F474166

General Info

Members Datasets Scaffolds Average Seq Length
671 340 621 389

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10000228|Ga0307511_1000022824
Length 431
Sequence MINEGLKFGCKGKGEQGKIRNSIAQIPKNVYSSSELSIFALSDHFMQLIPITTPSQAKEFIQANVQLNRQNPAYIRPIDAEIDEVFDPAKNKAFRHGEITRWVLKDEEGKLIGRIAAFVNKKYKTKGDDVPVGGIGFFDCINDQEAADMLLDVARHWLSQRGMEAMDGPINFGERDKWWGLLTEGFYEPLYGMNFNPPYYRELLENYGFRPFFHQLCFSMDYKKPLNAKLQRRHETLAADPAYSARMIDKRQLLKFAEDFIAIYNPAYAGHGGLKEMKKDQAVQLFKKMKPLMDEKIVWFVYHNERPIAMFLNIPDLNQYFKHFNGRFGLLQKLYFLWLRRRGACKRFTGILFAIIPEFQGKGVDGYMIVEAGKVVQHQSSYEDYEMQWIGDFNPKMVNIAKGLGEVNRKLTTYRYLFDRAKEFKRHPMLS

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
3 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
4 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
5 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
6 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
7 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
8 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
9 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
10 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
11 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
12 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
13 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
14 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
15 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
16 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
17 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
18 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
19 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
20 2738541278 Niastella sp. CF465 Isolate Unclassified
21 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
22 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
23 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
24 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
25 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
26 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
27 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
28 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
29 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
30 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
31 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
32 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
33 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
34 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
35 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
36 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
37 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
38 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
39 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
40 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
41 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
42 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
43 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
44 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
45 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
46 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
47 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
48 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
49 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
50 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
51 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
52 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
53 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
54 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
55 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
56 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
57 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
58 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
59 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
60 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
61 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
62 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
63 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
64 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
67 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
68 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
69 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
77 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
78 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
79 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
80 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
81 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
82 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
83 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
84 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
89 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
90 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
91 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
92 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
93 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
94 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
95 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
98 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
99 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
103 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
104 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
105 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
106 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
107 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
108 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
109 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
110 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
111 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
112 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
113 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
114 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
115 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
116 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
117 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
118 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
124 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
125 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
126 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
127 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
128 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
129 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
130 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
131 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
132 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
133 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
140 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
141 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
154 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
157 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
166 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
216 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
217 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
218 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
219 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
220 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
224 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
225 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
239 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
240 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
241 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
242 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
245 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
246 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
247 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
251 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
252 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
256 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
257 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
258 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
262 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
269 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
270 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
271 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
272 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
273 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
277 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
285 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
286 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
287 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
310 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
311 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
312 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
313 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
314 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
315 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
316 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
317 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
318 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
319 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
320 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
321 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
322 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
330 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
331 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
332 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
333 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
334 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
339 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.55
Metatranscriptomes 0
Isolates 7.45

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 5.96
Nodule 0.15
Rhizoplane 0.6
Rhizosphere 84.95
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1002211 3300001915 Bacteria 5163
