Ga0496113_0005682 | Ga0496113_0005682_4587_5819 | 406 |
| 249 | 3300048916 | Ga0496113_0013688 | Ga0496113_0013688_1884_3113 | 406 |
| 250 | 3300048918 | Ga0496115_0083572 | Ga0496115_0083572_246_1466 | 406 |
| 251 | 3300050507 | nmdc:mga05p37_285_c1 | nmdc:mga05p37_285_c1_29280_30524 | 406 |
| 252 | 3300050508 | nmdc:mga09592_664_c1 | nmdc:mga09592_664_c1_15353_16597 | 406 |
| 253 | 3300050509 | nmdc:mga0qj67_22598_c1 | nmdc:mga0qj67_22598_c1_1584_2828 | 406 |
| 254 | 3300050509 | nmdc:mga0qj67_296904_c1 | nmdc:mga0qj67_296904_c1_45_1268 | 406 |
| 255 | 3300050510 | nmdc:mga06r32_118_c1 | nmdc:mga06r32_118_c1_15944_17188 | 406 |
| 256 | 3300050511 | nmdc:mga08y16_89_c1 | nmdc:mga08y16_89_c1_14133_15377 | 406 |
| 257 | 3300050513 | nmdc:mga0rr50_68429_c1 | nmdc:mga0rr50_68429_c1_811_2067 | 406 |
| 258 | 3300050514 | nmdc:mga08x19_35_c1 | nmdc:mga08x19_35_c1_122852_124108 | 406 |
| 259 | 3300053119 | Ga0500595_023075 | Ga0500595_023075_752_1975 | 406 |
| 260 | 3300053146 | Ga0500588_0048594 | Ga0500588_0048594_70_1293 | 406 |
| 261 | 3300060353 | Ga0501082_0206809 | Ga0501082_0206809_172_1395 | 406 |
| 262 | iso_pu_bacteria | 2721755755 | 2723847412 | 406 |
| 263 | iso_pu_bacteria | 2889033259 | 2889037458 | 406 |
| 264 | iso_pu_bacteria | 8006984368 | 8006990484 | 406 |
| 265 | 3300003579 | Ga0007429J51699_1095660 | Ga0007429J51699_10956601 | 407 |
| 266 | 3300021388 | Ga0213875_10045581 | Ga0213875_100455812 | 407 |
| 267 | 3300037853 | Ga0436364_0718622 | Ga0436364_0718622_1161_2396 | 407 |
| 268 | 3300046462 | Ga0495651_0074760 | Ga0495651_0074760_38_1270 | 407 |
| 269 | 3300048907 | Ga0496104_0009093 | Ga0496104_0009093_7510_8757 | 407 |
| 270 | 3300048907 | Ga0496104_0037785 | Ga0496104_0037785_678_1913 | 407 |
| 271 | 3300048908 | Ga0496105_0006043 | Ga0496105_0006043_730_1965 | 407 |
| 272 | 3300048911 | Ga0496108_0214454 | Ga0496108_0214454_179_1414 | 407 |
| 273 | 3300048912 | Ga0496109_0003041 | Ga0496109_0003041_7050_8285 | 407 |
| 274 | 3300048913 | Ga0496110_0034774 | Ga0496110_0034774_952_2187 | 407 |
| 275 | 3300048914 | Ga0496111_0003992 | Ga0496111_0003992_5346_6581 | 407 |
| 276 | 3300048915 | Ga0496112_0009344 | Ga0496112_0009344_7393_8628 | 407 |
| 277 | 3300048916 | Ga0496113_0007895 | Ga0496113_0007895_5267_6502 | 407 |
| 278 | 3300048918 | Ga0496115_0049809 | Ga0496115_0049809_611_1846 | 407 |
| 279 | 3300005327 | Ga0070658_10039816 | Ga0070658_100398162 | 408 |
| 280 | 3300005441 | Ga0070700_100033409 | Ga0070700_1000334092 | 408 |
| 281 | 3300005545 | Ga0070695_100001037 | Ga0070695_1000010377 | 408 |
| 282 | 3300005937 | Ga0081455_10003143 | Ga0081455_100031439 | 408 |
| 283 | 3300005983 | Ga0081540_1000371 | Ga0081540_10003717 | 408 |
| 284 | 3300006852 | Ga0075433_10002766 | Ga0075433_100027663 | 408 |
| 285 | 3300006871 | Ga0075434_100002045 | Ga0075434_1000020459 | 408 |
| 286 | 3300007076 | Ga0075435_100084285 | Ga0075435_1000842853 | 408 |
| 287 | 3300009094 | Ga0111539_10124052 | Ga0111539_101240521 | 408 |
| 288 | 3300009094 | Ga0111539_10146002 | Ga0111539_101460022 | 408 |
| 289 | 3300025253 | Ga0209677_101648 | Ga0209677_1016483 | 408 |
| 290 | 3300025909 | Ga0207705_10071624 | Ga0207705_100716242 | 408 |
| 291 | 3300025924 | Ga0207694_10280679 | Ga0207694_102806791 | 408 |
| 292 | 3300031249 | Ga0265339_10008632 | Ga0265339_100086324 | 408 |
| 293 | 3300031456 | Ga0307513_10169321 | Ga0307513_101693212 | 408 |
| 294 | 3300035114 | Ga0373939_0041104 | Ga0373939_0041104_119_1360 | 408 |
| 295 | 3300035242 | Ga0373962_0015111 | Ga0373962_0015111_208_1449 | 408 |
| 296 | 3300035691 | Ga0373931_0007660 | Ga0373931_0007660_2457_3698 | 408 |
| 297 | 3300045976 | Ga0466967_0066335 | Ga0466967_0066335_625_1860 | 408 |
| 298 | 3300048907 | Ga0496104_0006383 | Ga0496104_0006383_8430_9671 | 408 |
| 299 | 3300048911 | Ga0496108_0000684 | Ga0496108_0000684_12961_14202 | 408 |
| 300 | 3300048913 | Ga0496110_0058186 | Ga0496110_0058186_2111_3352 | 408 |
| 301 | 3300048914 | Ga0496111_0021209 | Ga0496111_0021209_1858_3099 | 408 |
| 302 | 3300048915 | Ga0496112_0025283 | Ga0496112_0025283_1760_3001 | 408 |
| 303 | 3300048916 | Ga0496113_0035430 | Ga0496113_0035430_182_1423 | 408 |