2 JGI24744J21845_10007449 3300002077 Bacteria 2261
3 rootH1_10079717 3300003316 Bacteria 3130
4 rootH2_10009982 3300003320 Bacteria 25986
5 rootH2_10037920 3300003320 Bacteria 1945
6 rootH2_10050136 3300003320 Bacteria 12982
7 rootH2_10076592 3300003320 Bacteria 1912
8 rootL2_10266713 3300003322 Unclassified 1345
9 rootH1_10098969 3300003323 Bacteria 10813
10 rootH1_10259345 3300003323 Bacteria 6300
11 JGI25160J50197_1002332 3300003354 Bacteria 8881
12 Ga0055535_1007746 3300003761 Bacteria 2013
13 Ga0055534_1014363 3300003784 Bacteria 1486
14 Ga0055528_1000307 3300003790 Bacteria 41483
15 Ga0055528_1007947 3300003790 Bacteria 4622
16 Ga0055530_10001712 3300003791 Bacteria 15455
17 Ga0055531_10029535 3300003794 Unclassified 1865
18 Ga0055543_1006891 3300004625 Bacteria 2689
19 Ga0065165_1000722 3300005262 Bacteria 46444
20 Ga0065704_10020003 3300005289 Bacteria 1572
21 Ga0065707_10159377 3300005295 Bacteria 1577
22 Ga0070658_10036022 3300005327 Bacteria 3987
23 Ga0070658_10063362 3300005327 Unclassified 3014
24 Ga0070658_10076384 3300005327 Bacteria 2747
25 Ga0070658_10101670 3300005327 Bacteria 2376
26 Ga0070676_10005231 3300005328 Bacteria 6897
27 Ga0070676_10061783 3300005328 Bacteria 2227
28 Ga0070683_100004016 3300005329 Bacteria 12045
29 Ga0070683_100131528 3300005329 Bacteria 2368
30 Ga0070690_100052813 3300005330 Bacteria 2599
31 Ga0070690_100138638 3300005330 Bacteria 1649
32 Ga0070690_100149921 3300005330 Bacteria 1590
33 Ga0068869_100018653 3300005334 Bacteria 4727
34 Ga0068869_100029041 3300005334 Bacteria 3870
35 Ga0068869_100033033 3300005334 Bacteria 3651
36 Ga0068869_100052755 3300005334 Bacteria 2954
37 Ga0068869_100085349 3300005334 Bacteria 2365
38 Ga0070666_10000031 3300005335 Bacteria 132089
39 Ga0070666_10015920 3300005335 Bacteria 4804
40 Ga0070666_10158582 3300005335 Bacteria 1581
41 Ga0070680_100019674 3300005336 Bacteria 5354
42 Ga0070680_100052971 3300005336 Bacteria 3312
43 Ga0070680_100139304 3300005336 Bacteria 2034
44 Ga0070682_100000152 3300005337 Bacteria 54283
45 Ga0070682_100001276 3300005337 Bacteria 14283
46 Ga0070682_100032428 3300005337 Bacteria 3168
47 Ga0068868_100037647 3300005338 Bacteria 3751
48 Ga0068868_100341245 3300005338 Bacteria 1281
49 Ga0070660_100000201 3300005339 Bacteria 39920
50 Ga0070660_100027411 3300005339 Bacteria 4251
51 Ga0070660_100032879 3300005339 Bacteria 3907
52 Ga0070660_100063853 3300005339 Bacteria 2863
53 Ga0070689_100004257 3300005340 Bacteria 9644
54 Ga0070689_100065057 3300005340 Bacteria 2839
55 Ga0070689_100107592 3300005340 Bacteria 2214
56 Ga0070689_100214550 3300005340 Bacteria 1576
57 Ga0070687_100016820 3300005343 Bacteria 3348
58 Ga0070687_100067809 3300005343 Bacteria 1906
59 Ga0070661_100223479 3300005344 Bacteria 1445
60 Ga0070668_100049616 3300005347 Bacteria 3229
61 Ga0070669_100110056 3300005353 Bacteria 2089
62 Ga0070669_100289760 3300005353 Bacteria 1314
63 Ga0070675_100040413 3300005354 Bacteria 3807
64 Ga0070675_100061496 3300005354 Bacteria 3101
65 Ga0070675_100078587 3300005354 Bacteria 2748
66 Ga0070675_100107187 3300005354 Bacteria 2359
67 Ga0070671_100033594 3300005355 Unclassified 4244
68 Ga0070673_100034978 3300005364 Bacteria 3807
69 Ga0070673_100052550 3300005364 Bacteria 3197
70 Ga0070688_100003898 3300005365 Bacteria 7739
71 Ga0070688_100121359 3300005365 Bacteria 1751
72 Ga0070688_100122504 3300005365 Unclassified 1744
73 Ga0070659_100004878 3300005366 Bacteria 9586
74 Ga0070667_100004341 3300005367 Bacteria 11955
75 Ga0070667_100017484 3300005367 Bacteria 5943
76 Ga0070667_100095160 3300005367 Bacteria 2567
77 Ga0070667_100184404 3300005367 Bacteria 1846
78 Ga0070667_100231935 3300005367 Bacteria 1646
79 Ga0070700_100056409 3300005441 Bacteria 2462
80 Ga0070663_100224131 3300005455 Bacteria 1477
81 Ga0070662_100074215 3300005457 Bacteria 2515
82 Ga0070681_10016117 3300005458 Bacteria 7450
83 Ga0070681_10078377 3300005458 Bacteria 3261
84 Ga0068867_100011283 3300005459 Bacteria 6302
85 Ga0070685_10004480 3300005466 Bacteria 7066
86 Ga0070685_10023197 3300005466 Bacteria 3395
87 Ga0070698_100001241 3300005471 Bacteria 28439
88 Ga0070698_100003438 3300005471 Bacteria 17408
89 Ga0070698_100010706 3300005471 Bacteria 9767
90 Ga0070698_100168177 3300005471 Bacteria 2134
91 Ga0070679_100000836 3300005530 Bacteria 26787
92 Ga0070679_100034505 3300005530 Bacteria 5014
93 Ga0070684_100000232 3300005535 Bacteria 38587
94 Ga0070684_100004401 3300005535 Bacteria 10717
95 Ga0070684_100145662 3300005535 Bacteria 2144
96 Ga0068853_100000103 3300005539 Bacteria 57277
97 Ga0068853_100015582 3300005539 Bacteria 6245
98 Ga0068853_100040621 3300005539 Bacteria 3970
99 Ga0068853_100108228 3300005539 Bacteria 2466
100 Ga0068853_100312223 3300005539 Bacteria 1456
101 Ga0070672_100079740 3300005543 Bacteria 2621
102 Ga0070686_100008636 3300005544 Bacteria 5708
103 Ga0070693_100129416 3300005547 Bacteria 1576
104 Ga0070665_100004340 3300005548 Bacteria 14914
105 Ga0070665_100202416 3300005548 Unclassified 1986
106 Ga0068855_100031705 3300005563 Bacteria 6310
107 Ga0068855_100041522 3300005563 Bacteria 5451
108 Ga0068855_100078179 3300005563 Bacteria 3839
109 Ga0068855_100113607 3300005563 Bacteria 3106
110 Ga0068855_100127024 3300005563 Bacteria 2915
111 Ga0068855_100133045 3300005563 Bacteria 2839
112 Ga0070664_100205394 3300005564 Bacteria 1759
113 Ga0068857_100003404 3300005577 Bacteria 13251
114 Ga0068857_100004875 3300005577 Bacteria 11385
115 Ga0068857_100012331 3300005577 Bacteria 7439
116 Ga0068857_100103068 3300005577 Bacteria 2562
117 Ga0068854_100091866 3300005578 Bacteria 2260
118 Ga0068856_100025473 3300005614 Bacteria 5769
119 Ga0068856_100123380 3300005614 Bacteria 2593
120 Ga0068856_100165314 3300005614 Bacteria 2224
121 Ga0068856_100270077 3300005614 Unclassified 1717
122 Ga0068856_100282956 3300005614 Bacteria 1675
123 Ga0070702_100009538 3300005615 Bacteria 4755
124 Ga0068852_100001078 3300005616 Bacteria 18040
125 Ga0068852_100011910 3300005616 Bacteria 6577
126 Ga0068852_100063037 3300005616 Bacteria 3226
127 Ga0068859_100000045 3300005617 Bacteria 143607
128 Ga0068859_100030038 3300005617 Bacteria 5453
129 Ga0068859_100033339 3300005617 Bacteria 5172
130 Ga0068859_100094941 3300005617 Unclassified 3035
131 Ga0068859_100097286 3300005617 Bacteria 2996
132 Ga0068859_100141676 3300005617 Bacteria 2478
133 Ga0068864_100001622 3300005618 Bacteria 18523
134 Ga0068864_100045766 3300005618 Bacteria 3754
135 Ga0068861_100003382 3300005719 Bacteria 10578
136 Ga0068870_10036100 3300005840 Bacteria 2541
137 Ga0068863_100003089 3300005841 Bacteria 16457
138 Ga0068863_100006337 3300005841 Bacteria 11603
139 Ga0068863_100271972 3300005841 Bacteria 1640
140 Ga0068858_100024945 3300005842 Bacteria 5565
141 Ga0068858_100084450 3300005842 Bacteria 2953
142 Ga0068858_100126819 3300005842 Unclassified 2390
143 Ga0068860_100001289 3300005843 Bacteria 27204
144 Ga0068860_100007137 3300005843 Bacteria 11176
145 Ga0068860_100010059 3300005843 Bacteria 9372
146 Ga0068860_100011449 3300005843 Bacteria 8738
147 Ga0068860_100044074 3300005843 Bacteria 4253
148 Ga0068862_100035626 3300005844 Bacteria 4216
149 Ga0081540_1021338 3300005983 Bacteria 3861
150 Ga0075366_10017458 3300006195 Bacteria 4130
151 Ga0075366_10121674 3300006195 Bacteria 1573
152 Ga0097621_100001013 3300006237 Bacteria 19778
153 Ga0097621_100011779 3300006237 Bacteria 6458
154 Ga0097621_100154600 3300006237 Bacteria 1968
155 Ga0097621_100163905 3300006237 Bacteria 1912
156 Ga0068871_100007075 3300006358 Bacteria 7998
157 Ga0068871_100015208 3300006358 Bacteria 5754
158 Ga0068871_100082353 3300006358 Bacteria 2668
159 Ga0068871_100173743 3300006358 Bacteria 1848
160 Ga0068871_100279132 3300006358 Bacteria 1461
161 Ga0075428_100010044 3300006844 Bacteria 10516
162 Ga0075428_100048626 3300006844 Unclassified 4655
163 Ga0075430_100034545 3300006846 Bacteria 4291
164 Ga0075431_100009298 3300006847 Bacteria 9860
165 Ga0075431_100028606 3300006847 Bacteria 5730
166 Ga0075429_100006202 3300006880 Bacteria 10343
167 Ga0068865_100081601 3300006881 Unclassified 2323
168 Ga0097620_100000045 3300006931 Bacteria 143607
169 Ga0097620_100030038 3300006931 Bacteria 5453
170 Ga0097620_100033339 3300006931 Bacteria 5172
171 Ga0097620_100094942 3300006931 Unclassified 3035
172 Ga0097620_100097286 3300006931 Bacteria 2996
173 Ga0097620_100141676 3300006931 Bacteria 2478
174 Ga0105244_10000160 3300009036 Bacteria 69914
175 Ga0105240_10000040 3300009093 Bacteria 264634
176 Ga0105240_10001675 3300009093 Bacteria 37595
177 Ga0105240_10016117 3300009093 Bacteria 10127
178 Ga0105240_10016598 3300009093 Bacteria 9963
179 Ga0105240_10019498 3300009093 Bacteria 9060
180 Ga0105240_10022970 3300009093 Bacteria 8261
181 Ga0105240_10030232 3300009093 Bacteria 7041
182 Ga0105240_10044822 3300009093 Bacteria 5615
183 Ga0105240_10049425 3300009093 Bacteria 5307
184 Ga0105240_10060410 3300009093 Bacteria 4725
185 Ga0105240_10126436 3300009093 Bacteria 3071
186 Ga0111539_10061973 3300009094 Bacteria 4429
187 Ga0111539_10085088 3300009094 Bacteria 3717
188 Ga0111539_10127052 3300009094 Unclassified 2986
189 Ga0111539_10157559 3300009094 Unclassified 2657
190 Ga0105247_10001867 3300009101 Bacteria 14743
191 Ga0105247_10048650 3300009101 Bacteria 2604
192 Ga0114129_10005331 3300009147 Bacteria 18156
193 Ga0114129_10022630 3300009147 Bacteria 8914
194 Ga0105243_10000734 3300009148 Bacteria 31383
195 Ga0105241_10001060 3300009174 Bacteria 20957
196 Ga0105241_10009040 3300009174 Bacteria 7329
197 Ga0105241_10023896 3300009174 Bacteria 4536
198 Ga0105241_10134609 3300009174 Bacteria 2005
199 Ga0105241_10345116 3300009174 Bacteria 1291
200 Ga0105242_10012376 3300009176 Bacteria 6567
201 Ga0105242_10111192 3300009176 Bacteria 2335
202 Ga0105242_10134512 3300009176 Bacteria 2138
203 Ga0105242_10136704 3300009176 Bacteria 2122
204 Ga0105237_10000710 3300009545 Bacteria 46041
205 Ga0105237_10002600 3300009545 Bacteria 22265
206 Ga0105237_10006952 3300009545 Bacteria 12475
207 Ga0105237_10008509 3300009545 Bacteria 11097
208 Ga0105237_10012157 3300009545 Bacteria 9081
209 Ga0105237_10017744 3300009545 Bacteria 7378
210 Ga0105237_10056726 3300009545 Bacteria 3920
211 Ga0105237_10081659 3300009545 Bacteria 3223
212 Ga0105238_10021649 3300009551 Bacteria 6549
213 Ga0105238_10043345 3300009551 Bacteria 4553
214 Ga0105249_10002002 3300009553 Bacteria 17698
215 Ga0105249_10002678 3300009553 Bacteria 15401
216 Ga0105249_10003252 3300009553 Bacteria 14074
217 Ga0105249_10025900 3300009553 Bacteria 5283
218 Ga0105249_10066632 3300009553 Bacteria 3315
219 Ga0105249_10078162 3300009553 Bacteria 3070
220 Ga0105249_10223003 3300009553 Bacteria 1856
221 Ga0105249_10350883 3300009553 Bacteria 1495
222 Ga0105239_10000133 3300010375 Bacteria 105033
223 Ga0105239_10000155 3300010375 Bacteria 98415
224 Ga0105239_10002424 3300010375 Bacteria 23755
225 Ga0105239_10003358 3300010375 Bacteria 19664
226 Ga0105239_10012014 3300010375 Bacteria 9656
227 Ga0105239_10041014 3300010375 Bacteria 5073
228 Ga0105239_10059834 3300010375 Bacteria 4180
229 Ga0105239_10081324 3300010375 Bacteria 3565
230 Ga0105239_10198320 3300010375 Bacteria 2248
231 Ga0105239_10205777 3300010375 Bacteria 2205
232 Ga0105246_10058294 3300011119 Bacteria 2675
233 Ga0105246_10083019 3300011119 Bacteria 2288
234 Ga0157373_10000006 3300013100 Bacteria 261768
235 Ga0157373_10008939 3300013100 Bacteria 7410
236 Ga0157373_10091116 3300013100 Bacteria 2147
237 Ga0157373_10151782 3300013100 Bacteria 1629
238 Ga0157371_10002372 3300013102 Bacteria 18010
239 Ga0157371_10018427 3300013102 Bacteria 5162
240 Ga0157371_10021384 3300013102 Bacteria 4750
241 Ga0157371_10021719 3300013102 Bacteria 4709
242 Ga0157371_10123604 3300013102 Bacteria 1840
243 Ga0157371_10202293 3300013102 Bacteria 1424
244 Ga0157370_10000585 3300013104 Bacteria 45433
245 Ga0157370_10001018 3300013104 Bacteria 35308
246 Ga0157370_10033056 3300013104 Bacteria 5045
247 Ga0157370_10098774 3300013104 Bacteria 2737
248 Ga0157370_10138597 3300013104 Bacteria 2267
249 Ga0157370_10162662 3300013104 Bacteria 2076
250 Ga0157370_10266930 3300013104 Bacteria 1581
251 Ga0157369_10036682 3300013105 Bacteria 5370
252 Ga0157369_10044601 3300013105 Bacteria 4825
253 Ga0157369_10302959 3300013105 Bacteria 1662
254 Ga0157374_10000025 3300013296 Bacteria 245131
255 Ga0157374_10053493 3300013296 Bacteria 3764
256 Ga0157374_10134520 3300013296 Bacteria 2395
257 Ga0157374_10139202 3300013296 Bacteria 2355
258 Ga0157378_10010333 3300013297 Bacteria 8149
259 Ga0157378_10016998 3300013297 Bacteria 6378
260 Ga0157378_10069852 3300013297 Bacteria 3152
261 Ga0157378_10346894 3300013297 Bacteria 1449
262 Ga0163162_10001289 3300013306 Bacteria 23440
263 Ga0163162_10006376 3300013306 Bacteria 11422
264 Ga0163162_10033897 3300013306 Bacteria 5077
265 Ga0163162_10040893 3300013306 Bacteria 4637
266 Ga0163162_10120363 3300013306 Bacteria 2729
267 Ga0163162_10510372 3300013306 Bacteria 1332
268 Ga0157372_10000294 3300013307 Bacteria 55599
269 Ga0157372_10000582 3300013307 Bacteria 39937
270 Ga0157372_10013871 3300013307 Bacteria 8607
271 Ga0157372_10018908 3300013307 Bacteria 7414
272 Ga0157372_10024498 3300013307 Bacteria 6557
273 Ga0157372_10042920 3300013307 Bacteria 5005
274 Ga0157372_10070836 3300013307 Bacteria 3924
275 Ga0157372_10153881 3300013307 Bacteria 2655
276 Ga0157372_10214981 3300013307 Bacteria 2228
277 Ga0157375_10000209 3300013308 Bacteria 54570
278 Ga0157375_10096980 3300013308 Bacteria 3022
279 Ga0157375_10179898 3300013308 Bacteria 2266
280 Ga0157375_10216686 3300013308 Bacteria 2072
281 Ga0163163_10040361 3300014325 Unclassified 4557
282 Ga0163163_10069315 3300014325 Bacteria 3511
283 Ga0163163_10227992 3300014325 Bacteria 1912
284 Ga0163163_10285138 3300014325 Bacteria 1703
285 Ga0157380_10000085 3300014326 Bacteria 52062
286 Ga0182008_10000003 3300014497 Bacteria 456880
287 Ga0157377_10007687 3300014745 Bacteria 5222
288 Ga0157376_10000892 3300014969 Bacteria 19514
289 Ga0157376_10063722 3300014969 Bacteria 3106
290 Ga0182006_1000001 3300015261 Bacteria 1091090
291 Ga0182005_1000071 3300015265 Bacteria 84771
292 Ga0163161_10032678 3300017792 Bacteria 3717
293 Ga0163161_10213990 3300017792 Bacteria 1490
294 Ga0163161_10225004 3300017792 Bacteria 1454
295 Ga0209436_102850 3300025208 Bacteria 4896
296 Ga0209258_100075 3300025242 Bacteria 270751
297 Ga0209646_1000876 3300025246 Bacteria 9991
298 Ga0209148_1000085 3300025254 Bacteria 265193
299 Ga0209673_1000242 3300025273 Bacteria 104669
300 Ga0209675_1003045 3300025291 Bacteria 8225
301 Ga0209758_1005981 3300025297 Bacteria 9011
302 Ga0209758_1008438 3300025297 Bacteria 6672
303 Ga0209050_1000298 3300025298 Bacteria 104315
304 Ga0207426_1001104 3300025302 Bacteria 24841
305 Ga0207426_1003320 3300025302 Bacteria 8903
306 Ga0207426_1011838 3300025302 Bacteria 3301
307 Ga0209257_1001270 3300025304 Bacteria 30945
308 Ga0207655_1000016 3300025728 Bacteria 551476
309 Ga0207710_10001020 3300025900 Bacteria 14622
310 Ga0207710_10024388 3300025900 Bacteria 2604
311 Ga0207688_10145581 3300025901 Bacteria 1397
312 Ga0207680_10000381 3300025903 Bacteria 21208
313 Ga0207680_10157501 3300025903 Bacteria 1520
314 Ga0207647_10009037 3300025904 Bacteria 7095
315 Ga0207647_10052313 3300025904 Bacteria 2521
316 Ga0207645_10022683 3300025907 Bacteria 4081
317 Ga0207645_10090423 3300025907 Bacteria 1968
318 Ga0207643_10002262 3300025908 Bacteria 10493
319 Ga0207705_10009260 3300025909 Bacteria 7164
320 Ga0207654_10002167 3300025911 Bacteria 10053
321 Ga0207654_10014389 3300025911 Bacteria 4087
322 Ga0207654_10014404 3300025911 Bacteria 4086
323 Ga0207654_10021660 3300025911 Bacteria 3420
324 Ga0207654_10166300 3300025911 Bacteria 1428
325 Ga0207707_10247460 3300025912 Unclassified 1549
326 Ga0207695_10000041 3300025913 Bacteria 450902
327 Ga0207695_10000282 3300025913 Bacteria 126242
328 Ga0207695_10000363 3300025913 Bacteria 103522
329 Ga0207695_10000647 3300025913 Bacteria 69264
330 Ga0207695_10002667 3300025913 Bacteria 26073
331 Ga0207695_10029084 3300025913 Bacteria 6115
332 Ga0207695_10061184 3300025913 Bacteria 3893
333 Ga0207671_10007629 3300025914 Bacteria 9351
334 Ga0207671_10020255 3300025914 Bacteria 5066
335 Ga0207671_10021298 3300025914 Bacteria 4920
336 Ga0207671_10146567 3300025914 Bacteria 1821
337 Ga0207660_10009202 3300025917 Bacteria 6390
338 Ga0207657_10001516 3300025919 Bacteria 24881
339 Ga0207657_10020393 3300025919 Bacteria 6264
340 Ga0207657_10034034 3300025919 Bacteria 4587
341 Ga0207649_10021758 3300025920 Bacteria 3697
342 Ga0207649_10287051 3300025920 Bacteria 1198
343 Ga0207652_10008365 3300025921 Bacteria 8321
344 Ga0207652_10009232 3300025921 Bacteria 7934
345 Ga0207681_10016298 3300025923 Bacteria 4647
346 Ga0207681_10024666 3300025923 Bacteria 3861
347 Ga0207681_10227426 3300025923 Bacteria 1446
348 Ga0207694_10046142 3300025924 Bacteria 3368
349 Ga0207694_10151790 3300025924 Bacteria 1867
350 Ga0207659_10067709 3300025926 Bacteria 2594
351 Ga0207644_10201161 3300025931 Bacteria 1571
352 Ga0207706_10009214 3300025933 Bacteria 9068
353 Ga0207706_10028796 3300025933 Bacteria 4958
354 Ga0207686_10001766 3300025934 Bacteria 12028
355 Ga0207686_10100521 3300025934 Bacteria 1930
356 Ga0207686_10153098 3300025934 Bacteria 1607
357 Ga0207709_10000355 3300025935 Bacteria 46675
358 Ga0207670_10004749 3300025936 Bacteria 7369
359 Ga0207670_10005483 3300025936 Bacteria 6970
360 Ga0207670_10085741 3300025936 Bacteria 2214
361 Ga0207669_10002707 3300025937 Bacteria 7584
362 Ga0207691_10001776 3300025940 Bacteria 21223
363 Ga0207691_10056602 3300025940 Bacteria 3572
364 Ga0207689_10002278 3300025942 Bacteria 17956
365 Ga0207689_10005351 3300025942 Bacteria 11492
366 Ga0207689_10005867 3300025942 Bacteria 10885
367 Ga0207689_10009880 3300025942 Bacteria 8225
368 Ga0207689_10024182 3300025942 Bacteria 5096
369 Ga0207661_10022325 3300025944 Bacteria 4764
370 Ga0207661_10025164 3300025944 Unclassified 4523
371 Ga0207679_10013108 3300025945 Bacteria 5428
372 Ga0207679_10188528 3300025945 Bacteria 1712
373 Ga0207667_10000403 3300025949 Bacteria 58481
374 Ga0207667_10002943 3300025949 Bacteria 21138
375 Ga0207667_10024878 3300025949 Bacteria 6565
376 Ga0207667_10069889 3300025949 Bacteria 3655
377 Ga0207667_10083746 3300025949 Bacteria 3302
378 Ga0207667_10260123 3300025949 Bacteria 1775
379 Ga0207651_10014588 3300025960 Bacteria 4543
380 Ga0207712_10002600 3300025961 Bacteria 11579
381 Ga0207712_10002732 3300025961 Bacteria 11271
382 Ga0207712_10005321 3300025961 Bacteria 8126
383 Ga0207712_10007140 3300025961 Bacteria 7047
384 Ga0207712_10020061 3300025961 Bacteria 4373
385 Ga0207668_10096611 3300025972 Bacteria 2184
386 Ga0207640_10035820 3300025981 Bacteria 3110
387 Ga0207658_10003968 3300025986 Bacteria 10391
388 Ga0207658_10118474 3300025986 Bacteria 2106
389 Ga0207677_10041580 3300026023 Bacteria 3041
390 Ga0207677_10160302 3300026023 Bacteria 1747
391 Ga0207703_10009138 3300026035 Bacteria 7802
392 Ga0207703_10046177 3300026035 Bacteria 3507
393 Ga0207703_10092251 3300026035 Bacteria 2549
394 Ga0207703_10395356 3300026035 Bacteria 1281
395 Ga0207639_10000812 3300026041 Bacteria 21212
396 Ga0207639_10007187 3300026041 Bacteria 7586
397 Ga0207639_10073213 3300026041 Bacteria 2685
398 Ga0207639_10079850 3300026041 Bacteria 2586
399 Ga0207639_10098994 3300026041 Bacteria 2352
400 Ga0207708_10035730 3300026075 Bacteria 3782
401 Ga0207702_10091585 3300026078 Bacteria 2662
402 Ga0207702_10116976 3300026078 Bacteria 2380
403 Ga0207702_10210810 3300026078 Unclassified 1806
404 Ga0207641_10000133 3300026088 Bacteria 109199
405 Ga0207641_10000549 3300026088 Bacteria 42051
406 Ga0207641_10033652 3300026088 Bacteria 4258
407 Ga0207648_10018930 3300026089 Bacteria 6220
408 Ga0207648_10027799 3300026089 Bacteria 5018
409 Ga0207648_10052785 3300026089 Bacteria 3555
410 Ga0207648_10102280 3300026089 Bacteria 2511
411 Ga0207648_10125193 3300026089 Bacteria 2260
412 Ga0207676_10021480 3300026095 Bacteria 4735
413 Ga0207676_10276046 3300026095 Bacteria 1524
414 Ga0207676_10381976 3300026095 Bacteria 1311
415 Ga0207676_10415124 3300026095 Bacteria 1261
416 Ga0207674_10000600 3300026116 Bacteria 47324
417 Ga0207674_10000755 3300026116 Bacteria 42269
418 Ga0207674_10049258 3300026116 Bacteria 4309
419 Ga0207674_10134557 3300026116 Bacteria 2434
420 Ga0207674_10172946 3300026116 Bacteria 2113
421 Ga0207674_10199914 3300026116 Bacteria 1948