| 304 | 3300048921 | Ga0496118_0011588 | Ga0496118_0011588_2360_3595 | 408 |
| 305 | 3300050511 | nmdc:mga08y16_87820_c1 | nmdc:mga08y16_87820_c1_1382_2623 | 408 |
| 306 | 3300050512 | nmdc:mga0n895_7091_c1 | nmdc:mga0n895_7091_c1_6618_7859 | 408 |
| 307 | 3300050515 | nmdc:mga0a205_17237_c1 | nmdc:mga0a205_17237_c1_4234_5475 | 408 |
| 308 | 3300053111 | Ga0500572_000168 | Ga0500572_000168_8651_9913 | 408 |
| 309 | 3300053136 | Ga0500559_0001562 | Ga0500559_0001562_1153_2415 | 408 |
| 310 | 3300053163 | Ga0500639_029111 | Ga0500639_029111_1115_2377 | 408 |
| 311 | 3300003354 | JGI25160J50197_1001954 | JGI25160J50197_100195412 | 409 |
| 312 | 3300003354 | JGI25160J50197_1011003 | JGI25160J50197_10110033 | 409 |
| 313 | 3300003659 | JGI25404J52841_10000057 | JGI25404J52841_100000578 | 409 |
| 314 | 3300005262 | Ga0065165_1000054 | Ga0065165_100005425 | 409 |
| 315 | 3300005262 | Ga0065165_1003837 | Ga0065165_10038377 | 409 |
| 316 | 3300005289 | Ga0065704_10110842 | Ga0065704_101108423 | 409 |
| 317 | 3300005295 | Ga0065707_10004110 | Ga0065707_100041102 | 409 |
| 318 | 3300005327 | Ga0070658_10055874 | Ga0070658_100558742 | 409 |
| 319 | 3300005328 | Ga0070676_10032947 | Ga0070676_100329472 | 409 |
| 320 | 3300005336 | Ga0070680_100093318 | Ga0070680_1000933182 | 409 |
| 321 | 3300005339 | Ga0070660_100041577 | Ga0070660_1000415771 | 409 |
| 322 | 3300005339 | Ga0070660_100091512 | Ga0070660_1000915122 | 409 |
| 323 | 3300005353 | Ga0070669_100011384 | Ga0070669_1000113846 | 409 |
| 324 | 3300005354 | Ga0070675_100090215 | Ga0070675_1000902152 | 409 |
| 325 | 3300005455 | Ga0070663_100023267 | Ga0070663_1000232673 | 409 |
| 326 | 3300005466 | Ga0070685_10014233 | Ga0070685_100142332 | 409 |
| 327 | 3300005563 | Ga0068855_100115745 | Ga0068855_1001157452 | 409 |
| 328 | 3300005578 | Ga0068854_100003638 | Ga0068854_1000036384 | 409 |
| 329 | 3300005614 | Ga0068856_100000560 | Ga0068856_10000056031 | 409 |
| 330 | 3300005844 | Ga0068862_100016806 | Ga0068862_1000168065 | 409 |
| 331 | 3300005983 | Ga0081540_1000370 | Ga0081540_100037016 | 409 |
| 332 | 3300006844 | Ga0075428_100069782 | Ga0075428_1000697822 | 409 |
| 333 | 3300009094 | Ga0111539_10027399 | Ga0111539_100273992 | 409 |
| 334 | 3300009176 | Ga0105242_10095018 | Ga0105242_100950182 | 409 |
| 335 | 3300009551 | Ga0105238_10102762 | Ga0105238_101027622 | 409 |
| 336 | 3300009551 | Ga0105238_10182664 | Ga0105238_101826642 | 409 |
| 337 | 3300009553 | Ga0105249_10018210 | Ga0105249_100182105 | 409 |
| 338 | 3300009553 | Ga0105249_10227807 | Ga0105249_102278072 | 409 |
| 339 | 3300010375 | Ga0105239_10088243 | Ga0105239_100882433 | 409 |
| 340 | 3300013100 | Ga0157373_10096779 | Ga0157373_100967792 | 409 |
| 341 | 3300013102 | Ga0157371_10076826 | Ga0157371_100768262 | 409 |
| 342 | 3300013104 | Ga0157370_10025911 | Ga0157370_100259112 | 409 |
| 343 | 3300013306 | Ga0163162_10031313 | Ga0163162_100313131 | 409 |
| 344 | 3300021320 | Ga0214544_1014838 | Ga0214544_10148383 | 409 |
| 345 | 3300021321 | Ga0214542_1014570 | Ga0214542_10145706 | 409 |
| 346 | 3300021324 | Ga0214545_1014326 | Ga0214545_10143267 | 409 |
| 347 | 3300021327 | Ga0214543_1015412 | Ga0214543_10154126 | 409 |
| 348 | 3300021358 | Ga0213873_10015801 | Ga0213873_100158012 | 409 |
| 349 | 3300025230 | Ga0209563_101910 | Ga0209563_1019104 | 409 |
| 350 | 3300025253 | Ga0209677_103715 | Ga0209677_1037153 | 409 |
| 351 | 3300025254 | Ga0209148_1008198 | Ga0209148_10081981 | 409 |
| 352 | 3300025261 | Ga0209233_1000794 | Ga0209233_10007944 | 409 |
| 353 | 3300025261 | Ga0209233_1002869 | Ga0209233_10028694 | 409 |
| 354 | 3300025272 | Ga0209455_1002569 | Ga0209455_10025691 | 409 |
| 355 | 3300025272 | Ga0209455_1008997 | Ga0209455_10089972 | 409 |
| 356 | 3300025295 | Ga0209564_1014386 | Ga0209564_10143862 | 409 |
| 357 | 3300025297 | Ga0209758_1009026 | Ga0209758_10090263 | 409 |
| 358 | 3300025297 | Ga0209758_1010412 | Ga0209758_10104125 | 409 |
| 359 | 3300025297 | Ga0209758_1033486 | Ga0209758_10334862 | 409 |
| 360 | 3300025302 | Ga0207426_1002185 | Ga0207426_10021853 | 409 |
| 361 | 3300025302 | Ga0207426_1004331 | Ga0207426_10043317 | 409 |
| 362 | 3300025302 | Ga0207426_1015910 | Ga0207426_10159102 | 409 |
| 363 | 3300025904 | Ga0207647_10043910 | Ga0207647_100439103 | 409 |
| 364 | 3300025904 | Ga0207647_10068296 | Ga0207647_100682961 | 409 |
| 365 | 3300025907 | Ga0207645_10042359 | Ga0207645_100423591 | 409 |
| 366 | 3300025909 | Ga0207705_10087565 | Ga0207705_100875652 | 409 |
| 367 | 3300025911 | Ga0207654_10110763 | Ga0207654_101107631 | 409 |
| 368 | 3300025914 | Ga0207671_10126548 | Ga0207671_101265482 | 409 |
| 369 | 3300025919 | Ga0207657_10041949 | Ga0207657_100419492 | 409 |
| 370 | 3300025923 | Ga0207681_10021473 | Ga0207681_100214733 | 409 |
| 371 | 3300025929 | Ga0207664_10045707 | Ga0207664_100457072 | 409 |
| 372 | 3300025939 | Ga0207665_10220773 | Ga0207665_102207731 | 409 |
| 373 | 3300025940 | Ga0207691_10075120 | Ga0207691_100751202 | 409 |
| 374 | 3300025961 | Ga0207712_10148937 | Ga0207712_101489371 | 409 |
| 375 | 3300025981 | Ga0207640_10008142 | Ga0207640_100081423 | 409 |
| 376 | 3300026067 | Ga0207678_10037942 | Ga0207678_100379423 | 409 |
| 377 | 3300026078 | Ga0207702_10000101 | Ga0207702_100001013 | 409 |
| 378 | 3300026078 | Ga0207702_10162401 | Ga0207702_101624012 | 409 |
| 379 | 3300026089 | Ga0207648_10271244 | Ga0207648_102712441 | 409 |
| 380 | 3300026142 | Ga0207698_10112487 | Ga0207698_101124872 | 409 |
| 381 | 3300027907 | Ga0207428_10075775 | Ga0207428_100757753 | 409 |
| 382 | 3300028379 | Ga0268266_10109475 | Ga0268266_101094752 | 409 |
| 383 | 3300028380 | Ga0268265_10056168 | Ga0268265_100561681 | 409 |
| 384 | 3300033180 | Ga0307510_10000928 | Ga0307510_1000092811 | 409 |
| 385 | 3300035086 | Ga0373934_0026456 | Ga0373934_0026456_929_2161 | 409 |
| 386 | 3300037418 | Ga0395900_0009417 | Ga0395900_0009417_6321_7553 | 409 |
| 387 | 3300037466 | Ga0395898_0010330 | Ga0395898_0010330_4359_5591 | 409 |
| 388 | 3300038443 | Ga0395901_0013474 | Ga0395901_0013474_2489_3721 | 409 |
| 389 | 3300039447 | Ga0436361_0171734 | Ga0436361_0171734_726_1994 | 409 |
| 390 | 3300044683 | Ga0466965_0017517 | Ga0466965_0017517_276_1508 | 409 |
| 391 | 3300044684 | Ga0466966_0012155 | Ga0466966_0012155_1818_3050 | 409 |
| 392 | 3300044693 | Ga0466961_0000528 | Ga0466961_0000528_2706_3938 | 409 |
| 393 | 3300044842 | Ga0466957_0070987 | Ga0466957_0070987_71_1309 | 409 |
| 394 | 3300045049 | Ga0466959_0006894 | Ga0466959_0006894_4909_6141 | 409 |
| 395 | 3300046459 | Ga0495629_0020961 | Ga0495629_0020961_1494_2726 | 409 |
| 396 | 3300046459 | Ga0495629_0122769 | Ga0495629_0122769_463_1695 | 409 |
| 397 | 3300046459 | Ga0495629_0208273 | Ga0495629_0208273_72_1304 | 409 |
| 398 | 3300046460 | Ga0495638_0003384 | Ga0495638_0003384_10605_11837 | 409 |
| 399 | 3300046462 | Ga0495651_0005551 | Ga0495651_0005551_6084_7319 | 409 |
| 400 | 3300046462 | Ga0495651_0009663 | Ga0495651_0009663_4909_6141 | 409 |
| 401 | 3300046463 | Ga0495653_0012628 | Ga0495653_0012628_1775_3010 | 409 |
| 402 | 3300046477 | Ga0495664_0014611 | Ga0495664_0014611_1693_2928 | 409 |
| 403 | 3300046516 | Ga0495628_0166628 | Ga0495628_0166628_143_1378 | 409 |
| 404 | 3300046517 | Ga0495630_0089315 | Ga0495630_0089315_116_1348 | 409 |
| 405 | 3300046529 | Ga0495652_0002553 | Ga0495652_0002553_8738_9973 | 409 |
| 406 | 3300046533 | Ga0495640_0042702 | Ga0495640_0042702_1162_2394 | 409 |
| 407 | 3300046536 | Ga0495587_0001810 | Ga0495587_0001810_12078_13313 | 409 |
| 408 | 3300046536 | Ga0495587_0018343 | Ga0495587_0018343_2812_4044 | 409 |
| 409 | 3300046538 | Ga0495609_0057831 | Ga0495609_0057831_421_1653 | 409 |
| 410 | 3300046543 | Ga0495645_0044294 | Ga0495645_0044294_422_1657 | 409 |
| 411 | 3300046557 | Ga0495622_0002979 | Ga0495622_0002979_6655_7887 | 409 |
| 412 | 3300046557 | Ga0495622_0027566 | Ga0495622_0027566_1011_2243 | 409 |
| 413 | 3300046559 | Ga0495667_0158588 | Ga0495667_0158588_117_1349 | 409 |
| 414 | 3300046660 | Ga0495625_0026215 | Ga0495625_0026215_2027_3259 | 409 |
| 415 | 3300046663 | Ga0495635_0017508 | Ga0495635_0017508_402_1634 | 409 |
| 416 | 3300046663 | Ga0495635_0020906 | Ga0495635_0020906_701_1933 | 409 |
| 417 | 3300046665 | Ga0495661_0111234 | Ga0495661_0111234_256_1488 | 409 |
| 418 | 3300046674 | Ga0495588_0000856 | Ga0495588_0000856_12001_13233 | 409 |