422 Ga0207675_100005880 3300026118 Bacteria 11706
423 Ga0207675_100039927 3300026118 Bacteria 4379
424 Ga0207683_10051263 3300026121 Bacteria 3616
425 Ga0207698_10004932 3300026142 Bacteria 8180
426 Ga0207698_10037744 3300026142 Unclassified 3561
427 Ga0207698_10327172 3300026142 Bacteria 1438
428 Ga0268266_10000026 3300028379 Bacteria 434485
429 Ga0268264_10000015 3300028381 Bacteria 508501
430 Ga0268264_10000019 3300028381 Bacteria 488112
431 Ga0268264_10000054 3300028381 Bacteria 317048
432 Ga0268264_10001568 3300028381 Bacteria 21208
433 Ga0268264_10008314 3300028381 Bacteria 8626
434 Ga0268264_10019724 3300028381 Bacteria 5508
435 Ga0268264_10049395 3300028381 Bacteria 3500
436 Ga0265323_10000858 3300028653 Bacteria 16158
437 Ga0265336_10018321 3300028666 Bacteria 2270
438 Ga0307517_10000651 3300028786 Bacteria 59585
439 Ga0307515_10000001 3300028794 Bacteria 4259510
440 Ga0307511_10000228 3300030521 Bacteria 57237
441 Ga0265327_10021796 3300031251 Bacteria 3855
442 Ga0265316_10000401 3300031344 Bacteria 49342
443 Ga0265316_10007723 3300031344 Bacteria 10080
444 Ga0307513_10128346 3300031456 Bacteria 2486
445 Ga0307509_10201839 3300031507 Bacteria 1824
446 Ga0265342_10069366 3300031712 Unclassified 2059
447 Ga0307516_10001571 3300031730 Bacteria 31452
448 Ga0307516_10069974 3300031730 Bacteria 3374
449 Ga0307412_10000036 3300031911 Bacteria 192270
450 Ga0307412_10000677 3300031911 Bacteria 19768
451 Ga0307412_10009055 3300031911 Bacteria 5704
452 Ga0307416_100000006 3300032002 Bacteria 466074
453 Ga0307414_10000043 3300032004 Bacteria 137764
454 Ga0307414_10000118 3300032004 Bacteria 56182
455 Ga0307414_10002983 3300032004 Bacteria 8960
456 Ga0307414_10025499 3300032004 Bacteria 3789
457 Ga0307414_10037854 3300032004 Bacteria 3234
458 Ga0307510_10000650 3300033180 Bacteria 35339
459 Ga0373955_0044342 3300035172 Bacteria 2395
460 Ga0373927_0016164 3300035695 Bacteria 4924
461 Ga0373937_0026430 3300036401 Bacteria 5246
462 Ga0395899_0009711 3300037312 Bacteria 7385
463 Ga0395900_0008178 3300037418 Bacteria 10764
464 Ga0395900_0166678 3300037418 Bacteria 2245
465 Ga0395900_0169069 3300037418 Bacteria 2226
466 Ga0395898_0011708 3300037466 Bacteria 9095
467 Ga0395905_0020312 3300037471 Bacteria 6292
468 Ga0395901_0014250 3300038443 Bacteria 8095
469 Ga0439436_0000451 3300041404 Bacteria 10493
470 Ga0439466_0013706 3300041411 Bacteria 2964
471 Ga0439465_0000069 3300041413 Bacteria 22418
472 Ga0451795_1332565 3300041456 Bacteria 1487
473 Ga0451807_2302037 3300041486 Bacteria 3072
474 Ga0451853_1731523 3300041512 Bacteria 3226
475 Ga0439445_0020832 3300042004 Bacteria 1644
476 Ga0439449_0059057 3300042007 Bacteria 1416
477 Ga0439457_000066 3300042014 Bacteria 22683
478 Ga0439462_0018605 3300042015 Bacteria 1804
479 Ga0451577_0001198 3300042876 Bacteria 36335
480 Ga0451577_0009122 3300042876 Bacteria 9573
481 Ga0451577_0191664 3300042876 Bacteria 1844
482 Ga0466969_0000004 3300044656 Bacteria 168068
483 Ga0466972_0000017 3300044658 Bacteria 199884
484 Ga0466972_0000500 3300044658 Bacteria 19594
485 Ga0466966_0000295 3300044684 Bacteria 32723
486 Ga0466961_0011193 3300044693 Bacteria 5736
487 Ga0466964_0027934 3300044706 Bacteria 2219
488 Ga0453684_0001281 3300044712 Bacteria 75118
489 Ga0453684_0001619 3300044712 Bacteria 61621
490 Ga0453684_0003038 3300044712 Bacteria 39029
491 Ga0466970_0018872 3300044765 Bacteria 3572
492 Ga0466970_0031131 3300044765 Bacteria 2817
493 Ga0466957_0001466 3300044842 Bacteria 12365
494 Ga0466957_0057610 3300044842 Bacteria 2378
495 Ga0466959_0000004 3300045049 Bacteria 216815
496 Ga0466959_0000566 3300045049 Bacteria 21533
497 Ga0495627_000081 3300046453 Bacteria 116262
498 Ga0495627_044018 3300046453 Bacteria 1363
499 Ga0495592_0081730 3300046454 Bacteria 2336
500 Ga0495638_0031527 3300046460 Bacteria 3406
501 Ga0495653_0118277 3300046463 Bacteria 1893
502 Ga0495596_0002543 3300046500 Bacteria 9747
503 Ga0495606_0003999 3300046507 Bacteria 15050
504 Ga0495606_0050953 3300046507 Bacteria 2703
505 Ga0495608_0063346 3300046511 Bacteria 2427
506 Ga0495610_0000005 3300046512 Bacteria 924111
507 Ga0495630_0060363 3300046517 Bacteria 2846
508 Ga0495632_0002129 3300046519 Bacteria 15416
509 Ga0495648_0001530 3300046524 Bacteria 22622
510 Ga0495663_0000680 3300046525 Bacteria 11726
511 Ga0495663_0005383 3300046525 Bacteria 3552
512 Ga0495654_0000003 3300046530 Bacteria 863485
513 Ga0495598_0009585 3300046537 Bacteria 2294
514 Ga0495621_0005078 3300046539 Bacteria 3756
515 Ga0495633_0000022 3300046558 Bacteria 226582
516 Ga0495633_0000114 3300046558 Bacteria 108708
517 Ga0495633_0031288 3300046558 Bacteria 2582
518 Ga0495668_0004556 3300046616 Bacteria 9761
519 Ga0495611_0001127 3300046648 Bacteria 14007
520 Ga0495611_0033424 3300046648 Bacteria 2269
521 Ga0495625_0002476 3300046660 Bacteria 19910
522 Ga0495625_0178743 3300046660 Bacteria 1413
523 Ga0495599_0114542 3300046678 Bacteria 1678
524 Ga0495672_0016266 3300047320 Bacteria 5020
525 Ga0495672_0019138 3300047320 Bacteria 4526
526 Ga0495687_000031 3300047443 Bacteria 274659
527 Ga0495684_0152327 3300047471 Bacteria 1728
528 Ga0495686_0000128 3300047472 Bacteria 156223
529 Ga0495686_0021354 3300047472 Unclassified 4302
530 Ga0495686_0062493 3300047472 Bacteria 2310
531 Ga0496103_0078546 3300048906 Bacteria 2073
532 Ga0496110_0114393 3300048913 Bacteria 2428
533 Ga0496116_0000029 3300048919 Bacteria 422187
534 Ga0496117_0000007 3300048920 Bacteria 720505
535 Ga0496118_0015187 3300048921 Bacteria 7150
536 Ga0496118_0099818 3300048921 Bacteria 1966
537 Ga0496119_0000007 3300048922 Bacteria 475920
538 Ga0496120_0067739 3300048923 Bacteria 1971
539 Ga0496121_0000010 3300048924 Bacteria 793488
540 Ga0496122_0000946 3300048925 Bacteria 52631
541 Ga0496122_0001893 3300048925 Bacteria 31687
542 Ga0496122_0001900 3300048925 Bacteria 31591
543 Ga0496122_0001976 3300048925 Bacteria 30631
544 Ga0496122_0002061 3300048925 Bacteria 29808
545 Ga0496123_0001726 3300048926 Bacteria 29009
546 Ga0496123_0008606 3300048926 Bacteria 9340
547 Ga0496124_0001116 3300048927 Bacteria 42242
548 Ga0496125_0001777 3300048928 Bacteria 29790
549 Ga0496125_0017671 3300048928 Bacteria 6790
550 Ga0496126_0004748 3300048929 Bacteria 16022
551 Ga0501032_0002044 3300049569 Bacteria 15933
552 Ga0501033_0021393 3300049570 Bacteria 4880
553 Ga0501034_0009033 3300049571 Bacteria 10466
554 Ga0501034_0015128 3300049571 Bacteria 7930
555 Ga0501036_0011432 3300049572 Bacteria 7348
556 Ga0501037_0006267 3300049573 Bacteria 8696
557 Ga0501037_0032056 3300049573 Bacteria 3880
558 Ga0501038_0011204 3300049574 Bacteria 8186
559 Ga0501038_0028995 3300049574 Bacteria 4910
560 Ga0501043_0007889 3300049579 Bacteria 8415
561 Ga0501043_0015301 3300049579 Bacteria 6010
562 Ga0501043_0135302 3300049579 Bacteria 1931
563 Ga0501046_0011009 3300049580 Bacteria 7752
564 Ga0501047_0025590 3300049581 Bacteria 5673
565 Ga0501047_0045479 3300049581 Bacteria 4245
566 Ga0501047_0057178 3300049581 Bacteria 3772
567 Ga0501047_0071567 3300049581 Bacteria 3337
568 Ga0501047_0090965 3300049581 Bacteria 2929
569 Ga0501047_0195725 3300049581 Bacteria 1884
570 Ga0501048_0048606 3300049582 Bacteria 3025
571 Ga0501070_0013567 3300049586 Bacteria 6868
572 Ga0501072_0153683 3300049588 Bacteria 1835
573 Ga0501073_0003476 3300049589 Bacteria 11825
574 Ga0501074_0003529 3300049590 Bacteria 11096
575 Ga0501201_000329 3300049651 Bacteria 4368
576 Ga0501223_000724 3300049663 Bacteria 7868
577 Ga0501224_000319 3300049664 Bacteria 5632
578 Ga0501235_001375 3300049669 Bacteria 5158
579 Ga0501242_000579 3300049674 Bacteria 3311
580 Ga0501252_000079 3300049682 Bacteria 5041
581 Ga0501257_006977 3300049686 Bacteria 2516
582 Ga0501259_001418 3300049688 Bacteria 3985
583 Ga0501259_001520 3300049688 Bacteria 3863
584 Ga0501221_000581 3300049704 Bacteria 5835
585 Ga0501225_0000487 3300049705 Bacteria 12349
586 Ga0501225_0005736 3300049705 Bacteria 3636
587 Ga0501083_0096139 3300049744 Bacteria 1954
588 Ga0501241_000002 3300049758 Bacteria 194532
589 Ga0501241_000383 3300049758 Bacteria 9690
590 Ga0501269_000379 3300049766 Bacteria 10698
591 Ga0501035_0002820 3300049822 Bacteria 16814
592 Ga0501035_0033250 3300049822 Bacteria 4690
593 Ga0501044_0002356 3300049823 Bacteria 21549
594 Ga0501044_0022628 3300049823 Bacteria 6695
595 Ga0501044_0030671 3300049823 Bacteria 5664
596 nmdc:mga0k408_11249_c2 3300050493 Bacteria 4187
597 nmdc:mga0k408_27448_c1 3300050493 Bacteria 3233
598 nmdc:mga05p37_38869_c1 3300050507 Bacteria 5837
599 nmdc:mga09592_20617_c1 3300050508 Bacteria 5423
600 nmdc:mga09592_44624_c1 3300050508 Bacteria 3733
601 nmdc:mga06r32_138949_c1 3300050510 Bacteria 2405
602 nmdc:mga06r32_48218_c1 3300050510 Bacteria 4071
603 nmdc:mga08y16_109132_c1 3300050511 Bacteria 2881
604 nmdc:mga08y16_135439_c1 3300050511 Unclassified 2560
605 nmdc:mga08y16_94718_c1 3300050511 Bacteria 3110
606 Ga0500578_0087192 3300053086 Bacteria 1983
607 Ga0500644_0000593 3300053088 Bacteria 13830
608 Ga0500646_0001495 3300053090 Bacteria 6146
609 Ga0500583_0000062 3300053092 Bacteria 67892
610 Ga0500583_0000276 3300053092 Bacteria 17969
611 Ga0500583_0001457 3300053092 Bacteria 6785
612 Ga0500569_000223 3300053109 Bacteria 8953
613 Ga0500642_0016477 3300053130 Bacteria 2809
614 Ga0500658_0007468 3300053134 Bacteria 4040
615 Ga0500568_0000511 3300053139 Bacteria 28633
616 Ga0500577_0001525 3300053142 Bacteria 5902
617 Ga0500589_025059 3300053147 Bacteria 2760
618 Ga0500622_0000144 3300053156 Bacteria 75663
619 Ga0500622_0000926 3300053156 Bacteria 24930
620 Ga0500622_0034403 3300053156 Bacteria 2654
621 Ga0501084_0064508 3300054114 Bacteria 3065

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_10287051 Ga0207649_102870512 330
2 3300049651 Ga0501201_000329 Ga0501201_000329_882_2048 361
3 3300049663 Ga0501223_000724 Ga0501223_000724_3804_4970 361
4 3300049664 Ga0501224_000319 Ga0501224_000319_166_1332 361
5 3300049669 Ga0501235_001375 Ga0501235_001375_2310_3476 361
6 3300049682 Ga0501252_000079 Ga0501252_000079_2684_3850 361
7 3300049688 Ga0501259_001520 Ga0501259_001520_1908_3074 361
8 3300049704 Ga0501221_000581 Ga0501221_000581_4311_5477 361
9 3300049705 Ga0501225_0000487 Ga0501225_0000487_7561_8727 361
10 3300003322 rootL2_10266713 rootL2_102667131 363
11 3300047320 Ga0495672_0016266 Ga0495672_0016266_3800_4969 363
12 3300013102 Ga0157371_10002372 Ga0157371_100023723 364
13 3300013104 Ga0157370_10098774 Ga0157370_100987742 364
14 3300015265 Ga0182005_1000071 Ga0182005_100007125 364
15 3300005353 Ga0070669_100289760 Ga0070669_1002897601 370
16 3300005367 Ga0070667_100231935 Ga0070667_1002319352 370
17 3300014326 Ga0157380_10000085 Ga0157380_1000008533 370
18 3300005334 Ga0068869_100033033 Ga0068869_1000330332 371
19 3300009176 Ga0105242_10134512 Ga0105242_101345122 371
20 3300025934 Ga0207686_10153098 Ga0207686_101530982 371
21 3300025942 Ga0207689_10005351 Ga0207689_1000535110 371
22 3300026089 Ga0207648_10052785 Ga0207648_100527852 371
23 3300005330 Ga0070690_100052813 Ga0070690_1000528133 372
24 3300005340 Ga0070689_100065057 Ga0070689_1000650573 372
25 3300005354 Ga0070675_100040413 Ga0070675_1000404132 372
26 3300005544 Ga0070686_100008636 Ga0070686_1000086364 372
27 3300005564 Ga0070664_100205394 Ga0070664_1002053942 372
28 3300005615 Ga0070702_100009538 Ga0070702_1000095381 372
29 3300025901 Ga0207688_10145581 Ga0207688_101455811 372
30 3300025907 Ga0207645_10090423 Ga0207645_100904232 372
31 3300025931 Ga0207644_10201161 Ga0207644_102011611 372
32 3300025940 Ga0207691_10056602 Ga0207691_100566023 372
33 3300025945 Ga0207679_10013108 Ga0207679_100131083 372
34 3300026023 Ga0207677_10041580 Ga0207677_100415802 372
35 3300026035 Ga0207703_10395356 Ga0207703_103953561 372
36 3300026121 Ga0207683_10051263 Ga0207683_100512632 372
37 iso_pu_bacteria 2739367866 2740032167 374
38 3300005337 Ga0070682_100001276 Ga0070682_1000012764 375
39 3300005459 Ga0068867_100011283 Ga0068867_1000112834 376
40 3300009176 Ga0105242_10012376 Ga0105242_100123765 376
41 3300026089 Ga0207648_10018930 Ga0207648_100189303 376
42 3300028794 Ga0307515_10000001 Ga0307515_100000013667 376
43 iso_pu_bacteria 2884634485 2884637318 376
44 iso_pu_bacteria 2919692658 2919697545 376
45 3300005339 Ga0070660_100000201 Ga0070660_10000020111 377
46 3300025919 Ga0207657_10001516 Ga0207657_1000151613 377
47 3300046616 Ga0495668_0004556 Ga0495668_0004556_1522_2676 377
48 iso_pu_bacteria 2585428115 2587945381 377
49 iso_pu_bacteria 2839989709 2839991403 377
50 iso_pu_bacteria 2910245624 2910247858 377
51 iso_pu_bacteria 2511231000 2511231035 378
52 iso_pu_bacteria 2523533629 2524006166 378
53 iso_pu_bacteria 2582581281 2585156499 378
54 iso_pu_bacteria 2582581282 2585160850 378
55 iso_pu_bacteria 2585428061 2587752268 378
56 iso_pu_bacteria 2818991442 2819571871 378
57 iso_pu_bacteria 2821136567 2821141885 378
58 iso_pu_bacteria 2884634485 2884636702 378
59 iso_pu_bacteria 2904467357 2904469702 378
60 iso_pu_bacteria 2929921140 2929927737 378
61 iso_pu_bacteria 2582581278 2585143660 379
62 iso_pu_bacteria 2585428045 2587680048 379
63 iso_pu_bacteria 2585428060 2587748704 379
64 iso_pu_bacteria 2585428182 2588211563 379
65 iso_pu_bacteria 2585428183 2588215947 379
66 iso_pu_bacteria 2585428184 2588219369 379
67 iso_pu_bacteria 2585428185 2588224851 379
68 iso_pu_bacteria 2585428187 2588234683 379
69 iso_pu_bacteria 2588253712 2588447638 379
70 iso_pu_bacteria 2588254255 2590603268 379
71 iso_pu_bacteria 2588254257 2590610281 379
72 iso_pu_bacteria 2728369107 2729200689 379
73 iso_pu_bacteria 2738541273 2738698321 379
74 iso_pu_bacteria 2738543014 2739252647 379
75 iso_pu_bacteria 2739367874 2740060501 379
76 iso_pu_bacteria 2751185877 2753674271 379
77 iso_pu_bacteria 2765235839 2765575759 379
78 iso_pu_bacteria 2772190705 2772606100 379
79 iso_pu_bacteria 2775506739 2775674264 379
80 iso_pu_bacteria 2816332188 2816875598 379
81 iso_pu_bacteria 2842083920 2842086327 379
82 iso_pu_bacteria 2871720351 2871723679 379
83 iso_pu_bacteria 2889290771 2889293745 379
84 iso_pu_bacteria 2905999023 2906001110 379
85 iso_pu_bacteria 2919097161 2919100760 379
86 iso_pu_bacteria 2919399522 2919403122 379
87 iso_pu_bacteria 2945924605 2945924730 379
88 iso_pu_bacteria 2946019816 2946024154 379
89 iso_pu_bacteria 2977243572 2977247682 379
90 iso_pu_bacteria 2984572630 2984574515 379
91 iso_pu_bacteria 2984606641 2984607966 379
92 iso_pu_bacteria 2993372514 2993375024 379
93 iso_pu_bacteria 2993480792 2993481888 379
94 3300030521 Ga0307511_10000228 Ga0307511_1000022824 380
95 3300032004 Ga0307414_10000118 Ga0307414_100001186 380
96 3300032004 Ga0307414_10002983 Ga0307414_100029838 380
97 3300032004 Ga0307414_10025499 Ga0307414_100254992 380
98 3300044842 Ga0466957_0057610 Ga0466957_0057610_257_1444 380
99 3300003316 rootH1_10079717 rootH1_100797171 381
100 3300003323 rootH1_10098969 rootH1_100989697 381
101 3300005334 Ga0068869_100018653 Ga0068869_1000186531 381
102 3300005340 Ga0070689_100107592 Ga0070689_1001075922 381
103 3300005471 Ga0070698_100168177 Ga0070698_1001681771 381
104 3300005563 Ga0068855_100078179 Ga0068855_1000781792 381
105 3300005577 Ga0068857_100012331 Ga0068857_1000123315 381
106 3300005614 Ga0068856_100025473 Ga0068856_1000254732 381
107 3300005617 Ga0068859_100141676 Ga0068859_1001416761 381
108 3300005843 Ga0068860_100007137 Ga0068860_1000071374 381
109 3300005844 Ga0068862_100035626 Ga0068862_1000356262 381
110 3300006195 Ga0075366_10121674 Ga0075366_101216741 381
111 3300006358 Ga0068871_100082353 Ga0068871_1000823532 381
112 3300006931 Ga0097620_100141676 Ga0097620_1001416761 381
113 3300009093 Ga0105240_10000040 Ga0105240_1000004038 381
114 3300009174 Ga0105241_10023896 Ga0105241_100238963 381
115 3300009545 Ga0105237_10008509 Ga0105237_100085094 381
116 3300009553 Ga0105249_10003252 Ga0105249_1000325211 381
117 3300010375 Ga0105239_10000133 Ga0105239_1000013361 381
118 3300010375 Ga0105239_10003358 Ga0105239_100033582 381
119 3300013100 Ga0157373_10151782 Ga0157373_101517822 381
120 3300013102 Ga0157371_10021384 Ga0157371_100213842 381
121 3300013296 Ga0157374_10139202 Ga0157374_101392021 381
122 3300013297 Ga0157378_10346894 Ga0157378_103468941 381
123 3300013306 Ga0163162_10001289 Ga0163162_1000128925 381
124 3300013307 Ga0157372_10042920 Ga0157372_100429205 381
125 3300025246 Ga0209646_1000876 Ga0209646_10008761 381
126 3300025297 Ga0209758_1005981 Ga0209758_10059814 381
127 3300025302 Ga0207426_1011838 Ga0207426_10118382 381
128 3300025911 Ga0207654_10014404 Ga0207654_100144043 381
129 3300025913 Ga0207695_10000041 Ga0207695_10000041201 381
130 3300025914 Ga0207671_10146567 Ga0207671_101465672 381
131 3300025936 Ga0207670_10085741 Ga0207670_100857412 381
132 3300025949 Ga0207667_10024878 Ga0207667_100248785 381
133 3300025961 Ga0207712_10005321 Ga0207712_100053212 381
134 3300026023 Ga0207677_10160302 Ga0207677_101603022 381
135 3300026078 Ga0207702_10091585 Ga0207702_100915852 381
136 3300026089 Ga0207648_10125193 Ga0207648_101251932 381
137 3300026116 Ga0207674_10134557 Ga0207674_101345572 381
138 3300031456 Ga0307513_10128346 Ga0307513_101283462 381
139 3300031507 Ga0307509_10201839 Ga0307509_102018393 381
140 3300035695 Ga0373927_0016164 Ga0373927_0016164_3118_4281 381
141 3300037418 Ga0395900_0166678 Ga0395900_0166678_62_1222 381
142 3300037471 Ga0395905_0020312 Ga0395905_0020312_4863_6023 381
143 3300041404 Ga0439436_0000451 Ga0439436_0000451_3096_4289 381
144 3300041456 Ga0451795_1332565 Ga0451795_1332565_221_1387 381
145 3300041512 Ga0451853_1731523 Ga0451853_1731523_38_1201 381
146 3300042007 Ga0439449_0059057 Ga0439449_0059057_215_1378 381
147 3300042014 Ga0439457_000066 Ga0439457_000066_1388_2581 381
148 3300042015 Ga0439462_0018605 Ga0439462_0018605_590_1783 381
149 3300042876 Ga0451577_0001198 Ga0451577_0001198_19982_21148 381
150 3300044656 Ga0466969_0000004 Ga0466969_0000004_65281_66471 381
151 3300044658 Ga0466972_0000017 Ga0466972_0000017_90508_91776 381
152 3300044684 Ga0466966_0000295 Ga0466966_0000295_17503_18693 381
153 3300044706 Ga0466964_0027934 Ga0466964_0027934_680_1870 381
154 3300044712 Ga0453684_0001619 Ga0453684_0001619_8245_9411 381
155 3300044842 Ga0466957_0001466 Ga0466957_0001466_5788_6981 381
156 3300045049 Ga0466959_0000004 Ga0466959_0000004_201473_202663 381
157 3300047471 Ga0495684_0152327 Ga0495684_0152327_228_1388 381
158 3300049579 Ga0501043_0135302 Ga0501043_0135302_13_1206 381
159 3300049581 Ga0501047_0025590 Ga0501047_0025590_3766_4929 381
160 3300049581 Ga0501047_0057178 Ga0501047_0057178_2350_3543 381
161 3300049581 Ga0501047_0090965 Ga0501047_0090965_629_1819 381
162 3300049674 Ga0501242_000579 Ga0501242_000579_831_1994 381
163 3300049686 Ga0501257_006977 Ga0501257_006977_1156_2319 381
164 3300049688 Ga0501259_001418 Ga0501259_001418_1903_3066 381
165 3300049705 Ga0501225_0005736 Ga0501225_0005736_2294_3487 381
166 3300049823 Ga0501044_0022628 Ga0501044_0022628_730_1923 381
167 3300050493 nmdc:mga0k408_27448_c1 nmdc:mga0k408_27448_c1_2026_3189 381
168 3300053086 Ga0500578_0087192 Ga0500578_0087192_352_1614 381
169 3300053092 Ga0500583_0000062 Ga0500583_0000062_47525_48718 381
170 3300053092 Ga0500583_0000276 Ga0500583_0000276_16335_17498 381
171 3300053147 Ga0500589_025059 Ga0500589_025059_221_1384 381
172 3300053156 Ga0500622_0034403 Ga0500622_0034403_460_1623 381
173 iso_pu_bacteria 2738541278 2738724497 381
174 3300002077 JGI24744J21845_10007449 JGI24744J21845_100074492 382
175 3300003320 rootH2_10009982 rootH2_100099822 382
176 3300003320 rootH2_10037920 rootH2_100379202 382
177 3300003320 rootH2_10050136 rootH2_100501362 382
178 3300003320 rootH2_10076592 rootH2_100765922 382
179 3300003354 JGI25160J50197_1002332 JGI25160J50197_10023324 382
180 3300003790 Ga0055528_1000307 Ga0055528_10003073 382
181 3300003790 Ga0055528_1007947 Ga0055528_10079472 382
182 3300003791 Ga0055530_10001712 Ga0055530_1000171211 382
183 3300003794 Ga0055531_10029535 Ga0055531_100295352 382
184 3300004625 Ga0055543_1006891 Ga0055543_10068912 382
185 3300005262 Ga0065165_1000722 Ga0065165_100072222 382
186 3300005289 Ga0065704_10020003 Ga0065704_100200032 382
187 3300005295 Ga0065707_10159377 Ga0065707_101593772 382
188 3300005327 Ga0070658_10036022 Ga0070658_100360223 382
189 3300005327 Ga0070658_10063362 Ga0070658_100633622 382
190 3300005327 Ga0070658_10076384 Ga0070658_100763842 382
191 3300005327 Ga0070658_10101670 Ga0070658_101016702 382
192 3300005328 Ga0070676_10005231 Ga0070676_100052315 382