| 419 | 3300046675 | Ga0495657_0006245 | Ga0495657_0006245_6016_7251 | 409 |
| 420 | 3300046675 | Ga0495657_0121133 | Ga0495657_0121133_128_1360 | 409 |
| 421 | 3300046680 | Ga0495646_0008841 | Ga0495646_0008841_596_1831 | 409 |
| 422 | 3300046689 | Ga0495613_0165111 | Ga0495613_0165111_331_1563 | 409 |
| 423 | 3300046692 | Ga0495671_0035040 | Ga0495671_0035040_906_2138 | 409 |
| 424 | 3300046694 | Ga0495649_0054242 | Ga0495649_0054242_834_2066 | 409 |
| 425 | 3300046809 | Ga0495600_0006953 | Ga0495600_0006953_5475_6707 | 409 |
| 426 | 3300047317 | Ga0495604_0025841 | Ga0495604_0025841_2061_3296 | 409 |
| 427 | 3300047317 | Ga0495604_0036801 | Ga0495604_0036801_1676_2908 | 409 |
| 428 | 3300047319 | Ga0495674_0003716 | Ga0495674_0003716_3155_4390 | 409 |
| 429 | 3300047319 | Ga0495674_0060065 | Ga0495674_0060065_1560_2792 | 409 |
| 430 | 3300047320 | Ga0495672_0044824 | Ga0495672_0044824_1076_2353 | 409 |
| 431 | 3300047321 | Ga0495676_0016703 | Ga0495676_0016703_3011_4243 | 409 |
| 432 | 3300047322 | Ga0495680_0002657 | Ga0495680_0002657_13830_15065 | 409 |
| 433 | 3300047322 | Ga0495680_0047336 | Ga0495680_0047336_1489_2721 | 409 |
| 434 | 3300047444 | Ga0495675_0112860 | Ga0495675_0112860_80_1312 | 409 |
| 435 | 3300047472 | Ga0495686_0111169 | Ga0495686_0111169_381_1613 | 409 |
| 436 | 3300047673 | Ga0495593_0046164 | Ga0495593_0046164_82_1314 | 409 |
| 437 | 3300048088 | Ga0495602_0005315 | Ga0495602_0005315_5373_6608 | 409 |
| 438 | 3300048904 | Ga0496101_0177223 | Ga0496101_0177223_245_1477 | 409 |
| 439 | 3300048905 | Ga0496102_0211291 | Ga0496102_0211291_282_1514 | 409 |
| 440 | 3300048907 | Ga0496104_0008771 | Ga0496104_0008771_6518_7750 | 409 |
| 441 | 3300048907 | Ga0496104_0019057 | Ga0496104_0019057_2977_4209 | 409 |
| 442 | 3300048908 | Ga0496105_0004710 | Ga0496105_0004710_656_1888 | 409 |
| 443 | 3300048908 | Ga0496105_0029961 | Ga0496105_0029961_2973_4205 | 409 |
| 444 | 3300048909 | Ga0496106_0063814 | Ga0496106_0063814_758_1990 | 409 |
| 445 | 3300048915 | Ga0496112_0068510 | Ga0496112_0068510_41_1273 | 409 |
| 446 | 3300048919 | Ga0496116_0039775 | Ga0496116_0039775_864_2096 | 409 |
| 447 | 3300048921 | Ga0496118_0053761 | Ga0496118_0053761_286_1518 | 409 |
| 448 | 3300048921 | Ga0496118_0057863 | Ga0496118_0057863_754_1986 | 409 |
| 449 | 3300048921 | Ga0496118_0142342 | Ga0496118_0142342_240_1472 | 409 |
| 450 | 3300048922 | Ga0496119_0015262 | Ga0496119_0015262_4174_5406 | 409 |
| 451 | 3300048923 | Ga0496120_0016389 | Ga0496120_0016389_2251_3483 | 409 |
| 452 | 3300048924 | Ga0496121_0004204 | Ga0496121_0004204_3917_5149 | 409 |
| 453 | 3300048924 | Ga0496121_0031816 | Ga0496121_0031816_2229_3461 | 409 |
| 454 | 3300048924 | Ga0496121_0084150 | Ga0496121_0084150_1267_2499 | 409 |
| 455 | 3300048924 | Ga0496121_0134213 | Ga0496121_0134213_327_1562 | 409 |
| 456 | 3300048926 | Ga0496123_0081115 | Ga0496123_0081115_132_1364 | 409 |
| 457 | 3300048927 | Ga0496124_0072981 | Ga0496124_0072981_209_1441 | 409 |
| 458 | 3300048928 | Ga0496125_0000063 | Ga0496125_0000063_248943_250175 | 409 |
| 459 | 3300048928 | Ga0496125_0020683 | Ga0496125_0020683_4191_5423 | 409 |
| 460 | 3300048928 | Ga0496125_0021892 | Ga0496125_0021892_771_2003 | 409 |
| 461 | 3300048928 | Ga0496125_0035456 | Ga0496125_0035456_2636_3868 | 409 |
| 462 | 3300048929 | Ga0496126_0003851 | Ga0496126_0003851_1026_2264 | 409 |
| 463 | 3300048929 | Ga0496126_0004139 | Ga0496126_0004139_13285_14517 | 409 |
| 464 | 3300048929 | Ga0496126_0017838 | Ga0496126_0017838_2808_4040 | 409 |
| 465 | 3300048929 | Ga0496126_0026816 | Ga0496126_0026816_2697_3929 | 409 |
| 466 | 3300048929 | Ga0496126_0134983 | Ga0496126_0134983_727_1962 | 409 |
| 467 | 3300049568 | Ga0501031_0011778 | Ga0501031_0011778_2544_3782 | 409 |
| 468 | 3300049569 | Ga0501032_0000030 | Ga0501032_0000030_30874_32112 | 409 |
| 469 | 3300049570 | Ga0501033_0000111 | Ga0501033_0000111_21770_23008 | 409 |
| 470 | 3300049571 | Ga0501034_0000072 | Ga0501034_0000072_166710_167948 | 409 |
| 471 | 3300049572 | Ga0501036_0000033 | Ga0501036_0000033_46199_47437 | 409 |
| 472 | 3300049572 | Ga0501036_0139834 | Ga0501036_0139834_671_1903 | 409 |
| 473 | 3300049573 | Ga0501037_0000090 | Ga0501037_0000090_8790_10028 | 409 |
| 474 | 3300049574 | Ga0501038_0000060 | Ga0501038_0000060_73509_74747 | 409 |
| 475 | 3300049574 | Ga0501038_0044937 | Ga0501038_0044937_1904_3136 | 409 |
| 476 | 3300049575 | Ga0501039_0001633 | Ga0501039_0001633_3349_4587 | 409 |
| 477 | 3300049579 | Ga0501043_0000258 | Ga0501043_0000258_45900_47138 | 409 |
| 478 | 3300049580 | Ga0501046_0000078 | Ga0501046_0000078_61712_62950 | 409 |
| 479 | 3300049580 | Ga0501046_0028253 | Ga0501046_0028253_2907_4139 | 409 |
| 480 | 3300049581 | Ga0501047_0000140 | Ga0501047_0000140_55681_56919 | 409 |
| 481 | 3300049581 | Ga0501047_0035648 | Ga0501047_0035648_863_2233 | 409 |
| 482 | 3300049583 | Ga0501067_0000150 | Ga0501067_0000150_8121_9359 | 409 |
| 483 | 3300049584 | Ga0501068_0000292 | Ga0501068_0000292_9513_10751 | 409 |
| 484 | 3300049586 | Ga0501070_0080128 | Ga0501070_0080128_505_1737 | 409 |
| 485 | 3300049588 | Ga0501072_0000476 | Ga0501072_0000476_18465_19703 | 409 |
| 486 | 3300049589 | Ga0501073_0000009 | Ga0501073_0000009_182535_183773 | 409 |
| 487 | 3300049590 | Ga0501074_0000100 | Ga0501074_0000100_22671_23909 | 409 |
| 488 | 3300049741 | Ga0501079_0002676 | Ga0501079_0002676_9758_10996 | 409 |
| 489 | 3300049742 | Ga0501080_0000088 | Ga0501080_0000088_2109_3347 | 409 |
| 490 | 3300049822 | Ga0501035_0000302 | Ga0501035_0000302_44981_46219 | 409 |
| 491 | 3300049822 | Ga0501035_0207527 | Ga0501035_0207527_434_1666 | 409 |
| 492 | 3300049822 | Ga0501035_0252120 | Ga0501035_0252120_67_1299 | 409 |
| 493 | 3300049823 | Ga0501044_0000438 | Ga0501044_0000438_38059_39297 | 409 |
| 494 | 3300049824 | Ga0501045_0002548 | Ga0501045_0002548_6918_8156 | 409 |
| 495 | 3300050492 | nmdc:mga0yw44_4052_c1 | nmdc:mga0yw44_4052_c1_2142_3374 | 409 |
| 496 | 3300050496 | nmdc:mga07m45_56664_c1 | nmdc:mga07m45_56664_c1_962_2194 | 409 |
| 497 | 3300050511 | nmdc:mga08y16_28203_c1 | nmdc:mga08y16_28203_c1_206_1453 | 409 |
| 498 | 3300053085 | Ga0495619_0022363 | Ga0495619_0022363_2597_3832 | 409 |
| 499 | 3300053086 | Ga0500578_0075375 | Ga0500578_0075375_638_1870 | 409 |
| 500 | 3300053089 | Ga0500581_067905 | Ga0500581_067905_433_1665 | 409 |
| 501 | 3300053090 | Ga0500646_0009652 | Ga0500646_0009652_1117_2352 | 409 |
| 502 | 3300053093 | Ga0500651_0107527 | Ga0500651_0107527_201_1433 | 409 |
| 503 | 3300053094 | Ga0500566_0034377 | Ga0500566_0034377_1637_2872 | 409 |
| 504 | 3300053096 | Ga0500641_0043983 | Ga0500641_0043983_123_1391 | 409 |
| 505 | 3300053098 | Ga0500650_0014918 | Ga0500650_0014918_1219_2451 | 409 |
| 506 | 3300053102 | Ga0500554_002276 | Ga0500554_002276_1840_3081 | 409 |
| 507 | 3300053104 | Ga0500556_0001087 | Ga0500556_0001087_4062_5294 | 409 |
| 508 | 3300053108 | Ga0500562_035914 | Ga0500562_035914_49_1281 | 409 |
| 509 | 3300053119 | Ga0500595_006519 | Ga0500595_006519_1955_3187 | 409 |
| 510 | 3300053130 | Ga0500642_0000026 | Ga0500642_0000026_144_1376 | 409 |
| 511 | 3300053131 | Ga0500652_000882 | Ga0500652_000882_4252_5484 | 409 |
| 512 | 3300053134 | Ga0500658_0016838 | Ga0500658_0016838_116_1348 | 409 |
| 513 | 3300053139 | Ga0500568_0002271 | Ga0500568_0002271_3275_4507 | 409 |
| 514 | 3300053142 | Ga0500577_0000744 | Ga0500577_0000744_6956_8248 | 409 |
| 515 | 3300053150 | Ga0500603_001339 | Ga0500603_001339_1896_3137 | 409 |
| 516 | 3300053151 | Ga0500604_0001713 | Ga0500604_0001713_552_1784 | 409 |
| 517 | 3300053153 | Ga0500616_0000031 | Ga0500616_0000031_183532_184764 | 409 |
| 518 | 3300053156 | Ga0500622_0000112 | Ga0500622_0000112_7932_9164 | 409 |
| 519 | 3300053161 | Ga0500634_0040622 | Ga0500634_0040622_365_1600 | 409 |
| 520 | 3300053177 | Ga0500636_0005679 | Ga0500636_0005679_5134_6375 | 409 |
| 521 | 3300053177 | Ga0500636_0041200 | Ga0500636_0041200_437_1672 | 409 |
| 522 | 3300053178 | Ga0500637_0003548 | Ga0500637_0003548_2334_3575 | 409 |
| 523 | 3300053737 | Ga0500601_000034 | Ga0500601_000034_5865_7097 | 409 |
| 524 | 3300054114 | Ga0501084_0005330 | Ga0501084_0005330_2577_3815 | 409 |
| 525 | 3300059643 | Ga0587072_009788 | Ga0587072_009788_241_1473 | 409 |
| 526 | 3300002077 | JGI24744J21845_10008041 | JGI24744J21845_100080411 | 410 |