193 3300005328 Ga0070676_10061783 Ga0070676_100617832 382
194 3300005329 Ga0070683_100131528 Ga0070683_1001315283 382
195 3300005330 Ga0070690_100138638 Ga0070690_1001386381 382
196 3300005330 Ga0070690_100149921 Ga0070690_1001499211 382
197 3300005334 Ga0068869_100029041 Ga0068869_1000290412 382
198 3300005334 Ga0068869_100052755 Ga0068869_1000527552 382
199 3300005334 Ga0068869_100085349 Ga0068869_1000853491 382
200 3300005335 Ga0070666_10000031 Ga0070666_1000003121 382
201 3300005335 Ga0070666_10015920 Ga0070666_100159202 382
202 3300005335 Ga0070666_10158582 Ga0070666_101585822 382
203 3300005336 Ga0070680_100019674 Ga0070680_1000196743 382
204 3300005336 Ga0070680_100052971 Ga0070680_1000529712 382
205 3300005336 Ga0070680_100139304 Ga0070680_1001393041 382
206 3300005337 Ga0070682_100000152 Ga0070682_10000015245 382
207 3300005337 Ga0070682_100032428 Ga0070682_1000324283 382
208 3300005338 Ga0068868_100037647 Ga0068868_1000376473 382
209 3300005338 Ga0068868_100341245 Ga0068868_1003412451 382
210 3300005339 Ga0070660_100027411 Ga0070660_1000274113 382
211 3300005339 Ga0070660_100032879 Ga0070660_1000328792 382
212 3300005340 Ga0070689_100004257 Ga0070689_1000042573 382
213 3300005340 Ga0070689_100214550 Ga0070689_1002145501 382
214 3300005343 Ga0070687_100016820 Ga0070687_1000168202 382
215 3300005343 Ga0070687_100067809 Ga0070687_1000678092 382
216 3300005344 Ga0070661_100223479 Ga0070661_1002234791 382
217 3300005354 Ga0070675_100061496 Ga0070675_1000614962 382
218 3300005354 Ga0070675_100078587 Ga0070675_1000785872 382
219 3300005354 Ga0070675_100107187 Ga0070675_1001071872 382
220 3300005355 Ga0070671_100033594 Ga0070671_1000335943 382
221 3300005364 Ga0070673_100034978 Ga0070673_1000349784 382
222 3300005364 Ga0070673_100052550 Ga0070673_1000525502 382
223 3300005365 Ga0070688_100003898 Ga0070688_1000038982 382
224 3300005365 Ga0070688_100121359 Ga0070688_1001213591 382
225 3300005365 Ga0070688_100122504 Ga0070688_1001225041 382
226 3300005366 Ga0070659_100004878 Ga0070659_1000048786 382
227 3300005367 Ga0070667_100004341 Ga0070667_1000043417 382
228 3300005367 Ga0070667_100017484 Ga0070667_1000174843 382
229 3300005367 Ga0070667_100095160 Ga0070667_1000951601 382
230 3300005367 Ga0070667_100184404 Ga0070667_1001844042 382
231 3300005441 Ga0070700_100056409 Ga0070700_1000564092 382
232 3300005455 Ga0070663_100224131 Ga0070663_1002241311 382
233 3300005457 Ga0070662_100074215 Ga0070662_1000742151 382
234 3300005458 Ga0070681_10016117 Ga0070681_100161172 382
235 3300005458 Ga0070681_10078377 Ga0070681_100783772 382
236 3300005466 Ga0070685_10004480 Ga0070685_100044803 382
237 3300005466 Ga0070685_10023197 Ga0070685_100231972 382
238 3300005471 Ga0070698_100001241 Ga0070698_10000124114 382
239 3300005471 Ga0070698_100003438 Ga0070698_10000343813 382
240 3300005530 Ga0070679_100000836 Ga0070679_1000008363 382
241 3300005530 Ga0070679_100034505 Ga0070679_1000345053 382
242 3300005535 Ga0070684_100000232 Ga0070684_1000002321 382
243 3300005535 Ga0070684_100145662 Ga0070684_1001456622 382
244 3300005539 Ga0068853_100000103 Ga0068853_10000010326 382
245 3300005539 Ga0068853_100015582 Ga0068853_1000155823 382
246 3300005539 Ga0068853_100040621 Ga0068853_1000406212 382
247 3300005539 Ga0068853_100108228 Ga0068853_1001082282 382
248 3300005539 Ga0068853_100312223 Ga0068853_1003122231 382
249 3300005543 Ga0070672_100079740 Ga0070672_1000797402 382
250 3300005547 Ga0070693_100129416 Ga0070693_1001294162 382
251 3300005548 Ga0070665_100004340 Ga0070665_1000043404 382
252 3300005548 Ga0070665_100202416 Ga0070665_1002024162 382
253 3300005563 Ga0068855_100031705 Ga0068855_1000317053 382
254 3300005563 Ga0068855_100041522 Ga0068855_1000415227 382
255 3300005563 Ga0068855_100113607 Ga0068855_1001136073 382
256 3300005563 Ga0068855_100127024 Ga0068855_1001270242 382
257 3300005563 Ga0068855_100133045 Ga0068855_1001330451 382
258 3300005577 Ga0068857_100003404 Ga0068857_10000340413 382
259 3300005577 Ga0068857_100004875 Ga0068857_10000487510 382
260 3300005577 Ga0068857_100103068 Ga0068857_1001030682 382
261 3300005578 Ga0068854_100091866 Ga0068854_1000918662 382
262 3300005614 Ga0068856_100123380 Ga0068856_1001233803 382
263 3300005614 Ga0068856_100165314 Ga0068856_1001653141 382
264 3300005614 Ga0068856_100270077 Ga0068856_1002700772 382
265 3300005614 Ga0068856_100282956 Ga0068856_1002829562 382
266 3300005616 Ga0068852_100001078 Ga0068852_10000107810 382
267 3300005616 Ga0068852_100011910 Ga0068852_1000119107 382
268 3300005616 Ga0068852_100063037 Ga0068852_1000630372 382
269 3300005617 Ga0068859_100000045 Ga0068859_100000045125 382
270 3300005617 Ga0068859_100030038 Ga0068859_1000300383 382
271 3300005617 Ga0068859_100033339 Ga0068859_1000333392 382
272 3300005617 Ga0068859_100094941 Ga0068859_1000949412 382
273 3300005617 Ga0068859_100097286 Ga0068859_1000972862 382
274 3300005618 Ga0068864_100001622 Ga0068864_10000162219 382
275 3300005618 Ga0068864_100045766 Ga0068864_1000457663 382
276 3300005719 Ga0068861_100003382 Ga0068861_1000033825 382
277 3300005840 Ga0068870_10036100 Ga0068870_100361002 382
278 3300005841 Ga0068863_100003089 Ga0068863_1000030896 382
279 3300005841 Ga0068863_100006337 Ga0068863_10000633710 382
280 3300005841 Ga0068863_100271972 Ga0068863_1002719721 382
281 3300005842 Ga0068858_100024945 Ga0068858_1000249453 382
282 3300005842 Ga0068858_100084450 Ga0068858_1000844502 382
283 3300005842 Ga0068858_100126819 Ga0068858_1001268192 382
284 3300005843 Ga0068860_100001289 Ga0068860_10000128917 382
285 3300005843 Ga0068860_100010059 Ga0068860_1000100595 382
286 3300005843 Ga0068860_100011449 Ga0068860_1000114496 382
287 3300005843 Ga0068860_100044074 Ga0068860_1000440742 382
288 3300005983 Ga0081540_1021338 Ga0081540_10213382 382
289 3300006195 Ga0075366_10017458 Ga0075366_100174583 382
290 3300006237 Ga0097621_100001013 Ga0097621_1000010134 382
291 3300006237 Ga0097621_100011779 Ga0097621_1000117796 382
292 3300006237 Ga0097621_100154600 Ga0097621_1001546002 382
293 3300006237 Ga0097621_100163905 Ga0097621_1001639052 382
294 3300006358 Ga0068871_100007075 Ga0068871_1000070757 382
295 3300006358 Ga0068871_100015208 Ga0068871_1000152082 382
296 3300006358 Ga0068871_100173743 Ga0068871_1001737432 382
297 3300006358 Ga0068871_100279132 Ga0068871_1002791322 382
298 3300006844 Ga0075428_100010044 Ga0075428_1000100447 382
299 3300006844 Ga0075428_100048626 Ga0075428_1000486262 382
300 3300006846 Ga0075430_100034545 Ga0075430_1000345452 382
301 3300006847 Ga0075431_100009298 Ga0075431_1000092984 382
302 3300006847 Ga0075431_100028606 Ga0075431_1000286062 382
303 3300006880 Ga0075429_100006202 Ga0075429_1000062028 382
304 3300006881 Ga0068865_100081601 Ga0068865_1000816011 382
305 3300006931 Ga0097620_100000045 Ga0097620_10000004516 382
306 3300006931 Ga0097620_100030038 Ga0097620_1000300383 382
307 3300006931 Ga0097620_100033339 Ga0097620_1000333392 382
308 3300006931 Ga0097620_100094942 Ga0097620_1000949422 382
309 3300006931 Ga0097620_100097286 Ga0097620_1000972862 382
310 3300009093 Ga0105240_10001675 Ga0105240_1000167513 382
311 3300009093 Ga0105240_10016117 Ga0105240_100161176 382
312 3300009093 Ga0105240_10016598 Ga0105240_100165986 382
313 3300009093 Ga0105240_10019498 Ga0105240_100194987 382
314 3300009093 Ga0105240_10022970 Ga0105240_100229705 382
315 3300009093 Ga0105240_10030232 Ga0105240_100302324 382
316 3300009093 Ga0105240_10049425 Ga0105240_100494255 382
317 3300009093 Ga0105240_10060410 Ga0105240_100604102 382
318 3300009094 Ga0111539_10061973 Ga0111539_100619733 382
319 3300009094 Ga0111539_10085088 Ga0111539_100850882 382
320 3300009094 Ga0111539_10127052 Ga0111539_101270522 382
321 3300009094 Ga0111539_10157559 Ga0111539_101575592 382
322 3300009101 Ga0105247_10001867 Ga0105247_100018676 382
323 3300009101 Ga0105247_10048650 Ga0105247_100486505 382
324 3300009147 Ga0114129_10005331 Ga0114129_1000533120 382
325 3300009147 Ga0114129_10022630 Ga0114129_100226303 382
326 3300009174 Ga0105241_10001060 Ga0105241_1000106021 382
327 3300009174 Ga0105241_10009040 Ga0105241_100090402 382
328 3300009174 Ga0105241_10134609 Ga0105241_101346092 382
329 3300009174 Ga0105241_10345116 Ga0105241_103451161 382
330 3300009176 Ga0105242_10111192 Ga0105242_101111922 382
331 3300009176 Ga0105242_10136704 Ga0105242_101367042 382
332 3300009545 Ga0105237_10000710 Ga0105237_1000071029 382
333 3300009545 Ga0105237_10002600 Ga0105237_100026002 382
334 3300009545 Ga0105237_10006952 Ga0105237_100069528 382
335 3300009545 Ga0105237_10012157 Ga0105237_100121572 382
336 3300009545 Ga0105237_10017744 Ga0105237_100177442 382
337 3300009545 Ga0105237_10056726 Ga0105237_100567262 382
338 3300009545 Ga0105237_10081659 Ga0105237_100816593 382
339 3300009551 Ga0105238_10021649 Ga0105238_100216493 382
340 3300009551 Ga0105238_10043345 Ga0105238_100433453 382
341 3300009553 Ga0105249_10002002 Ga0105249_100020029 382
342 3300009553 Ga0105249_10002678 Ga0105249_100026786 382
343 3300009553 Ga0105249_10025900 Ga0105249_100259002 382
344 3300009553 Ga0105249_10066632 Ga0105249_100666325 382
345 3300009553 Ga0105249_10078162 Ga0105249_100781622 382
346 3300009553 Ga0105249_10223003 Ga0105249_102230032 382
347 3300009553 Ga0105249_10350883 Ga0105249_103508831 382
348 3300010375 Ga0105239_10000155 Ga0105239_1000015518 382
349 3300010375 Ga0105239_10002424 Ga0105239_100024244 382
350 3300010375 Ga0105239_10012014 Ga0105239_100120149 382
351 3300010375 Ga0105239_10041014 Ga0105239_100410142 382
352 3300010375 Ga0105239_10081324 Ga0105239_100813243 382
353 3300010375 Ga0105239_10198320 Ga0105239_101983201 382
354 3300010375 Ga0105239_10205777 Ga0105239_102057772 382
355 3300011119 Ga0105246_10058294 Ga0105246_100582941 382
356 3300011119 Ga0105246_10083019 Ga0105246_100830192 382
357 3300013100 Ga0157373_10000006 Ga0157373_1000000659 382
358 3300013100 Ga0157373_10008939 Ga0157373_100089395 382
359 3300013100 Ga0157373_10091116 Ga0157373_100911161 382
360 3300013102 Ga0157371_10018427 Ga0157371_100184273 382
361 3300013102 Ga0157371_10021719 Ga0157371_100217193 382
362 3300013102 Ga0157371_10123604 Ga0157371_101236041 382
363 3300013102 Ga0157371_10202293 Ga0157371_102022931 382
364 3300013104 Ga0157370_10000585 Ga0157370_1000058536 382
365 3300013104 Ga0157370_10001018 Ga0157370_1000101829 382
366 3300013104 Ga0157370_10138597 Ga0157370_101385972 382
367 3300013104 Ga0157370_10162662 Ga0157370_101626622 382
368 3300013104 Ga0157370_10266930 Ga0157370_102669301 382
369 3300013105 Ga0157369_10036682 Ga0157369_100366823 382
370 3300013105 Ga0157369_10044601 Ga0157369_100446012 382
371 3300013296 Ga0157374_10053493 Ga0157374_100534931 382
372 3300013296 Ga0157374_10134520 Ga0157374_101345202 382
373 3300013297 Ga0157378_10010333 Ga0157378_100103337 382
374 3300013297 Ga0157378_10016998 Ga0157378_100169985 382
375 3300013297 Ga0157378_10069852 Ga0157378_100698522 382
376 3300013306 Ga0163162_10006376 Ga0163162_100063767 382
377 3300013306 Ga0163162_10033897 Ga0163162_100338972 382
378 3300013306 Ga0163162_10040893 Ga0163162_100408932 382
379 3300013306 Ga0163162_10120363 Ga0163162_101203632 382
380 3300013306 Ga0163162_10510372 Ga0163162_105103721 382
381 3300013307 Ga0157372_10000294 Ga0157372_1000029435 382
382 3300013307 Ga0157372_10000582 Ga0157372_1000058229 382
383 3300013307 Ga0157372_10018908 Ga0157372_100189083 382
384 3300013307 Ga0157372_10024498 Ga0157372_100244984 382
385 3300013307 Ga0157372_10070836 Ga0157372_100708363 382
386 3300013307 Ga0157372_10153881 Ga0157372_101538812 382
387 3300013307 Ga0157372_10214981 Ga0157372_102149812 382
388 3300013308 Ga0157375_10096980 Ga0157375_100969801 382
389 3300013308 Ga0157375_10179898 Ga0157375_101798982 382
390 3300014325 Ga0163163_10040361 Ga0163163_100403613 382
391 3300014325 Ga0163163_10069315 Ga0163163_100693153 382
392 3300014325 Ga0163163_10227992 Ga0163163_102279922 382
393 3300014325 Ga0163163_10285138 Ga0163163_102851382 382
394 3300014497 Ga0182008_10000003 Ga0182008_10000003231 382
395 3300014745 Ga0157377_10007687 Ga0157377_100076873 382
396 3300014969 Ga0157376_10063722 Ga0157376_100637221 382
397 3300017792 Ga0163161_10032678 Ga0163161_100326781 382
398 3300017792 Ga0163161_10213990 Ga0163161_102139901 382
399 3300017792 Ga0163161_10225004 Ga0163161_102250042 382
400 3300025208 Ga0209436_102850 Ga0209436_1028506 382
401 3300025273 Ga0209673_1000242 Ga0209673_100024238 382
402 3300025297 Ga0209758_1008438 Ga0209758_10084384 382
403 3300025298 Ga0209050_1000298 Ga0209050_100029854 382
404 3300025302 Ga0207426_1001104 Ga0207426_100110415 382
405 3300025302 Ga0207426_1003320 Ga0207426_10033206 382
406 3300025304 Ga0209257_1001270 Ga0209257_10012704 382
407 3300025900 Ga0207710_10001020 Ga0207710_100010202 382
408 3300025900 Ga0207710_10024388 Ga0207710_100243885 382
409 3300025903 Ga0207680_10000381 Ga0207680_100003816 382
410 3300025903 Ga0207680_10157501 Ga0207680_101575012 382
411 3300025904 Ga0207647_10009037 Ga0207647_100090376 382
412 3300025904 Ga0207647_10052313 Ga0207647_100523132 382
413 3300025907 Ga0207645_10022683 Ga0207645_100226831 382
414 3300025908 Ga0207643_10002262 Ga0207643_100022627 382
415 3300025911 Ga0207654_10002167 Ga0207654_1000216712 382
416 3300025911 Ga0207654_10014389 Ga0207654_100143891 382
417 3300025911 Ga0207654_10021660 Ga0207654_100216602 382
418 3300025911 Ga0207654_10166300 Ga0207654_101663001 382
419 3300025912 Ga0207707_10247460 Ga0207707_102474601 382
420 3300025913 Ga0207695_10000282 Ga0207695_1000028259 382
421 3300025913 Ga0207695_10000363 Ga0207695_1000036358 382
422 3300025913 Ga0207695_10000647 Ga0207695_1000064754 382
423 3300025913 Ga0207695_10002667 Ga0207695_1000266713 382
424 3300025913 Ga0207695_10029084 Ga0207695_100290846 382
425 3300025913 Ga0207695_10061184 Ga0207695_100611842 382
426 3300025914 Ga0207671_10007629 Ga0207671_1000762910 382
427 3300025914 Ga0207671_10020255 Ga0207671_100202553 382
428 3300025914 Ga0207671_10021298 Ga0207671_100212982 382
429 3300025917 Ga0207660_10009202 Ga0207660_100092022 382
430 3300025919 Ga0207657_10020393 Ga0207657_100203933 382
431 3300025919 Ga0207657_10034034 Ga0207657_100340342 382
432 3300025920 Ga0207649_10021758 Ga0207649_100217583 382
433 3300025921 Ga0207652_10008365 Ga0207652_100083653 382
434 3300025921 Ga0207652_10009232 Ga0207652_100092323 382
435 3300025923 Ga0207681_10016298 Ga0207681_100162982 382
436 3300025923 Ga0207681_10024666 Ga0207681_100246663 382
437 3300025924 Ga0207694_10046142 Ga0207694_100461422 382
438 3300025924 Ga0207694_10151790 Ga0207694_101517902 382
439 3300025926 Ga0207659_10067709 Ga0207659_100677092 382
440 3300025933 Ga0207706_10009214 Ga0207706_100092147 382
441 3300025933 Ga0207706_10028796 Ga0207706_100287964 382
442 3300025934 Ga0207686_10001766 Ga0207686_1000176610 382
443 3300025934 Ga0207686_10100521 Ga0207686_101005212 382
444 3300025936 Ga0207670_10004749 Ga0207670_100047496 382
445 3300025936 Ga0207670_10005483 Ga0207670_100054833 382
446 3300025937 Ga0207669_10002707 Ga0207669_100027072 382
447 3300025940 Ga0207691_10001776 Ga0207691_1000177619 382
448 3300025942 Ga0207689_10002278 Ga0207689_1000227810 382
449 3300025942 Ga0207689_10005867 Ga0207689_1000586712 382
450 3300025942 Ga0207689_10009880 Ga0207689_100098802 382
451 3300025942 Ga0207689_10024182 Ga0207689_100241824 382
452 3300025944 Ga0207661_10022325 Ga0207661_100223252 382
453 3300025944 Ga0207661_10025164 Ga0207661_100251641 382
454 3300025945 Ga0207679_10188528 Ga0207679_101885281 382
455 3300025949 Ga0207667_10000403 Ga0207667_100004033 382
456 3300025949 Ga0207667_10002943 Ga0207667_1000294320 382
457 3300025949 Ga0207667_10069889 Ga0207667_100698892 382
458 3300025949 Ga0207667_10083746 Ga0207667_100837462 382
459 3300025949 Ga0207667_10260123 Ga0207667_102601232 382
460 3300025960 Ga0207651_10014588 Ga0207651_100145882 382
461 3300025961 Ga0207712_10002600 Ga0207712_100026005 382
462 3300025961 Ga0207712_10002732 Ga0207712_100027327 382
463 3300025961 Ga0207712_10007140 Ga0207712_100071403 382
464 3300025961 Ga0207712_10020061 Ga0207712_100200613 382
465 3300025981 Ga0207640_10035820 Ga0207640_100358202 382
466 3300025986 Ga0207658_10003968 Ga0207658_100039686 382
467 3300025986 Ga0207658_10118474 Ga0207658_101184743 382
468 3300026035 Ga0207703_10009138 Ga0207703_100091385 382
469 3300026035 Ga0207703_10046177 Ga0207703_100461772 382
470 3300026035 Ga0207703_10092251 Ga0207703_100922512 382
471 3300026041 Ga0207639_10000812 Ga0207639_1000081216 382
472 3300026041 Ga0207639_10007187 Ga0207639_100071876 382
473 3300026041 Ga0207639_10073213 Ga0207639_100732132 382
474 3300026041 Ga0207639_10079850 Ga0207639_100798502 382
475 3300026041 Ga0207639_10098994 Ga0207639_100989942 382
476 3300026075 Ga0207708_10035730 Ga0207708_100357302 382
477 3300026078 Ga0207702_10116976 Ga0207702_101169762 382
478 3300026078 Ga0207702_10210810 Ga0207702_102108102 382
479 3300026088 Ga0207641_10000133 Ga0207641_1000013367 382
480 3300026088 Ga0207641_10000549 Ga0207641_1000054916 382
481 3300026088 Ga0207641_10033652 Ga0207641_100336523 382
482 3300026089 Ga0207648_10027799 Ga0207648_100277995 382
483 3300026089 Ga0207648_10102280 Ga0207648_101022801 382
484 3300026095 Ga0207676_10021480 Ga0207676_100214804 382
485 3300026095 Ga0207676_10276046 Ga0207676_102760461 382
486 3300026095 Ga0207676_10381976 Ga0207676_103819761 382
487 3300026095 Ga0207676_10415124 Ga0207676_104151241 382
488 3300026116 Ga0207674_10000600 Ga0207674_1000060041 382
489 3300026116 Ga0207674_10000755 Ga0207674_1000075518 382
490 3300026116 Ga0207674_10049258 Ga0207674_100492582 382
491 3300026116 Ga0207674_10172946 Ga0207674_101729462 382
492 3300026116 Ga0207674_10199914 Ga0207674_101999141 382
493 3300026118 Ga0207675_100005880 Ga0207675_1000058806 382
494 3300026118 Ga0207675_100039927 Ga0207675_1000399273 382
495 3300026142 Ga0207698_10004932 Ga0207698_100049329 382
496 3300026142 Ga0207698_10037744 Ga0207698_100377442 382
497 3300028379 Ga0268266_10000026 Ga0268266_10000026227 382
498 3300028381 Ga0268264_10000015 Ga0268264_10000015124 382
499 3300028381 Ga0268264_10000019 Ga0268264_10000019221 382
500 3300028381 Ga0268264_10000054 Ga0268264_10000054149 382
501 3300028381 Ga0268264_10001568 Ga0268264_100015685 382
502 3300028381 Ga0268264_10008314 Ga0268264_100083146 382
503 3300028381 Ga0268264_10019724 Ga0268264_100197242 382
504 3300028381 Ga0268264_10049395 Ga0268264_100493952 382
505 3300028653 Ga0265323_10000858 Ga0265323_100008584 382
506 3300028666 Ga0265336_10018321 Ga0265336_100183212 382
507 3300028786 Ga0307517_10000651 Ga0307517_1000065143 382
508 3300031251 Ga0265327_10021796 Ga0265327_100217962 382
509 3300031344 Ga0265316_10000401 Ga0265316_1000040123 382
510 3300031344 Ga0265316_10007723 Ga0265316_100077233 382
511 3300031712 Ga0265342_10069366 Ga0265342_100693661 382
512 3300031730 Ga0307516_10001571 Ga0307516_1000157122 382
513 3300031730 Ga0307516_10069974 Ga0307516_100699742 382
514 3300033180 Ga0307510_10000650 Ga0307510_1000065017 382
515 3300035172 Ga0373955_0044342 Ga0373955_0044342_425_1588 382
516 3300036401 Ga0373937_0026430 Ga0373937_0026430_1727_2890 382
517 3300037312 Ga0395899_0009711 Ga0395899_0009711_1807_2970 382
518 3300037418 Ga0395900_0008178 Ga0395900_0008178_4348_5511 382
519 3300037418 Ga0395900_0169069 Ga0395900_0169069_328_1491 382
520 3300037466 Ga0395898_0011708 Ga0395898_0011708_1720_2883 382
521 3300038443 Ga0395901_0014250 Ga0395901_0014250_1997_3160 382
522 3300041411 Ga0439466_0013706 Ga0439466_0013706_47_1198 382
523 3300041486 Ga0451807_2302037 Ga0451807_2302037_1047_2210 382
524 3300042004 Ga0439445_0020832 Ga0439445_0020832_430_1590 382
525 3300042876 Ga0451577_0009122 Ga0451577_0009122_4604_5776 382
526 3300042876 Ga0451577_0191664 Ga0451577_0191664_251_1411 382
527 3300044658 Ga0466972_0000500 Ga0466972_0000500_17152_18318 382
528 3300044693 Ga0466961_0011193 Ga0466961_0011193_3822_4991 382
529 3300044712 Ga0453684_0001281 Ga0453684_0001281_52800_53972 382
530 3300044712 Ga0453684_0003038 Ga0453684_0003038_7930_9102 382
531 3300044765 Ga0466970_0018872 Ga0466970_0018872_157_1326 382
532 3300044765 Ga0466970_0031131 Ga0466970_0031131_493_1662 382
533 3300045049 Ga0466959_0000566 Ga0466959_0000566_9850_11019 382
534 3300046453 Ga0495627_044018 Ga0495627_044018_36_1199 382
535 3300046454 Ga0495592_0081730 Ga0495592_0081730_1076_2239 382
536 3300046460 Ga0495638_0031527 Ga0495638_0031527_1518_2687 382