| 527 | 3300002244 | JGI24742J22300_10000509 | JGI24742J22300_100005096 | 410 |
| 528 | 3300003203 | JGI25406J46586_10000014 | JGI25406J46586_100000147 | 410 |
| 529 | 3300003215 | JGI25153J46596_10038702 | JGI25153J46596_100387021 | 410 |
| 530 | 3300005328 | Ga0070676_10008312 | Ga0070676_100083124 | 410 |
| 531 | 3300005330 | Ga0070690_100002327 | Ga0070690_1000023277 | 410 |
| 532 | 3300005347 | Ga0070668_100015142 | Ga0070668_1000151426 | 410 |
| 533 | 3300005356 | Ga0070674_100000485 | Ga0070674_10000048510 | 410 |
| 534 | 3300005364 | Ga0070673_100028812 | Ga0070673_1000288121 | 410 |
| 535 | 3300005367 | Ga0070667_100081235 | Ga0070667_1000812353 | 410 |
| 536 | 3300005436 | Ga0070713_100128209 | Ga0070713_1001282092 | 410 |
| 537 | 3300005438 | Ga0070701_10035060 | Ga0070701_100350601 | 410 |
| 538 | 3300005441 | Ga0070700_100003300 | Ga0070700_1000033007 | 410 |
| 539 | 3300005455 | Ga0070663_100051334 | Ga0070663_1000513341 | 410 |
| 540 | 3300005456 | Ga0070678_100060893 | Ga0070678_1000608933 | 410 |
| 541 | 3300005457 | Ga0070662_100022601 | Ga0070662_1000226012 | 410 |
| 542 | 3300005459 | Ga0068867_100004714 | Ga0068867_1000047147 | 410 |
| 543 | 3300005468 | Ga0070707_100103748 | Ga0070707_1001037481 | 410 |
| 544 | 3300005518 | Ga0070699_100022502 | Ga0070699_1000225025 | 410 |
| 545 | 3300005536 | Ga0070697_100102688 | Ga0070697_1001026882 | 410 |
| 546 | 3300005543 | Ga0070672_100077955 | Ga0070672_1000779552 | 410 |
| 547 | 3300005544 | Ga0070686_100006029 | Ga0070686_1000060292 | 410 |
| 548 | 3300005548 | Ga0070665_100007932 | Ga0070665_1000079324 | 410 |
| 549 | 3300005549 | Ga0070704_100066334 | Ga0070704_1000663343 | 410 |
| 550 | 3300005614 | Ga0068856_100095555 | Ga0068856_1000955553 | 410 |
| 551 | 3300005615 | Ga0070702_100021652 | Ga0070702_1000216523 | 410 |
| 552 | 3300005616 | Ga0068852_100163403 | Ga0068852_1001634032 | 410 |
| 553 | 3300005718 | Ga0068866_10002087 | Ga0068866_100020874 | 410 |
| 554 | 3300005719 | Ga0068861_100011596 | Ga0068861_1000115964 | 410 |
| 555 | 3300005842 | Ga0068858_100027398 | Ga0068858_1000273985 | 410 |
| 556 | 3300005843 | Ga0068860_100011821 | Ga0068860_1000118212 | 410 |
| 557 | 3300005844 | Ga0068862_100018037 | Ga0068862_1000180373 | 410 |
| 558 | 3300005983 | Ga0081540_1015080 | Ga0081540_10150802 | 410 |
| 559 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008149 | 410 |
| 560 | 3300006175 | Ga0070712_100126315 | Ga0070712_1001263152 | 410 |
| 561 | 3300006881 | Ga0068865_100003839 | Ga0068865_1000038391 | 410 |
| 562 | 3300007265 | Ga0099794_10044444 | Ga0099794_100444442 | 410 |
| 563 | 3300007788 | Ga0099795_10026058 | Ga0099795_100260581 | 410 |
| 564 | 3300009093 | Ga0105240_10080600 | Ga0105240_100806003 | 410 |
| 565 | 3300009098 | Ga0105245_10031810 | Ga0105245_100318103 | 410 |
| 566 | 3300009148 | Ga0105243_10258730 | Ga0105243_102587301 | 410 |
| 567 | 3300009174 | Ga0105241_10059531 | Ga0105241_100595313 | 410 |
| 568 | 3300009176 | Ga0105242_10031596 | Ga0105242_100315962 | 410 |
| 569 | 3300009553 | Ga0105249_10001730 | Ga0105249_100017305 | 410 |
| 570 | 3300010375 | Ga0105239_10056173 | Ga0105239_100561732 | 410 |
| 571 | 3300013296 | Ga0157374_10378168 | Ga0157374_103781681 | 410 |
| 572 | 3300013297 | Ga0157378_10008838 | Ga0157378_100088388 | 410 |
| 573 | 3300013306 | Ga0163162_10009472 | Ga0163162_100094722 | 410 |
| 574 | 3300014325 | Ga0163163_10254404 | Ga0163163_102544042 | 410 |
| 575 | 3300014326 | Ga0157380_10104532 | Ga0157380_101045322 | 410 |
| 576 | 3300014968 | Ga0157379_10019649 | Ga0157379_100196493 | 410 |
| 577 | 3300014968 | Ga0157379_10139631 | Ga0157379_101396312 | 410 |
| 578 | 3300014969 | Ga0157376_10015348 | Ga0157376_100153483 | 410 |
| 579 | 3300017792 | Ga0163161_10001515 | Ga0163161_1000151515 | 410 |
| 580 | 3300025297 | Ga0209758_1022843 | Ga0209758_10228434 | 410 |
| 581 | 3300025315 | Ga0207697_10005623 | Ga0207697_100056232 | 410 |
| 582 | 3300025907 | Ga0207645_10027154 | Ga0207645_100271543 | 410 |
| 583 | 3300025913 | Ga0207695_10062132 | Ga0207695_100621323 | 410 |
| 584 | 3300025916 | Ga0207663_10003842 | Ga0207663_100038426 | 410 |