537 3300046463 Ga0495653_0118277 Ga0495653_0118277_164_1327 382
538 3300046507 Ga0495606_0003999 Ga0495606_0003999_4158_5324 382
539 3300046511 Ga0495608_0063346 Ga0495608_0063346_989_2152 382
540 3300046517 Ga0495630_0060363 Ga0495630_0060363_61_1224 382
541 3300046524 Ga0495648_0001530 Ga0495648_0001530_7139_8308 382
542 3300046525 Ga0495663_0000680 Ga0495663_0000680_9007_10158 382
543 3300046537 Ga0495598_0009585 Ga0495598_0009585_220_1419 382
544 3300046539 Ga0495621_0005078 Ga0495621_0005078_2129_3328 382
545 3300046558 Ga0495633_0000022 Ga0495633_0000022_159441_160604 382
546 3300046648 Ga0495611_0001127 Ga0495611_0001127_11681_12850 382
547 3300046648 Ga0495611_0033424 Ga0495611_0033424_580_1776 382
548 3300046660 Ga0495625_0178743 Ga0495625_0178743_200_1369 382
549 3300046678 Ga0495599_0114542 Ga0495599_0114542_97_1260 382
550 3300047320 Ga0495672_0019138 Ga0495672_0019138_2369_3562 382
551 3300047443 Ga0495687_000031 Ga0495687_000031_105059_106228 382
552 3300047472 Ga0495686_0000128 Ga0495686_0000128_140691_141860 382
553 3300047472 Ga0495686_0021354 Ga0495686_0021354_201_1397 382
554 3300048913 Ga0496110_0114393 Ga0496110_0114393_1208_2371 382
555 3300048924 Ga0496121_0000010 Ga0496121_0000010_107968_109137 382
556 3300049569 Ga0501032_0002044 Ga0501032_0002044_8117_9277 382
557 3300049570 Ga0501033_0021393 Ga0501033_0021393_2668_3828 382
558 3300049571 Ga0501034_0009033 Ga0501034_0009033_7169_8329 382
559 3300049571 Ga0501034_0015128 Ga0501034_0015128_6278_7477 382
560 3300049572 Ga0501036_0011432 Ga0501036_0011432_5888_7087 382
561 3300049573 Ga0501037_0006267 Ga0501037_0006267_2280_3440 382
562 3300049573 Ga0501037_0032056 Ga0501037_0032056_158_1357 382
563 3300049574 Ga0501038_0011204 Ga0501038_0011204_5075_6274 382
564 3300049574 Ga0501038_0028995 Ga0501038_0028995_2427_3587 382
565 3300049579 Ga0501043_0007889 Ga0501043_0007889_1980_3179 382
566 3300049579 Ga0501043_0015301 Ga0501043_0015301_3701_4861 382
567 3300049580 Ga0501046_0011009 Ga0501046_0011009_268_1467 382
568 3300049581 Ga0501047_0045479 Ga0501047_0045479_17_1177 382
569 3300049581 Ga0501047_0071567 Ga0501047_0071567_382_1581 382
570 3300049581 Ga0501047_0195725 Ga0501047_0195725_410_1570 382
571 3300049582 Ga0501048_0048606 Ga0501048_0048606_1295_2494 382
572 3300049586 Ga0501070_0013567 Ga0501070_0013567_2206_3405 382
573 3300049588 Ga0501072_0153683 Ga0501072_0153683_197_1363 382
574 3300049589 Ga0501073_0003476 Ga0501073_0003476_4464_5663 382
575 3300049590 Ga0501074_0003529 Ga0501074_0003529_3593_4792 382
576 3300049744 Ga0501083_0096139 Ga0501083_0096139_469_1668 382
577 3300049758 Ga0501241_000383 Ga0501241_000383_4300_5469 382
578 3300049822 Ga0501035_0002820 Ga0501035_0002820_15428_16627 382
579 3300049822 Ga0501035_0033250 Ga0501035_0033250_2301_3461 382
580 3300049823 Ga0501044_0002356 Ga0501044_0002356_18368_19528 382
581 3300049823 Ga0501044_0030671 Ga0501044_0030671_2532_3731 382
582 3300050493 nmdc:mga0k408_11249_c2 nmdc:mga0k408_11249_c2_2395_3591 382
583 3300050507 nmdc:mga05p37_38869_c1 nmdc:mga05p37_38869_c1_1924_3123 382
584 3300050508 nmdc:mga09592_20617_c1 nmdc:mga09592_20617_c1_1618_2817 382
585 3300050508 nmdc:mga09592_44624_c1 nmdc:mga09592_44624_c1_234_1433 382
586 3300050510 nmdc:mga06r32_138949_c1 nmdc:mga06r32_138949_c1_746_1906 382
587 3300050510 nmdc:mga06r32_48218_c1 nmdc:mga06r32_48218_c1_664_1863 382
588 3300050511 nmdc:mga08y16_109132_c1 nmdc:mga08y16_109132_c1_688_1908 382
589 3300050511 nmdc:mga08y16_135439_c1 nmdc:mga08y16_135439_c1_843_2021 382
590 3300050511 nmdc:mga08y16_94718_c1 nmdc:mga08y16_94718_c1_543_1742 382
591 3300053088 Ga0500644_0000593 Ga0500644_0000593_8407_9570 382
592 3300053090 Ga0500646_0001495 Ga0500646_0001495_2646_3809 382
593 3300053092 Ga0500583_0001457 Ga0500583_0001457_5379_6548 382
594 3300053109 Ga0500569_000223 Ga0500569_000223_5538_6701 382
595 3300053130 Ga0500642_0016477 Ga0500642_0016477_1372_2541 382
596 3300053134 Ga0500658_0007468 Ga0500658_0007468_653_1816 382
597 3300053139 Ga0500568_0000511 Ga0500568_0000511_138_1331 382
598 3300053142 Ga0500577_0001525 Ga0500577_0001525_782_1945 382
599 3300053156 Ga0500622_0000144 Ga0500622_0000144_23346_24506 382
600 3300053156 Ga0500622_0000926 Ga0500622_0000926_427_1596 382
601 3300054114 Ga0501084_0064508 Ga0501084_0064508_121_1320 382
602 3300001915 JGI24741J21665_1002211 JGI24741J21665_10022116 383
603 3300003323 rootH1_10259345 rootH1_102593454 383
604 3300003761 Ga0055535_1007746 Ga0055535_10077462 383
605 3300003784 Ga0055534_1014363 Ga0055534_10143631 383
606 3300005329 Ga0070683_100004016 Ga0070683_1000040164 383
607 3300005339 Ga0070660_100063853 Ga0070660_1000638533 383
608 3300005347 Ga0070668_100049616 Ga0070668_1000496163 383
609 3300005353 Ga0070669_100110056 Ga0070669_1001100562 383
610 3300005471 Ga0070698_100010706 Ga0070698_1000107068 383
611 3300005535 Ga0070684_100004401 Ga0070684_1000044013 383
612 3300009036 Ga0105244_10000160 Ga0105244_1000016066 383
613 3300009093 Ga0105240_10044822 Ga0105240_100448222 383
614 3300009093 Ga0105240_10126436 Ga0105240_101264363 383
615 3300009148 Ga0105243_10000734 Ga0105243_1000073424 383
616 3300010375 Ga0105239_10059834 Ga0105239_100598341 383
617 3300013104 Ga0157370_10033056 Ga0157370_100330563 383
618 3300013105 Ga0157369_10302959 Ga0157369_103029592 383
619 3300013296 Ga0157374_10000025 Ga0157374_1000002570 383
620 3300013307 Ga0157372_10013871 Ga0157372_100138713 383
621 3300013308 Ga0157375_10000209 Ga0157375_1000020922 383
622 3300013308 Ga0157375_10216686 Ga0157375_102166862 383
623 3300014969 Ga0157376_10000892 Ga0157376_1000089210 383
624 3300015261 Ga0182006_1000001 Ga0182006_1000001923 383
625 3300025242 Ga0209258_100075 Ga0209258_10007537 383
626 3300025254 Ga0209148_1000085 Ga0209148_1000085193 383
627 3300025291 Ga0209675_1003045 Ga0209675_10030455 383
628 3300025728 Ga0207655_1000016 Ga0207655_1000016511 383
629 3300025909 Ga0207705_10009260 Ga0207705_100092607 383
630 3300025923 Ga0207681_10227426 Ga0207681_102274262 383
631 3300025935 Ga0207709_10000355 Ga0207709_100003554 383
632 3300025972 Ga0207668_10096611 Ga0207668_100966113 383
633 3300026142 Ga0207698_10327172 Ga0207698_103271721 383
634 3300031911 Ga0307412_10000036 Ga0307412_10000036137 383
635 3300031911 Ga0307412_10000677 Ga0307412_1000067718 383
636 3300031911 Ga0307412_10009055 Ga0307412_100090553 383
637 3300032002 Ga0307416_100000006 Ga0307416_10000000619 383
638 3300032004 Ga0307414_10000043 Ga0307414_1000004337 383
639 3300032004 Ga0307414_10037854 Ga0307414_100378543 383
640 3300041413 Ga0439465_0000069 Ga0439465_0000069_1186_2379 383
641 3300046453 Ga0495627_000081 Ga0495627_000081_24_1178 383
642 3300046500 Ga0495596_0002543 Ga0495596_0002543_4607_5758 383
643 3300046507 Ga0495606_0050953 Ga0495606_0050953_569_1723 383
644 3300046512 Ga0495610_0000005 Ga0495610_0000005_123505_124659 383
645 3300046519 Ga0495632_0002129 Ga0495632_0002129_501_1655 383
646 3300046525 Ga0495663_0005383 Ga0495663_0005383_1346_2500 383
647 3300046530 Ga0495654_0000003 Ga0495654_0000003_752605_753759 383
648 3300046558 Ga0495633_0000114 Ga0495633_0000114_61_1215 383
649 3300046558 Ga0495633_0031288 Ga0495633_0031288_810_1964 383
650 3300046660 Ga0495625_0002476 Ga0495625_0002476_9210_10364 383
651 3300047472 Ga0495686_0062493 Ga0495686_0062493_1091_2245 383
652 3300048906 Ga0496103_0078546 Ga0496103_0078546_18_1169 383
653 3300048919 Ga0496116_0000029 Ga0496116_0000029_3925_5076 383
654 3300048920 Ga0496117_0000007 Ga0496117_0000007_3129_4280 383
655 3300048921 Ga0496118_0015187 Ga0496118_0015187_2865_4016 383
656 3300048921 Ga0496118_0099818 Ga0496118_0099818_59_1213 383
657 3300048922 Ga0496119_0000007 Ga0496119_0000007_3196_4347 383
658 3300048923 Ga0496120_0067739 Ga0496120_0067739_469_1620 383
659 3300048925 Ga0496122_0000946 Ga0496122_0000946_14484_15638 383
660 3300048925 Ga0496122_0001893 Ga0496122_0001893_3936_5087 383
661 3300048925 Ga0496122_0001900 Ga0496122_0001900_3851_5002 383
662 3300048925 Ga0496122_0001976 Ga0496122_0001976_4209_5405 383
663 3300048925 Ga0496122_0002061 Ga0496122_0002061_3196_4347 383
664 3300048926 Ga0496123_0001726 Ga0496123_0001726_24446_25597 383
665 3300048926 Ga0496123_0008606 Ga0496123_0008606_111_1307 383
666 3300048927 Ga0496124_0001116 Ga0496124_0001116_38504_39655 383
667 3300048928 Ga0496125_0001777 Ga0496125_0001777_3782_4933 383
668 3300048928 Ga0496125_0017671 Ga0496125_0017671_3107_4258 383
669 3300048929 Ga0496126_0004748 Ga0496126_0004748_11840_12991 383
670 3300049758 Ga0501241_000002 Ga0501241_000002_153631_154788 383
671 3300049766 Ga0501269_000379 Ga0501269_000379_66_1223 383

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8217 55 119
5c82-assembly1.cif.gz_A-2 crystal structure of nourseothricin acetyltransferase 0.7959 55 119
1p0h-assembly1.cif.gz_A crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex 0.7597 1 369
1p0h-assembly1.cif.gz_A crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex 0.7574 1 369
6sll-assembly1.cif.gz_B diaminobutyrate acetyltransferase ecta from paenibacillus lautus in complex with its substrate l-2,4-diaminobutyric acid (dab) and coenzyme a 0.7548 195 331
ID Description Score Start End Superfamily
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8803 5 371 3.40.630.30
af_Q46840_21_390_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8715 5 371 3.40.630.30
af_K7KMF1_95_188_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.794 55 115 3.40.630.30
af_Q555H5_1389_1473_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7895 259 323 3.40.630.30
2d4oA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7791 57 115 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A848NBQ9-F1-model_v4 N-acetyltransferase domain-containing protein 0.9917 1 380
AF-A0A5C7EWC3-F1-model_v4 GNAT family N-acetyltransferase 0.9906 3 383
AF-A0A0Q5QCL4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9894 1 383
AF-A0A0Q5QCL4-F1-model_v4 N-acetyltransferase domain-containing protein 0.9868 1 383
AF-A0A381F7K6-F1-model_v4 N-acetyltransferase domain-containing protein 0.9858 1 383

Feature Viewer

pLDDT pTM Quality
94.32 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map