| 585 | 3300025916 | Ga0207663_10032363 | Ga0207663_100323632 | 410 |
| 586 | 3300025927 | Ga0207687_10056044 | Ga0207687_100560441 | 410 |
| 587 | 3300025928 | Ga0207700_10117579 | Ga0207700_101175792 | 410 |
| 588 | 3300025933 | Ga0207706_10001763 | Ga0207706_1000176311 | 410 |
| 589 | 3300025934 | Ga0207686_10048052 | Ga0207686_100480522 | 410 |
| 590 | 3300025935 | Ga0207709_10006083 | Ga0207709_100060834 | 410 |
| 591 | 3300025937 | Ga0207669_10006404 | Ga0207669_100064043 | 410 |
| 592 | 3300025938 | Ga0207704_10009774 | Ga0207704_100097744 | 410 |
| 593 | 3300025940 | Ga0207691_10011336 | Ga0207691_100113368 | 410 |
| 594 | 3300025941 | Ga0207711_10048746 | Ga0207711_100487462 | 410 |
| 595 | 3300025960 | Ga0207651_10008687 | Ga0207651_100086873 | 410 |
| 596 | 3300025961 | Ga0207712_10037133 | Ga0207712_100371333 | 410 |
| 597 | 3300025972 | Ga0207668_10002534 | Ga0207668_100025346 | 410 |
| 598 | 3300026035 | Ga0207703_10176745 | Ga0207703_101767452 | 410 |
| 599 | 3300026067 | Ga0207678_10004912 | Ga0207678_100049129 | 410 |
| 600 | 3300026075 | Ga0207708_10004920 | Ga0207708_100049207 | 410 |
| 601 | 3300026078 | Ga0207702_10151066 | Ga0207702_101510662 | 410 |
| 602 | 3300026089 | Ga0207648_10006487 | Ga0207648_1000648710 | 410 |
| 603 | 3300026118 | Ga0207675_100054595 | Ga0207675_1000545952 | 410 |
| 604 | 3300026121 | Ga0207683_10014299 | Ga0207683_100142994 | 410 |
| 605 | 3300026142 | Ga0207698_10016038 | Ga0207698_100160381 | 410 |
| 606 | 3300027671 | Ga0209588_1040481 | Ga0209588_10404811 | 410 |
| 607 | 3300028380 | Ga0268265_10040171 | Ga0268265_100401713 | 410 |
| 608 | 3300028381 | Ga0268264_10232828 | Ga0268264_102328281 | 410 |
| 609 | 3300031548 | Ga0307408_100067541 | Ga0307408_1000675411 | 410 |
| 610 | 3300031711 | Ga0265314_10013066 | Ga0265314_100130665 | 410 |
| 611 | 3300035119 | Ga0373956_0032329 | Ga0373956_0032329_982_2217 | 410 |
| 612 | 3300035120 | Ga0373957_0006832 | Ga0373957_0006832_1562_2797 | 410 |
| 613 | 3300035172 | Ga0373955_0032409 | Ga0373955_0032409_101_1336 | 410 |
| 614 | 3300035692 | Ga0373935_0001026 | Ga0373935_0001026_6478_7713 | 410 |
| 615 | 3300035695 | Ga0373927_0002601 | Ga0373927_0002601_10993_12228 | 410 |
| 616 | 3300035695 | Ga0373927_0006364 | Ga0373927_0006364_3723_4964 | 410 |
| 617 | 3300035725 | Ga0373947_0013236 | Ga0373947_0013236_3007_4248 | 410 |
| 618 | 3300036401 | Ga0373937_0201078 | Ga0373937_0201078_522_1763 | 410 |
| 619 | 3300037068 | Ga0373925_0021692 | Ga0373925_0021692_14_1249 | 410 |
| 620 | 3300046455 | Ga0495603_0001156 | Ga0495603_0001156_89_1324 | 410 |
| 621 | 3300046459 | Ga0495629_0007329 | Ga0495629_0007329_6827_8062 | 410 |
| 622 | 3300046463 | Ga0495653_0066838 | Ga0495653_0066838_277_1512 | 410 |
| 623 | 3300046473 | Ga0495582_0003642 | Ga0495582_0003642_6685_7920 | 410 |
| 624 | 3300046475 | Ga0495639_0001339 | Ga0495639_0001339_9530_10765 | 410 |
| 625 | 3300046476 | Ga0495662_0002101 | Ga0495662_0002101_6478_7713 | 410 |
| 626 | 3300046477 | Ga0495664_0047664 | Ga0495664_0047664_501_1736 | 410 |
| 627 | 3300046512 | Ga0495610_0093762 | Ga0495610_0093762_47_1282 | 410 |
| 628 | 3300046514 | Ga0495618_0017747 | Ga0495618_0017747_1269_2504 | 410 |
| 629 | 3300046517 | Ga0495630_0034020 | Ga0495630_0034020_1489_2724 | 410 |
| 630 | 3300046520 | Ga0495637_0045528 | Ga0495637_0045528_544_1779 | 410 |
| 631 | 3300046526 | Ga0495666_0037853 | Ga0495666_0037853_573_1808 | 410 |
| 632 | 3300046529 | Ga0495652_0019981 | Ga0495652_0019981_3431_4666 | 410 |
| 633 | 3300046531 | Ga0495665_0005946 | Ga0495665_0005946_947_2182 | 410 |
| 634 | 3300046543 | Ga0495645_0010090 | Ga0495645_0010090_4566_5801 | 410 |
| 635 | 3300046557 | Ga0495622_0050711 | Ga0495622_0050711_403_1638 | 410 |
| 636 | 3300046615 | Ga0495656_0014767 | Ga0495656_0014767_1294_2526 | 410 |
| 637 | 3300046616 | Ga0495668_0028463 | Ga0495668_0028463_1467_2699 | 410 |
| 638 | 3300046642 | Ga0495634_0010428 | Ga0495634_0010428_439_1674 | 410 |
| 639 | 3300046642 | Ga0495634_0058285 | Ga0495634_0058285_415_1650 | 410 |
| 640 | 3300046663 | Ga0495635_0055049 | Ga0495635_0055049_371_1606 | 410 |
| 641 | 3300046663 | Ga0495635_0166509 | Ga0495635_0166509_59_1294 | 410 |
| 642 | 3300046679 | Ga0495623_0024653 | Ga0495623_0024653_1760_2995 | 410 |
| 643 | 3300046680 | Ga0495646_0024264 | Ga0495646_0024264_1922_3157 | 410 |
| 644 | 3300046680 | Ga0495646_0127115 | Ga0495646_0127115_89_1324 | 410 |
| 645 | 3300046681 | Ga0495647_0023164 | Ga0495647_0023164_70_1305 | 410 |
| 646 | 3300046684 | Ga0495669_0007372 | Ga0495669_0007372_80_1312 | 410 |
| 647 | 3300046690 | Ga0495624_0005387 | Ga0495624_0005387_6735_7970 | 410 |
| 648 | 3300046809 | Ga0495600_0060206 | Ga0495600_0060206_87_1322 | 410 |
| 649 | 3300047315 | Ga0495581_0004974 | Ga0495581_0004974_652_1887 | 410 |
| 650 | 3300047317 | Ga0495604_0083370 | Ga0495604_0083370_844_2079 | 410 |
| 651 | 3300047319 | Ga0495674_0015066 | Ga0495674_0015066_348_1583 | 410 |
| 652 | 3300047320 | Ga0495672_0055278 | Ga0495672_0055278_834_2069 | 410 |
| 653 | 3300047321 | Ga0495676_0095338 | Ga0495676_0095338_492_1727 | 410 |
| 654 | 3300047322 | Ga0495680_0028899 | Ga0495680_0028899_1290_2525 | 410 |
| 655 | 3300047471 | Ga0495684_0011768 | Ga0495684_0011768_4720_5955 | 410 |
| 656 | 3300047673 | Ga0495593_0004447 | Ga0495593_0004447_1063_2298 | 410 |
| 657 | 3300048088 | Ga0495602_0039952 | Ga0495602_0039952_2911_4146 | 410 |
| 658 | 3300048904 | Ga0496101_0028077 | Ga0496101_0028077_2516_3748 | 410 |
| 659 | 3300048907 | Ga0496104_0141974 | Ga0496104_0141974_103_1365 | 410 |
| 660 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_222016_223251 | 410 |
| 661 | 3300048918 | Ga0496115_0263974 | Ga0496115_0263974_132_1364 | 410 |
| 662 | 3300048924 | Ga0496121_0000774 | Ga0496121_0000774_49239_50474 | 410 |
| 663 | 3300048924 | Ga0496121_0001681 | Ga0496121_0001681_8389_9624 | 410 |
| 664 | 3300048929 | Ga0496126_0046515 | Ga0496126_0046515_1919_3154 | 410 |
| 665 | 3300050492 | nmdc:mga0yw44_72733_c1 | nmdc:mga0yw44_72733_c1_17_1252 | 410 |
| 666 | 3300050512 | nmdc:mga0n895_361601_c1 | nmdc:mga0n895_361601_c1_176_1408 | 410 |
| 667 | 3300053077 | Ga0495601_0116640 | Ga0495601_0116640_37_1299 | 410 |
| 668 | 3300053078 | Ga0495612_0008890 | Ga0495612_0008890_1618_2853 | 410 |
| 669 | 3300053084 | Ga0495595_0025822 | Ga0495595_0025822_80_1315 | 410 |
| 670 | 3300053085 | Ga0495619_0012259 | Ga0495619_0012259_3376_4611 | 410 |
| 671 | 3300053085 | Ga0495619_0014546 | Ga0495619_0014546_3038_4273 | 410 |
| 672 | 3300053119 | Ga0500595_011091 | Ga0500595_011091_272_1507 | 410 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jfn-assembly1.cif.gz_A | crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation | 0.9133 | 22 | 409 |
| 7jfn-assembly1.cif.gz_A | crystal structure of leucine-, isoleucine-, valine-, threonine-, and alanine-binding protein from brucella ovis, closed conformation | 0.9066 | 22 | 409 |
| 1z18-assembly1.cif.gz_A | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8757 | 22 | 368 |
| 3ip9-assembly1.cif.gz_A | structure of atu2422-gaba receptor in complex with gaba | 0.8721 | 23 | 389 |
| 4evr-assembly1.cif.gz_A | crystal structure of abc transporter from r. palustris - solute binding protein (rpa0668) in complex with benzoate | 0.8683 | 23 | 395 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i45A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9067 | 149 | 260 | 3.40.50.2300 |
| 3i45A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.894 | 22 | 360 | 3.40.50.2300 |
| 3i45A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8727 | 22 | 360 | 3.40.50.2300 |
| af_P04816_25_358_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.8675 | 24 | 360 | 3.40.190.10 |
| af_Q69NA5_27_147_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8662 | 23 | 149 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3YBG4-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9702 | 40 | 409 |
|
| AF-A0A315BBB9-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9619 | 33 | 410 |
|
| AF-A0A4Q3J205-F1-model_v4 | deleted | 0.9539 | 275 | 408 |
|
| AF-A0A1F3YBG4-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9475 | 40 | 409 |
|
| AF-A0A3S0G2G8-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9474 | 5 | 399 |
GO:0006865
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar