F474166
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 671 | 340 | 621 | 389 |
Family's Representative Sequence
| Representative Sequence | 3300030521|Ga0307511_10000228|Ga0307511_1000022824 |
| Length | 431 |
| Sequence | MINEGLKFGCKGKGEQGKIRNSIAQIPKNVYSSSELSIFALSDHFMQLIPITTPSQAKEFIQANVQLNRQNPAYIRPIDAEIDEVFDPAKNKAFRHGEITRWVLKDEEGKLIGRIAAFVNKKYKTKGDDVPVGGIGFFDCINDQEAADMLLDVARHWLSQRGMEAMDGPINFGERDKWWGLLTEGFYEPLYGMNFNPPYYRELLENYGFRPFFHQLCFSMDYKKPLNAKLQRRHETLAADPAYSARMIDKRQLLKFAEDFIAIYNPAYAGHGGLKEMKKDQAVQLFKKMKPLMDEKIVWFVYHNERPIAMFLNIPDLNQYFKHFNGRFGLLQKLYFLWLRRRGACKRFTGILFAIIPEFQGKGVDGYMIVEAGKVVQHQSSYEDYEMQWIGDFNPKMVNIAKGLGEVNRKLTTYRYLFDRAKEFKRHPMLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 2 | 2523533629 | Kaistella palustris DSM 21579 | Isolate | Rhizosphere |
| 3 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 4 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 5 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 6 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 7 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 8 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 9 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 10 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 11 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 12 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 13 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 14 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 15 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 16 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 17 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 18 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 19 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 20 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 21 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 22 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 23 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 24 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 25 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 26 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 27 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 28 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 29 | 2818991442 | Chitinophaga pinensis 1204 | Isolate | Unclassified |
| 30 | 2821136567 | Chitinophaga sancti 1232 | Isolate | Unclassified |
| 31 | 2839989709 | Pontibacter arcticus 2b14 | Isolate | Unclassified |
| 32 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 33 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 34 | 2884634485 | Algoriphagus kandeliae XY-J91 | Isolate | Unclassified |
| 35 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 36 | 2904467357 | Chitinophaga sancti 3198 | Isolate | Unclassified |
| 37 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 38 | 2910245624 | Adhaeribacter radiodurans KUDC8001 | Isolate | Rhizosphere |
| 39 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 40 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 41 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 42 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 43 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 44 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 45 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 46 | 2984572630 | Chryseobacterium sp. SORGH_AS909 | Isolate | Aerial Root |
| 47 | 2984606641 | Chryseobacterium sp. SORGH_AS1175 | Isolate | Aerial Root |
| 48 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 49 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 50 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 51 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 52 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 53 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 54 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 55 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 56 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 57 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 58 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 59 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 60 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 61 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 62 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 63 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 64 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 65 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 70 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 71 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 73 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 77 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 91 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 92 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 93 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 95 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 96 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 97 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 99 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 102 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 104 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 105 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 106 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 108 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 109 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 110 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 111 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 112 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 113 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 114 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 115 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 116 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 124 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 125 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 151 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 154 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 218 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 219 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 220 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 223 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 224 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 225 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 234 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 235 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 239 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 240 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 241 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 245 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 246 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 247 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 251 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 252 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 256 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 257 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 258 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 285 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 286 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 287 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 310 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 311 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 314 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 316 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 317 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 318 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 319 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 330 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 332 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 333 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 335 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 339 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 340 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.55 |
| Metatranscriptomes | 0 |
| Isolates | 7.45 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 5.96 |
| Nodule | 0.15 |
| Rhizoplane | 0.6 |
| Rhizosphere | 84.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1002211 | 3300001915 | Bacteria | 5163 |
| 2 | JGI24744J21845_10007449 | 3300002077 | Bacteria | 2261 |
| 3 | rootH1_10079717 | 3300003316 | Bacteria | 3130 |
| 4 | rootH2_10009982 | 3300003320 | Bacteria | 25986 |
| 5 | rootH2_10037920 | 3300003320 | Bacteria | 1945 |
| 6 | rootH2_10050136 | 3300003320 | Bacteria | 12982 |
| 7 | rootH2_10076592 | 3300003320 | Bacteria | 1912 |
| 8 | rootL2_10266713 | 3300003322 | Unclassified | 1345 |
| 9 | rootH1_10098969 | 3300003323 | Bacteria | 10813 |
| 10 | rootH1_10259345 | 3300003323 | Bacteria | 6300 |
| 11 | JGI25160J50197_1002332 | 3300003354 | Bacteria | 8881 |
| 12 | Ga0055535_1007746 | 3300003761 | Bacteria | 2013 |
| 13 | Ga0055534_1014363 | 3300003784 | Bacteria | 1486 |
| 14 | Ga0055528_1000307 | 3300003790 | Bacteria | 41483 |
| 15 | Ga0055528_1007947 | 3300003790 | Bacteria | 4622 |
| 16 | Ga0055530_10001712 | 3300003791 | Bacteria | 15455 |
| 17 | Ga0055531_10029535 | 3300003794 | Unclassified | 1865 |
| 18 | Ga0055543_1006891 | 3300004625 | Bacteria | 2689 |
| 19 | Ga0065165_1000722 | 3300005262 | Bacteria | 46444 |
| 20 | Ga0065704_10020003 | 3300005289 | Bacteria | 1572 |
| 21 | Ga0065707_10159377 | 3300005295 | Bacteria | 1577 |
| 22 | Ga0070658_10036022 | 3300005327 | Bacteria | 3987 |
| 23 | Ga0070658_10063362 | 3300005327 | Unclassified | 3014 |
| 24 | Ga0070658_10076384 | 3300005327 | Bacteria | 2747 |
| 25 | Ga0070658_10101670 | 3300005327 | Bacteria | 2376 |
| 26 | Ga0070676_10005231 | 3300005328 | Bacteria | 6897 |
| 27 | Ga0070676_10061783 | 3300005328 | Bacteria | 2227 |
| 28 | Ga0070683_100004016 | 3300005329 | Bacteria | 12045 |
| 29 | Ga0070683_100131528 | 3300005329 | Bacteria | 2368 |
| 30 | Ga0070690_100052813 | 3300005330 | Bacteria | 2599 |
| 31 | Ga0070690_100138638 | 3300005330 | Bacteria | 1649 |
| 32 | Ga0070690_100149921 | 3300005330 | Bacteria | 1590 |
| 33 | Ga0068869_100018653 | 3300005334 | Bacteria | 4727 |
| 34 | Ga0068869_100029041 | 3300005334 | Bacteria | 3870 |
| 35 | Ga0068869_100033033 | 3300005334 | Bacteria | 3651 |
| 36 | Ga0068869_100052755 | 3300005334 | Bacteria | 2954 |
| 37 | Ga0068869_100085349 | 3300005334 | Bacteria | 2365 |
| 38 | Ga0070666_10000031 | 3300005335 | Bacteria | 132089 |
| 39 | Ga0070666_10015920 | 3300005335 | Bacteria | 4804 |
| 40 | Ga0070666_10158582 | 3300005335 | Bacteria | 1581 |
| 41 | Ga0070680_100019674 | 3300005336 | Bacteria | 5354 |
| 42 | Ga0070680_100052971 | 3300005336 | Bacteria | 3312 |
| 43 | Ga0070680_100139304 | 3300005336 | Bacteria | 2034 |
| 44 | Ga0070682_100000152 | 3300005337 | Bacteria | 54283 |
| 45 | Ga0070682_100001276 | 3300005337 | Bacteria | 14283 |
| 46 | Ga0070682_100032428 | 3300005337 | Bacteria | 3168 |
| 47 | Ga0068868_100037647 | 3300005338 | Bacteria | 3751 |
| 48 | Ga0068868_100341245 | 3300005338 | Bacteria | 1281 |
| 49 | Ga0070660_100000201 | 3300005339 | Bacteria | 39920 |
| 50 | Ga0070660_100027411 | 3300005339 | Bacteria | 4251 |
| 51 | Ga0070660_100032879 | 3300005339 | Bacteria | 3907 |
| 52 | Ga0070660_100063853 | 3300005339 | Bacteria | 2863 |
| 53 | Ga0070689_100004257 | 3300005340 | Bacteria | 9644 |
| 54 | Ga0070689_100065057 | 3300005340 | Bacteria | 2839 |
| 55 | Ga0070689_100107592 | 3300005340 | Bacteria | 2214 |
| 56 | Ga0070689_100214550 | 3300005340 | Bacteria | 1576 |
| 57 | Ga0070687_100016820 | 3300005343 | Bacteria | 3348 |
| 58 | Ga0070687_100067809 | 3300005343 | Bacteria | 1906 |
| 59 | Ga0070661_100223479 | 3300005344 | Bacteria | 1445 |
| 60 | Ga0070668_100049616 | 3300005347 | Bacteria | 3229 |
| 61 | Ga0070669_100110056 | 3300005353 | Bacteria | 2089 |
| 62 | Ga0070669_100289760 | 3300005353 | Bacteria | 1314 |
| 63 | Ga0070675_100040413 | 3300005354 | Bacteria | 3807 |
| 64 | Ga0070675_100061496 | 3300005354 | Bacteria | 3101 |
| 65 | Ga0070675_100078587 | 3300005354 | Bacteria | 2748 |
| 66 | Ga0070675_100107187 | 3300005354 | Bacteria | 2359 |
| 67 | Ga0070671_100033594 | 3300005355 | Unclassified | 4244 |
| 68 | Ga0070673_100034978 | 3300005364 | Bacteria | 3807 |
| 69 | Ga0070673_100052550 | 3300005364 | Bacteria | 3197 |
| 70 | Ga0070688_100003898 | 3300005365 | Bacteria | 7739 |
| 71 | Ga0070688_100121359 | 3300005365 | Bacteria | 1751 |
| 72 | Ga0070688_100122504 | 3300005365 | Unclassified | 1744 |
| 73 | Ga0070659_100004878 | 3300005366 | Bacteria | 9586 |
| 74 | Ga0070667_100004341 | 3300005367 | Bacteria | 11955 |
| 75 | Ga0070667_100017484 | 3300005367 | Bacteria | 5943 |
| 76 | Ga0070667_100095160 | 3300005367 | Bacteria | 2567 |
| 77 | Ga0070667_100184404 | 3300005367 | Bacteria | 1846 |
| 78 | Ga0070667_100231935 | 3300005367 | Bacteria | 1646 |
| 79 | Ga0070700_100056409 | 3300005441 | Bacteria | 2462 |
| 80 | Ga0070663_100224131 | 3300005455 | Bacteria | 1477 |
| 81 | Ga0070662_100074215 | 3300005457 | Bacteria | 2515 |
| 82 | Ga0070681_10016117 | 3300005458 | Bacteria | 7450 |
| 83 | Ga0070681_10078377 | 3300005458 | Bacteria | 3261 |
| 84 | Ga0068867_100011283 | 3300005459 | Bacteria | 6302 |
| 85 | Ga0070685_10004480 | 3300005466 | Bacteria | 7066 |
| 86 | Ga0070685_10023197 | 3300005466 | Bacteria | 3395 |
| 87 | Ga0070698_100001241 | 3300005471 | Bacteria | 28439 |
| 88 | Ga0070698_100003438 | 3300005471 | Bacteria | 17408 |
| 89 | Ga0070698_100010706 | 3300005471 | Bacteria | 9767 |
| 90 | Ga0070698_100168177 | 3300005471 | Bacteria | 2134 |
| 91 | Ga0070679_100000836 | 3300005530 | Bacteria | 26787 |
| 92 | Ga0070679_100034505 | 3300005530 | Bacteria | 5014 |
| 93 | Ga0070684_100000232 | 3300005535 | Bacteria | 38587 |
| 94 | Ga0070684_100004401 | 3300005535 | Bacteria | 10717 |
| 95 | Ga0070684_100145662 | 3300005535 | Bacteria | 2144 |
| 96 | Ga0068853_100000103 | 3300005539 | Bacteria | 57277 |
| 97 | Ga0068853_100015582 | 3300005539 | Bacteria | 6245 |
| 98 | Ga0068853_100040621 | 3300005539 | Bacteria | 3970 |
| 99 | Ga0068853_100108228 | 3300005539 | Bacteria | 2466 |
| 100 | Ga0068853_100312223 | 3300005539 | Bacteria | 1456 |
| 101 | Ga0070672_100079740 | 3300005543 | Bacteria | 2621 |
| 102 | Ga0070686_100008636 | 3300005544 | Bacteria | 5708 |
| 103 | Ga0070693_100129416 | 3300005547 | Bacteria | 1576 |
| 104 | Ga0070665_100004340 | 3300005548 | Bacteria | 14914 |
| 105 | Ga0070665_100202416 | 3300005548 | Unclassified | 1986 |
| 106 | Ga0068855_100031705 | 3300005563 | Bacteria | 6310 |
| 107 | Ga0068855_100041522 | 3300005563 | Bacteria | 5451 |
| 108 | Ga0068855_100078179 | 3300005563 | Bacteria | 3839 |
| 109 | Ga0068855_100113607 | 3300005563 | Bacteria | 3106 |
| 110 | Ga0068855_100127024 | 3300005563 | Bacteria | 2915 |
| 111 | Ga0068855_100133045 | 3300005563 | Bacteria | 2839 |
| 112 | Ga0070664_100205394 | 3300005564 | Bacteria | 1759 |
| 113 | Ga0068857_100003404 | 3300005577 | Bacteria | 13251 |
| 114 | Ga0068857_100004875 | 3300005577 | Bacteria | 11385 |
| 115 | Ga0068857_100012331 | 3300005577 | Bacteria | 7439 |
| 116 | Ga0068857_100103068 | 3300005577 | Bacteria | 2562 |
| 117 | Ga0068854_100091866 | 3300005578 | Bacteria | 2260 |
| 118 | Ga0068856_100025473 | 3300005614 | Bacteria | 5769 |
| 119 | Ga0068856_100123380 | 3300005614 | Bacteria | 2593 |
| 120 | Ga0068856_100165314 | 3300005614 | Bacteria | 2224 |
| 121 | Ga0068856_100270077 | 3300005614 | Unclassified | 1717 |
| 122 | Ga0068856_100282956 | 3300005614 | Bacteria | 1675 |
| 123 | Ga0070702_100009538 | 3300005615 | Bacteria | 4755 |
| 124 | Ga0068852_100001078 | 3300005616 | Bacteria | 18040 |
| 125 | Ga0068852_100011910 | 3300005616 | Bacteria | 6577 |
| 126 | Ga0068852_100063037 | 3300005616 | Bacteria | 3226 |
| 127 | Ga0068859_100000045 | 3300005617 | Bacteria | 143607 |
| 128 | Ga0068859_100030038 | 3300005617 | Bacteria | 5453 |
| 129 | Ga0068859_100033339 | 3300005617 | Bacteria | 5172 |
| 130 | Ga0068859_100094941 | 3300005617 | Unclassified | 3035 |
| 131 | Ga0068859_100097286 | 3300005617 | Bacteria | 2996 |
| 132 | Ga0068859_100141676 | 3300005617 | Bacteria | 2478 |
| 133 | Ga0068864_100001622 | 3300005618 | Bacteria | 18523 |
| 134 | Ga0068864_100045766 | 3300005618 | Bacteria | 3754 |
| 135 | Ga0068861_100003382 | 3300005719 | Bacteria | 10578 |
| 136 | Ga0068870_10036100 | 3300005840 | Bacteria | 2541 |
| 137 | Ga0068863_100003089 | 3300005841 | Bacteria | 16457 |
| 138 | Ga0068863_100006337 | 3300005841 | Bacteria | 11603 |
| 139 | Ga0068863_100271972 | 3300005841 | Bacteria | 1640 |
| 140 | Ga0068858_100024945 | 3300005842 | Bacteria | 5565 |
| 141 | Ga0068858_100084450 | 3300005842 | Bacteria | 2953 |
| 142 | Ga0068858_100126819 | 3300005842 | Unclassified | 2390 |
| 143 | Ga0068860_100001289 | 3300005843 | Bacteria | 27204 |
| 144 | Ga0068860_100007137 | 3300005843 | Bacteria | 11176 |
| 145 | Ga0068860_100010059 | 3300005843 | Bacteria | 9372 |
| 146 | Ga0068860_100011449 | 3300005843 | Bacteria | 8738 |
| 147 | Ga0068860_100044074 | 3300005843 | Bacteria | 4253 |
| 148 | Ga0068862_100035626 | 3300005844 | Bacteria | 4216 |
| 149 | Ga0081540_1021338 | 3300005983 | Bacteria | 3861 |
| 150 | Ga0075366_10017458 | 3300006195 | Bacteria | 4130 |
| 151 | Ga0075366_10121674 | 3300006195 | Bacteria | 1573 |
| 152 | Ga0097621_100001013 | 3300006237 | Bacteria | 19778 |
| 153 | Ga0097621_100011779 | 3300006237 | Bacteria | 6458 |
| 154 | Ga0097621_100154600 | 3300006237 | Bacteria | 1968 |
| 155 | Ga0097621_100163905 | 3300006237 | Bacteria | 1912 |
| 156 | Ga0068871_100007075 | 3300006358 | Bacteria | 7998 |
| 157 | Ga0068871_100015208 | 3300006358 | Bacteria | 5754 |
| 158 | Ga0068871_100082353 | 3300006358 | Bacteria | 2668 |
| 159 | Ga0068871_100173743 | 3300006358 | Bacteria | 1848 |
| 160 | Ga0068871_100279132 | 3300006358 | Bacteria | 1461 |
| 161 | Ga0075428_100010044 | 3300006844 | Bacteria | 10516 |
| 162 | Ga0075428_100048626 | 3300006844 | Unclassified | 4655 |
| 163 | Ga0075430_100034545 | 3300006846 | Bacteria | 4291 |
| 164 | Ga0075431_100009298 | 3300006847 | Bacteria | 9860 |
| 165 | Ga0075431_100028606 | 3300006847 | Bacteria | 5730 |
| 166 | Ga0075429_100006202 | 3300006880 | Bacteria | 10343 |
| 167 | Ga0068865_100081601 | 3300006881 | Unclassified | 2323 |
| 168 | Ga0097620_100000045 | 3300006931 | Bacteria | 143607 |
| 169 | Ga0097620_100030038 | 3300006931 | Bacteria | 5453 |
| 170 | Ga0097620_100033339 | 3300006931 | Bacteria | 5172 |
| 171 | Ga0097620_100094942 | 3300006931 | Unclassified | 3035 |
| 172 | Ga0097620_100097286 | 3300006931 | Bacteria | 2996 |
| 173 | Ga0097620_100141676 | 3300006931 | Bacteria | 2478 |
| 174 | Ga0105244_10000160 | 3300009036 | Bacteria | 69914 |
| 175 | Ga0105240_10000040 | 3300009093 | Bacteria | 264634 |
| 176 | Ga0105240_10001675 | 3300009093 | Bacteria | 37595 |
| 177 | Ga0105240_10016117 | 3300009093 | Bacteria | 10127 |
| 178 | Ga0105240_10016598 | 3300009093 | Bacteria | 9963 |
| 179 | Ga0105240_10019498 | 3300009093 | Bacteria | 9060 |
| 180 | Ga0105240_10022970 | 3300009093 | Bacteria | 8261 |
| 181 | Ga0105240_10030232 | 3300009093 | Bacteria | 7041 |
| 182 | Ga0105240_10044822 | 3300009093 | Bacteria | 5615 |
| 183 | Ga0105240_10049425 | 3300009093 | Bacteria | 5307 |
| 184 | Ga0105240_10060410 | 3300009093 | Bacteria | 4725 |
| 185 | Ga0105240_10126436 | 3300009093 | Bacteria | 3071 |
| 186 | Ga0111539_10061973 | 3300009094 | Bacteria | 4429 |
| 187 | Ga0111539_10085088 | 3300009094 | Bacteria | 3717 |
| 188 | Ga0111539_10127052 | 3300009094 | Unclassified | 2986 |
| 189 | Ga0111539_10157559 | 3300009094 | Unclassified | 2657 |
| 190 | Ga0105247_10001867 | 3300009101 | Bacteria | 14743 |
| 191 | Ga0105247_10048650 | 3300009101 | Bacteria | 2604 |
| 192 | Ga0114129_10005331 | 3300009147 | Bacteria | 18156 |
| 193 | Ga0114129_10022630 | 3300009147 | Bacteria | 8914 |
| 194 | Ga0105243_10000734 | 3300009148 | Bacteria | 31383 |
| 195 | Ga0105241_10001060 | 3300009174 | Bacteria | 20957 |
| 196 | Ga0105241_10009040 | 3300009174 | Bacteria | 7329 |
| 197 | Ga0105241_10023896 | 3300009174 | Bacteria | 4536 |
| 198 | Ga0105241_10134609 | 3300009174 | Bacteria | 2005 |
| 199 | Ga0105241_10345116 | 3300009174 | Bacteria | 1291 |
| 200 | Ga0105242_10012376 | 3300009176 | Bacteria | 6567 |
| 201 | Ga0105242_10111192 | 3300009176 | Bacteria | 2335 |
| 202 | Ga0105242_10134512 | 3300009176 | Bacteria | 2138 |
| 203 | Ga0105242_10136704 | 3300009176 | Bacteria | 2122 |
| 204 | Ga0105237_10000710 | 3300009545 | Bacteria | 46041 |
| 205 | Ga0105237_10002600 | 3300009545 | Bacteria | 22265 |
| 206 | Ga0105237_10006952 | 3300009545 | Bacteria | 12475 |
| 207 | Ga0105237_10008509 | 3300009545 | Bacteria | 11097 |
| 208 | Ga0105237_10012157 | 3300009545 | Bacteria | 9081 |
| 209 | Ga0105237_10017744 | 3300009545 | Bacteria | 7378 |
| 210 | Ga0105237_10056726 | 3300009545 | Bacteria | 3920 |
| 211 | Ga0105237_10081659 | 3300009545 | Bacteria | 3223 |
| 212 | Ga0105238_10021649 | 3300009551 | Bacteria | 6549 |
| 213 | Ga0105238_10043345 | 3300009551 | Bacteria | 4553 |
| 214 | Ga0105249_10002002 | 3300009553 | Bacteria | 17698 |
| 215 | Ga0105249_10002678 | 3300009553 | Bacteria | 15401 |
| 216 | Ga0105249_10003252 | 3300009553 | Bacteria | 14074 |
| 217 | Ga0105249_10025900 | 3300009553 | Bacteria | 5283 |
| 218 | Ga0105249_10066632 | 3300009553 | Bacteria | 3315 |
| 219 | Ga0105249_10078162 | 3300009553 | Bacteria | 3070 |
| 220 | Ga0105249_10223003 | 3300009553 | Bacteria | 1856 |
| 221 | Ga0105249_10350883 | 3300009553 | Bacteria | 1495 |
| 222 | Ga0105239_10000133 | 3300010375 | Bacteria | 105033 |
| 223 | Ga0105239_10000155 | 3300010375 | Bacteria | 98415 |
| 224 | Ga0105239_10002424 | 3300010375 | Bacteria | 23755 |
| 225 | Ga0105239_10003358 | 3300010375 | Bacteria | 19664 |
| 226 | Ga0105239_10012014 | 3300010375 | Bacteria | 9656 |
| 227 | Ga0105239_10041014 | 3300010375 | Bacteria | 5073 |
| 228 | Ga0105239_10059834 | 3300010375 | Bacteria | 4180 |
| 229 | Ga0105239_10081324 | 3300010375 | Bacteria | 3565 |
| 230 | Ga0105239_10198320 | 3300010375 | Bacteria | 2248 |
| 231 | Ga0105239_10205777 | 3300010375 | Bacteria | 2205 |
| 232 | Ga0105246_10058294 | 3300011119 | Bacteria | 2675 |
| 233 | Ga0105246_10083019 | 3300011119 | Bacteria | 2288 |
| 234 | Ga0157373_10000006 | 3300013100 | Bacteria | 261768 |
| 235 | Ga0157373_10008939 | 3300013100 | Bacteria | 7410 |
| 236 | Ga0157373_10091116 | 3300013100 | Bacteria | 2147 |
| 237 | Ga0157373_10151782 | 3300013100 | Bacteria | 1629 |
| 238 | Ga0157371_10002372 | 3300013102 | Bacteria | 18010 |
| 239 | Ga0157371_10018427 | 3300013102 | Bacteria | 5162 |
| 240 | Ga0157371_10021384 | 3300013102 | Bacteria | 4750 |
| 241 | Ga0157371_10021719 | 3300013102 | Bacteria | 4709 |
| 242 | Ga0157371_10123604 | 3300013102 | Bacteria | 1840 |
| 243 | Ga0157371_10202293 | 3300013102 | Bacteria | 1424 |
| 244 | Ga0157370_10000585 | 3300013104 | Bacteria | 45433 |
| 245 | Ga0157370_10001018 | 3300013104 | Bacteria | 35308 |
| 246 | Ga0157370_10033056 | 3300013104 | Bacteria | 5045 |
| 247 | Ga0157370_10098774 | 3300013104 | Bacteria | 2737 |
| 248 | Ga0157370_10138597 | 3300013104 | Bacteria | 2267 |
| 249 | Ga0157370_10162662 | 3300013104 | Bacteria | 2076 |
| 250 | Ga0157370_10266930 | 3300013104 | Bacteria | 1581 |
| 251 | Ga0157369_10036682 | 3300013105 | Bacteria | 5370 |
| 252 | Ga0157369_10044601 | 3300013105 | Bacteria | 4825 |
| 253 | Ga0157369_10302959 | 3300013105 | Bacteria | 1662 |
| 254 | Ga0157374_10000025 | 3300013296 | Bacteria | 245131 |
| 255 | Ga0157374_10053493 | 3300013296 | Bacteria | 3764 |
| 256 | Ga0157374_10134520 | 3300013296 | Bacteria | 2395 |
| 257 | Ga0157374_10139202 | 3300013296 | Bacteria | 2355 |
| 258 | Ga0157378_10010333 | 3300013297 | Bacteria | 8149 |
| 259 | Ga0157378_10016998 | 3300013297 | Bacteria | 6378 |
| 260 | Ga0157378_10069852 | 3300013297 | Bacteria | 3152 |
| 261 | Ga0157378_10346894 | 3300013297 | Bacteria | 1449 |
| 262 | Ga0163162_10001289 | 3300013306 | Bacteria | 23440 |
| 263 | Ga0163162_10006376 | 3300013306 | Bacteria | 11422 |
| 264 | Ga0163162_10033897 | 3300013306 | Bacteria | 5077 |
| 265 | Ga0163162_10040893 | 3300013306 | Bacteria | 4637 |
| 266 | Ga0163162_10120363 | 3300013306 | Bacteria | 2729 |
| 267 | Ga0163162_10510372 | 3300013306 | Bacteria | 1332 |
| 268 | Ga0157372_10000294 | 3300013307 | Bacteria | 55599 |
| 269 | Ga0157372_10000582 | 3300013307 | Bacteria | 39937 |
| 270 | Ga0157372_10013871 | 3300013307 | Bacteria | 8607 |
| 271 | Ga0157372_10018908 | 3300013307 | Bacteria | 7414 |
| 272 | Ga0157372_10024498 | 3300013307 | Bacteria | 6557 |
| 273 | Ga0157372_10042920 | 3300013307 | Bacteria | 5005 |
| 274 | Ga0157372_10070836 | 3300013307 | Bacteria | 3924 |
| 275 | Ga0157372_10153881 | 3300013307 | Bacteria | 2655 |
| 276 | Ga0157372_10214981 | 3300013307 | Bacteria | 2228 |
| 277 | Ga0157375_10000209 | 3300013308 | Bacteria | 54570 |
| 278 | Ga0157375_10096980 | 3300013308 | Bacteria | 3022 |
| 279 | Ga0157375_10179898 | 3300013308 | Bacteria | 2266 |
| 280 | Ga0157375_10216686 | 3300013308 | Bacteria | 2072 |
| 281 | Ga0163163_10040361 | 3300014325 | Unclassified | 4557 |
| 282 | Ga0163163_10069315 | 3300014325 | Bacteria | 3511 |
| 283 | Ga0163163_10227992 | 3300014325 | Bacteria | 1912 |
| 284 | Ga0163163_10285138 | 3300014325 | Bacteria | 1703 |
| 285 | Ga0157380_10000085 | 3300014326 | Bacteria | 52062 |
| 286 | Ga0182008_10000003 | 3300014497 | Bacteria | 456880 |
| 287 | Ga0157377_10007687 | 3300014745 | Bacteria | 5222 |
| 288 | Ga0157376_10000892 | 3300014969 | Bacteria | 19514 |
| 289 | Ga0157376_10063722 | 3300014969 | Bacteria | 3106 |
| 290 | Ga0182006_1000001 | 3300015261 | Bacteria | 1091090 |
| 291 | Ga0182005_1000071 | 3300015265 | Bacteria | 84771 |
| 292 | Ga0163161_10032678 | 3300017792 | Bacteria | 3717 |
| 293 | Ga0163161_10213990 | 3300017792 | Bacteria | 1490 |
| 294 | Ga0163161_10225004 | 3300017792 | Bacteria | 1454 |
| 295 | Ga0209436_102850 | 3300025208 | Bacteria | 4896 |
| 296 | Ga0209258_100075 | 3300025242 | Bacteria | 270751 |
| 297 | Ga0209646_1000876 | 3300025246 | Bacteria | 9991 |
| 298 | Ga0209148_1000085 | 3300025254 | Bacteria | 265193 |
| 299 | Ga0209673_1000242 | 3300025273 | Bacteria | 104669 |
| 300 | Ga0209675_1003045 | 3300025291 | Bacteria | 8225 |
| 301 | Ga0209758_1005981 | 3300025297 | Bacteria | 9011 |
| 302 | Ga0209758_1008438 | 3300025297 | Bacteria | 6672 |
| 303 | Ga0209050_1000298 | 3300025298 | Bacteria | 104315 |
| 304 | Ga0207426_1001104 | 3300025302 | Bacteria | 24841 |
| 305 | Ga0207426_1003320 | 3300025302 | Bacteria | 8903 |
| 306 | Ga0207426_1011838 | 3300025302 | Bacteria | 3301 |
| 307 | Ga0209257_1001270 | 3300025304 | Bacteria | 30945 |
| 308 | Ga0207655_1000016 | 3300025728 | Bacteria | 551476 |
| 309 | Ga0207710_10001020 | 3300025900 | Bacteria | 14622 |
| 310 | Ga0207710_10024388 | 3300025900 | Bacteria | 2604 |
| 311 | Ga0207688_10145581 | 3300025901 | Bacteria | 1397 |
| 312 | Ga0207680_10000381 | 3300025903 | Bacteria | 21208 |
| 313 | Ga0207680_10157501 | 3300025903 | Bacteria | 1520 |
| 314 | Ga0207647_10009037 | 3300025904 | Bacteria | 7095 |
| 315 | Ga0207647_10052313 | 3300025904 | Bacteria | 2521 |
| 316 | Ga0207645_10022683 | 3300025907 | Bacteria | 4081 |
| 317 | Ga0207645_10090423 | 3300025907 | Bacteria | 1968 |
| 318 | Ga0207643_10002262 | 3300025908 | Bacteria | 10493 |
| 319 | Ga0207705_10009260 | 3300025909 | Bacteria | 7164 |
| 320 | Ga0207654_10002167 | 3300025911 | Bacteria | 10053 |
| 321 | Ga0207654_10014389 | 3300025911 | Bacteria | 4087 |
| 322 | Ga0207654_10014404 | 3300025911 | Bacteria | 4086 |
| 323 | Ga0207654_10021660 | 3300025911 | Bacteria | 3420 |
| 324 | Ga0207654_10166300 | 3300025911 | Bacteria | 1428 |
| 325 | Ga0207707_10247460 | 3300025912 | Unclassified | 1549 |
| 326 | Ga0207695_10000041 | 3300025913 | Bacteria | 450902 |
| 327 | Ga0207695_10000282 | 3300025913 | Bacteria | 126242 |
| 328 | Ga0207695_10000363 | 3300025913 | Bacteria | 103522 |
| 329 | Ga0207695_10000647 | 3300025913 | Bacteria | 69264 |
| 330 | Ga0207695_10002667 | 3300025913 | Bacteria | 26073 |
| 331 | Ga0207695_10029084 | 3300025913 | Bacteria | 6115 |
| 332 | Ga0207695_10061184 | 3300025913 | Bacteria | 3893 |
| 333 | Ga0207671_10007629 | 3300025914 | Bacteria | 9351 |
| 334 | Ga0207671_10020255 | 3300025914 | Bacteria | 5066 |
| 335 | Ga0207671_10021298 | 3300025914 | Bacteria | 4920 |
| 336 | Ga0207671_10146567 | 3300025914 | Bacteria | 1821 |
| 337 | Ga0207660_10009202 | 3300025917 | Bacteria | 6390 |
| 338 | Ga0207657_10001516 | 3300025919 | Bacteria | 24881 |
| 339 | Ga0207657_10020393 | 3300025919 | Bacteria | 6264 |
| 340 | Ga0207657_10034034 | 3300025919 | Bacteria | 4587 |
| 341 | Ga0207649_10021758 | 3300025920 | Bacteria | 3697 |
| 342 | Ga0207649_10287051 | 3300025920 | Bacteria | 1198 |
| 343 | Ga0207652_10008365 | 3300025921 | Bacteria | 8321 |
| 344 | Ga0207652_10009232 | 3300025921 | Bacteria | 7934 |
| 345 | Ga0207681_10016298 | 3300025923 | Bacteria | 4647 |
| 346 | Ga0207681_10024666 | 3300025923 | Bacteria | 3861 |
| 347 | Ga0207681_10227426 | 3300025923 | Bacteria | 1446 |
| 348 | Ga0207694_10046142 | 3300025924 | Bacteria | 3368 |
| 349 | Ga0207694_10151790 | 3300025924 | Bacteria | 1867 |
| 350 | Ga0207659_10067709 | 3300025926 | Bacteria | 2594 |
| 351 | Ga0207644_10201161 | 3300025931 | Bacteria | 1571 |
| 352 | Ga0207706_10009214 | 3300025933 | Bacteria | 9068 |
| 353 | Ga0207706_10028796 | 3300025933 | Bacteria | 4958 |
| 354 | Ga0207686_10001766 | 3300025934 | Bacteria | 12028 |
| 355 | Ga0207686_10100521 | 3300025934 | Bacteria | 1930 |
| 356 | Ga0207686_10153098 | 3300025934 | Bacteria | 1607 |
| 357 | Ga0207709_10000355 | 3300025935 | Bacteria | 46675 |
| 358 | Ga0207670_10004749 | 3300025936 | Bacteria | 7369 |
| 359 | Ga0207670_10005483 | 3300025936 | Bacteria | 6970 |
| 360 | Ga0207670_10085741 | 3300025936 | Bacteria | 2214 |
| 361 | Ga0207669_10002707 | 3300025937 | Bacteria | 7584 |
| 362 | Ga0207691_10001776 | 3300025940 | Bacteria | 21223 |
| 363 | Ga0207691_10056602 | 3300025940 | Bacteria | 3572 |
| 364 | Ga0207689_10002278 | 3300025942 | Bacteria | 17956 |
| 365 | Ga0207689_10005351 | 3300025942 | Bacteria | 11492 |
| 366 | Ga0207689_10005867 | 3300025942 | Bacteria | 10885 |
| 367 | Ga0207689_10009880 | 3300025942 | Bacteria | 8225 |
| 368 | Ga0207689_10024182 | 3300025942 | Bacteria | 5096 |
| 369 | Ga0207661_10022325 | 3300025944 | Bacteria | 4764 |
| 370 | Ga0207661_10025164 | 3300025944 | Unclassified | 4523 |
| 371 | Ga0207679_10013108 | 3300025945 | Bacteria | 5428 |
| 372 | Ga0207679_10188528 | 3300025945 | Bacteria | 1712 |
| 373 | Ga0207667_10000403 | 3300025949 | Bacteria | 58481 |
| 374 | Ga0207667_10002943 | 3300025949 | Bacteria | 21138 |
| 375 | Ga0207667_10024878 | 3300025949 | Bacteria | 6565 |
| 376 | Ga0207667_10069889 | 3300025949 | Bacteria | 3655 |
| 377 | Ga0207667_10083746 | 3300025949 | Bacteria | 3302 |
| 378 | Ga0207667_10260123 | 3300025949 | Bacteria | 1775 |
| 379 | Ga0207651_10014588 | 3300025960 | Bacteria | 4543 |
| 380 | Ga0207712_10002600 | 3300025961 | Bacteria | 11579 |
| 381 | Ga0207712_10002732 | 3300025961 | Bacteria | 11271 |
| 382 | Ga0207712_10005321 | 3300025961 | Bacteria | 8126 |
| 383 | Ga0207712_10007140 | 3300025961 | Bacteria | 7047 |
| 384 | Ga0207712_10020061 | 3300025961 | Bacteria | 4373 |
| 385 | Ga0207668_10096611 | 3300025972 | Bacteria | 2184 |
| 386 | Ga0207640_10035820 | 3300025981 | Bacteria | 3110 |
| 387 | Ga0207658_10003968 | 3300025986 | Bacteria | 10391 |
| 388 | Ga0207658_10118474 | 3300025986 | Bacteria | 2106 |
| 389 | Ga0207677_10041580 | 3300026023 | Bacteria | 3041 |
| 390 | Ga0207677_10160302 | 3300026023 | Bacteria | 1747 |
| 391 | Ga0207703_10009138 | 3300026035 | Bacteria | 7802 |
| 392 | Ga0207703_10046177 | 3300026035 | Bacteria | 3507 |
| 393 | Ga0207703_10092251 | 3300026035 | Bacteria | 2549 |
| 394 | Ga0207703_10395356 | 3300026035 | Bacteria | 1281 |
| 395 | Ga0207639_10000812 | 3300026041 | Bacteria | 21212 |
| 396 | Ga0207639_10007187 | 3300026041 | Bacteria | 7586 |
| 397 | Ga0207639_10073213 | 3300026041 | Bacteria | 2685 |
| 398 | Ga0207639_10079850 | 3300026041 | Bacteria | 2586 |
| 399 | Ga0207639_10098994 | 3300026041 | Bacteria | 2352 |
| 400 | Ga0207708_10035730 | 3300026075 | Bacteria | 3782 |
| 401 | Ga0207702_10091585 | 3300026078 | Bacteria | 2662 |
| 402 | Ga0207702_10116976 | 3300026078 | Bacteria | 2380 |
| 403 | Ga0207702_10210810 | 3300026078 | Unclassified | 1806 |
| 404 | Ga0207641_10000133 | 3300026088 | Bacteria | 109199 |
| 405 | Ga0207641_10000549 | 3300026088 | Bacteria | 42051 |
| 406 | Ga0207641_10033652 | 3300026088 | Bacteria | 4258 |
| 407 | Ga0207648_10018930 | 3300026089 | Bacteria | 6220 |
| 408 | Ga0207648_10027799 | 3300026089 | Bacteria | 5018 |
| 409 | Ga0207648_10052785 | 3300026089 | Bacteria | 3555 |
| 410 | Ga0207648_10102280 | 3300026089 | Bacteria | 2511 |
| 411 | Ga0207648_10125193 | 3300026089 | Bacteria | 2260 |
| 412 | Ga0207676_10021480 | 3300026095 | Bacteria | 4735 |
| 413 | Ga0207676_10276046 | 3300026095 | Bacteria | 1524 |
| 414 | Ga0207676_10381976 | 3300026095 | Bacteria | 1311 |
| 415 | Ga0207676_10415124 | 3300026095 | Bacteria | 1261 |
| 416 | Ga0207674_10000600 | 3300026116 | Bacteria | 47324 |
| 417 | Ga0207674_10000755 | 3300026116 | Bacteria | 42269 |
| 418 | Ga0207674_10049258 | 3300026116 | Bacteria | 4309 |
| 419 | Ga0207674_10134557 | 3300026116 | Bacteria | 2434 |
| 420 | Ga0207674_10172946 | 3300026116 | Bacteria | 2113 |
| 421 | Ga0207674_10199914 | 3300026116 | Bacteria | 1948 |
| 422 | Ga0207675_100005880 | 3300026118 | Bacteria | 11706 |
| 423 | Ga0207675_100039927 | 3300026118 | Bacteria | 4379 |
| 424 | Ga0207683_10051263 | 3300026121 | Bacteria | 3616 |
| 425 | Ga0207698_10004932 | 3300026142 | Bacteria | 8180 |
| 426 | Ga0207698_10037744 | 3300026142 | Unclassified | 3561 |
| 427 | Ga0207698_10327172 | 3300026142 | Bacteria | 1438 |
| 428 | Ga0268266_10000026 | 3300028379 | Bacteria | 434485 |
| 429 | Ga0268264_10000015 | 3300028381 | Bacteria | 508501 |
| 430 | Ga0268264_10000019 | 3300028381 | Bacteria | 488112 |
| 431 | Ga0268264_10000054 | 3300028381 | Bacteria | 317048 |
| 432 | Ga0268264_10001568 | 3300028381 | Bacteria | 21208 |
| 433 | Ga0268264_10008314 | 3300028381 | Bacteria | 8626 |
| 434 | Ga0268264_10019724 | 3300028381 | Bacteria | 5508 |
| 435 | Ga0268264_10049395 | 3300028381 | Bacteria | 3500 |
| 436 | Ga0265323_10000858 | 3300028653 | Bacteria | 16158 |
| 437 | Ga0265336_10018321 | 3300028666 | Bacteria | 2270 |
| 438 | Ga0307517_10000651 | 3300028786 | Bacteria | 59585 |
| 439 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 440 | Ga0307511_10000228 | 3300030521 | Bacteria | 57237 |
| 441 | Ga0265327_10021796 | 3300031251 | Bacteria | 3855 |
| 442 | Ga0265316_10000401 | 3300031344 | Bacteria | 49342 |
| 443 | Ga0265316_10007723 | 3300031344 | Bacteria | 10080 |
| 444 | Ga0307513_10128346 | 3300031456 | Bacteria | 2486 |
| 445 | Ga0307509_10201839 | 3300031507 | Bacteria | 1824 |
| 446 | Ga0265342_10069366 | 3300031712 | Unclassified | 2059 |
| 447 | Ga0307516_10001571 | 3300031730 | Bacteria | 31452 |
| 448 | Ga0307516_10069974 | 3300031730 | Bacteria | 3374 |
| 449 | Ga0307412_10000036 | 3300031911 | Bacteria | 192270 |
| 450 | Ga0307412_10000677 | 3300031911 | Bacteria | 19768 |
| 451 | Ga0307412_10009055 | 3300031911 | Bacteria | 5704 |
| 452 | Ga0307416_100000006 | 3300032002 | Bacteria | 466074 |
| 453 | Ga0307414_10000043 | 3300032004 | Bacteria | 137764 |
| 454 | Ga0307414_10000118 | 3300032004 | Bacteria | 56182 |
| 455 | Ga0307414_10002983 | 3300032004 | Bacteria | 8960 |
| 456 | Ga0307414_10025499 | 3300032004 | Bacteria | 3789 |
| 457 | Ga0307414_10037854 | 3300032004 | Bacteria | 3234 |
| 458 | Ga0307510_10000650 | 3300033180 | Bacteria | 35339 |
| 459 | Ga0373955_0044342 | 3300035172 | Bacteria | 2395 |
| 460 | Ga0373927_0016164 | 3300035695 | Bacteria | 4924 |
| 461 | Ga0373937_0026430 | 3300036401 | Bacteria | 5246 |
| 462 | Ga0395899_0009711 | 3300037312 | Bacteria | 7385 |
| 463 | Ga0395900_0008178 | 3300037418 | Bacteria | 10764 |
| 464 | Ga0395900_0166678 | 3300037418 | Bacteria | 2245 |
| 465 | Ga0395900_0169069 | 3300037418 | Bacteria | 2226 |
| 466 | Ga0395898_0011708 | 3300037466 | Bacteria | 9095 |
| 467 | Ga0395905_0020312 | 3300037471 | Bacteria | 6292 |
| 468 | Ga0395901_0014250 | 3300038443 | Bacteria | 8095 |
| 469 | Ga0439436_0000451 | 3300041404 | Bacteria | 10493 |
| 470 | Ga0439466_0013706 | 3300041411 | Bacteria | 2964 |
| 471 | Ga0439465_0000069 | 3300041413 | Bacteria | 22418 |
| 472 | Ga0451795_1332565 | 3300041456 | Bacteria | 1487 |
| 473 | Ga0451807_2302037 | 3300041486 | Bacteria | 3072 |
| 474 | Ga0451853_1731523 | 3300041512 | Bacteria | 3226 |
| 475 | Ga0439445_0020832 | 3300042004 | Bacteria | 1644 |
| 476 | Ga0439449_0059057 | 3300042007 | Bacteria | 1416 |
| 477 | Ga0439457_000066 | 3300042014 | Bacteria | 22683 |
| 478 | Ga0439462_0018605 | 3300042015 | Bacteria | 1804 |
| 479 | Ga0451577_0001198 | 3300042876 | Bacteria | 36335 |
| 480 | Ga0451577_0009122 | 3300042876 | Bacteria | 9573 |
| 481 | Ga0451577_0191664 | 3300042876 | Bacteria | 1844 |
| 482 | Ga0466969_0000004 | 3300044656 | Bacteria | 168068 |
| 483 | Ga0466972_0000017 | 3300044658 | Bacteria | 199884 |
| 484 | Ga0466972_0000500 | 3300044658 | Bacteria | 19594 |
| 485 | Ga0466966_0000295 | 3300044684 | Bacteria | 32723 |
| 486 | Ga0466961_0011193 | 3300044693 | Bacteria | 5736 |
| 487 | Ga0466964_0027934 | 3300044706 | Bacteria | 2219 |
| 488 | Ga0453684_0001281 | 3300044712 | Bacteria | 75118 |
| 489 | Ga0453684_0001619 | 3300044712 | Bacteria | 61621 |
| 490 | Ga0453684_0003038 | 3300044712 | Bacteria | 39029 |
| 491 | Ga0466970_0018872 | 3300044765 | Bacteria | 3572 |
| 492 | Ga0466970_0031131 | 3300044765 | Bacteria | 2817 |
| 493 | Ga0466957_0001466 | 3300044842 | Bacteria | 12365 |
| 494 | Ga0466957_0057610 | 3300044842 | Bacteria | 2378 |
| 495 | Ga0466959_0000004 | 3300045049 | Bacteria | 216815 |
| 496 | Ga0466959_0000566 | 3300045049 | Bacteria | 21533 |
| 497 | Ga0495627_000081 | 3300046453 | Bacteria | 116262 |
| 498 | Ga0495627_044018 | 3300046453 | Bacteria | 1363 |
| 499 | Ga0495592_0081730 | 3300046454 | Bacteria | 2336 |
| 500 | Ga0495638_0031527 | 3300046460 | Bacteria | 3406 |
| 501 | Ga0495653_0118277 | 3300046463 | Bacteria | 1893 |
| 502 | Ga0495596_0002543 | 3300046500 | Bacteria | 9747 |
| 503 | Ga0495606_0003999 | 3300046507 | Bacteria | 15050 |
| 504 | Ga0495606_0050953 | 3300046507 | Bacteria | 2703 |
| 505 | Ga0495608_0063346 | 3300046511 | Bacteria | 2427 |
| 506 | Ga0495610_0000005 | 3300046512 | Bacteria | 924111 |
| 507 | Ga0495630_0060363 | 3300046517 | Bacteria | 2846 |
| 508 | Ga0495632_0002129 | 3300046519 | Bacteria | 15416 |
| 509 | Ga0495648_0001530 | 3300046524 | Bacteria | 22622 |
| 510 | Ga0495663_0000680 | 3300046525 | Bacteria | 11726 |
| 511 | Ga0495663_0005383 | 3300046525 | Bacteria | 3552 |
| 512 | Ga0495654_0000003 | 3300046530 | Bacteria | 863485 |
| 513 | Ga0495598_0009585 | 3300046537 | Bacteria | 2294 |
| 514 | Ga0495621_0005078 | 3300046539 | Bacteria | 3756 |
| 515 | Ga0495633_0000022 | 3300046558 | Bacteria | 226582 |
| 516 | Ga0495633_0000114 | 3300046558 | Bacteria | 108708 |
| 517 | Ga0495633_0031288 | 3300046558 | Bacteria | 2582 |
| 518 | Ga0495668_0004556 | 3300046616 | Bacteria | 9761 |
| 519 | Ga0495611_0001127 | 3300046648 | Bacteria | 14007 |
| 520 | Ga0495611_0033424 | 3300046648 | Bacteria | 2269 |
| 521 | Ga0495625_0002476 | 3300046660 | Bacteria | 19910 |
| 522 | Ga0495625_0178743 | 3300046660 | Bacteria | 1413 |
| 523 | Ga0495599_0114542 | 3300046678 | Bacteria | 1678 |
| 524 | Ga0495672_0016266 | 3300047320 | Bacteria | 5020 |
| 525 | Ga0495672_0019138 | 3300047320 | Bacteria | 4526 |
| 526 | Ga0495687_000031 | 3300047443 | Bacteria | 274659 |
| 527 | Ga0495684_0152327 | 3300047471 | Bacteria | 1728 |
| 528 | Ga0495686_0000128 | 3300047472 | Bacteria | 156223 |
| 529 | Ga0495686_0021354 | 3300047472 | Unclassified | 4302 |
| 530 | Ga0495686_0062493 | 3300047472 | Bacteria | 2310 |
| 531 | Ga0496103_0078546 | 3300048906 | Bacteria | 2073 |
| 532 | Ga0496110_0114393 | 3300048913 | Bacteria | 2428 |
| 533 | Ga0496116_0000029 | 3300048919 | Bacteria | 422187 |
| 534 | Ga0496117_0000007 | 3300048920 | Bacteria | 720505 |
| 535 | Ga0496118_0015187 | 3300048921 | Bacteria | 7150 |
| 536 | Ga0496118_0099818 | 3300048921 | Bacteria | 1966 |
| 537 | Ga0496119_0000007 | 3300048922 | Bacteria | 475920 |
| 538 | Ga0496120_0067739 | 3300048923 | Bacteria | 1971 |
| 539 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 540 | Ga0496122_0000946 | 3300048925 | Bacteria | 52631 |
| 541 | Ga0496122_0001893 | 3300048925 | Bacteria | 31687 |
| 542 | Ga0496122_0001900 | 3300048925 | Bacteria | 31591 |
| 543 | Ga0496122_0001976 | 3300048925 | Bacteria | 30631 |
| 544 | Ga0496122_0002061 | 3300048925 | Bacteria | 29808 |
| 545 | Ga0496123_0001726 | 3300048926 | Bacteria | 29009 |
| 546 | Ga0496123_0008606 | 3300048926 | Bacteria | 9340 |
| 547 | Ga0496124_0001116 | 3300048927 | Bacteria | 42242 |
| 548 | Ga0496125_0001777 | 3300048928 | Bacteria | 29790 |
| 549 | Ga0496125_0017671 | 3300048928 | Bacteria | 6790 |
| 550 | Ga0496126_0004748 | 3300048929 | Bacteria | 16022 |
| 551 | Ga0501032_0002044 | 3300049569 | Bacteria | 15933 |
| 552 | Ga0501033_0021393 | 3300049570 | Bacteria | 4880 |
| 553 | Ga0501034_0009033 | 3300049571 | Bacteria | 10466 |
| 554 | Ga0501034_0015128 | 3300049571 | Bacteria | 7930 |
| 555 | Ga0501036_0011432 | 3300049572 | Bacteria | 7348 |
| 556 | Ga0501037_0006267 | 3300049573 | Bacteria | 8696 |
| 557 | Ga0501037_0032056 | 3300049573 | Bacteria | 3880 |
| 558 | Ga0501038_0011204 | 3300049574 | Bacteria | 8186 |
| 559 | Ga0501038_0028995 | 3300049574 | Bacteria | 4910 |
| 560 | Ga0501043_0007889 | 3300049579 | Bacteria | 8415 |
| 561 | Ga0501043_0015301 | 3300049579 | Bacteria | 6010 |
| 562 | Ga0501043_0135302 | 3300049579 | Bacteria | 1931 |
| 563 | Ga0501046_0011009 | 3300049580 | Bacteria | 7752 |
| 564 | Ga0501047_0025590 | 3300049581 | Bacteria | 5673 |
| 565 | Ga0501047_0045479 | 3300049581 | Bacteria | 4245 |
| 566 | Ga0501047_0057178 | 3300049581 | Bacteria | 3772 |
| 567 | Ga0501047_0071567 | 3300049581 | Bacteria | 3337 |
| 568 | Ga0501047_0090965 | 3300049581 | Bacteria | 2929 |
| 569 | Ga0501047_0195725 | 3300049581 | Bacteria | 1884 |
| 570 | Ga0501048_0048606 | 3300049582 | Bacteria | 3025 |
| 571 | Ga0501070_0013567 | 3300049586 | Bacteria | 6868 |
| 572 | Ga0501072_0153683 | 3300049588 | Bacteria | 1835 |
| 573 | Ga0501073_0003476 | 3300049589 | Bacteria | 11825 |
| 574 | Ga0501074_0003529 | 3300049590 | Bacteria | 11096 |
| 575 | Ga0501201_000329 | 3300049651 | Bacteria | 4368 |
| 576 | Ga0501223_000724 | 3300049663 | Bacteria | 7868 |
| 577 | Ga0501224_000319 | 3300049664 | Bacteria | 5632 |
| 578 | Ga0501235_001375 | 3300049669 | Bacteria | 5158 |
| 579 | Ga0501242_000579 | 3300049674 | Bacteria | 3311 |
| 580 | Ga0501252_000079 | 3300049682 | Bacteria | 5041 |
| 581 | Ga0501257_006977 | 3300049686 | Bacteria | 2516 |
| 582 | Ga0501259_001418 | 3300049688 | Bacteria | 3985 |
| 583 | Ga0501259_001520 | 3300049688 | Bacteria | 3863 |
| 584 | Ga0501221_000581 | 3300049704 | Bacteria | 5835 |
| 585 | Ga0501225_0000487 | 3300049705 | Bacteria | 12349 |
| 586 | Ga0501225_0005736 | 3300049705 | Bacteria | 3636 |
| 587 | Ga0501083_0096139 | 3300049744 | Bacteria | 1954 |
| 588 | Ga0501241_000002 | 3300049758 | Bacteria | 194532 |
| 589 | Ga0501241_000383 | 3300049758 | Bacteria | 9690 |
| 590 | Ga0501269_000379 | 3300049766 | Bacteria | 10698 |
| 591 | Ga0501035_0002820 | 3300049822 | Bacteria | 16814 |
| 592 | Ga0501035_0033250 | 3300049822 | Bacteria | 4690 |
| 593 | Ga0501044_0002356 | 3300049823 | Bacteria | 21549 |
| 594 | Ga0501044_0022628 | 3300049823 | Bacteria | 6695 |
| 595 | Ga0501044_0030671 | 3300049823 | Bacteria | 5664 |
| 596 | nmdc:mga0k408_11249_c2 | 3300050493 | Bacteria | 4187 |
| 597 | nmdc:mga0k408_27448_c1 | 3300050493 | Bacteria | 3233 |
| 598 | nmdc:mga05p37_38869_c1 | 3300050507 | Bacteria | 5837 |
| 599 | nmdc:mga09592_20617_c1 | 3300050508 | Bacteria | 5423 |
| 600 | nmdc:mga09592_44624_c1 | 3300050508 | Bacteria | 3733 |
| 601 | nmdc:mga06r32_138949_c1 | 3300050510 | Bacteria | 2405 |
| 602 | nmdc:mga06r32_48218_c1 | 3300050510 | Bacteria | 4071 |
| 603 | nmdc:mga08y16_109132_c1 | 3300050511 | Bacteria | 2881 |
| 604 | nmdc:mga08y16_135439_c1 | 3300050511 | Unclassified | 2560 |
| 605 | nmdc:mga08y16_94718_c1 | 3300050511 | Bacteria | 3110 |
| 606 | Ga0500578_0087192 | 3300053086 | Bacteria | 1983 |
| 607 | Ga0500644_0000593 | 3300053088 | Bacteria | 13830 |
| 608 | Ga0500646_0001495 | 3300053090 | Bacteria | 6146 |
| 609 | Ga0500583_0000062 | 3300053092 | Bacteria | 67892 |
| 610 | Ga0500583_0000276 | 3300053092 | Bacteria | 17969 |
| 611 | Ga0500583_0001457 | 3300053092 | Bacteria | 6785 |
| 612 | Ga0500569_000223 | 3300053109 | Bacteria | 8953 |
| 613 | Ga0500642_0016477 | 3300053130 | Bacteria | 2809 |
| 614 | Ga0500658_0007468 | 3300053134 | Bacteria | 4040 |
| 615 | Ga0500568_0000511 | 3300053139 | Bacteria | 28633 |
| 616 | Ga0500577_0001525 | 3300053142 | Bacteria | 5902 |
| 617 | Ga0500589_025059 | 3300053147 | Bacteria | 2760 |
| 618 | Ga0500622_0000144 | 3300053156 | Bacteria | 75663 |
| 619 | Ga0500622_0000926 | 3300053156 | Bacteria | 24930 |
| 620 | Ga0500622_0034403 | 3300053156 | Bacteria | 2654 |
| 621 | Ga0501084_0064508 | 3300054114 | Bacteria | 3065 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025920 | Ga0207649_10287051 | Ga0207649_102870512 | 330 |
| 2 | 3300049651 | Ga0501201_000329 | Ga0501201_000329_882_2048 | 361 |
| 3 | 3300049663 | Ga0501223_000724 | Ga0501223_000724_3804_4970 | 361 |
| 4 | 3300049664 | Ga0501224_000319 | Ga0501224_000319_166_1332 | 361 |
| 5 | 3300049669 | Ga0501235_001375 | Ga0501235_001375_2310_3476 | 361 |
| 6 | 3300049682 | Ga0501252_000079 | Ga0501252_000079_2684_3850 | 361 |
| 7 | 3300049688 | Ga0501259_001520 | Ga0501259_001520_1908_3074 | 361 |
| 8 | 3300049704 | Ga0501221_000581 | Ga0501221_000581_4311_5477 | 361 |
| 9 | 3300049705 | Ga0501225_0000487 | Ga0501225_0000487_7561_8727 | 361 |
| 10 | 3300003322 | rootL2_10266713 | rootL2_102667131 | 363 |
| 11 | 3300047320 | Ga0495672_0016266 | Ga0495672_0016266_3800_4969 | 363 |
| 12 | 3300013102 | Ga0157371_10002372 | Ga0157371_100023723 | 364 |
| 13 | 3300013104 | Ga0157370_10098774 | Ga0157370_100987742 | 364 |
| 14 | 3300015265 | Ga0182005_1000071 | Ga0182005_100007125 | 364 |
| 15 | 3300005353 | Ga0070669_100289760 | Ga0070669_1002897601 | 370 |
| 16 | 3300005367 | Ga0070667_100231935 | Ga0070667_1002319352 | 370 |
| 17 | 3300014326 | Ga0157380_10000085 | Ga0157380_1000008533 | 370 |
| 18 | 3300005334 | Ga0068869_100033033 | Ga0068869_1000330332 | 371 |
| 19 | 3300009176 | Ga0105242_10134512 | Ga0105242_101345122 | 371 |
| 20 | 3300025934 | Ga0207686_10153098 | Ga0207686_101530982 | 371 |
| 21 | 3300025942 | Ga0207689_10005351 | Ga0207689_1000535110 | 371 |
| 22 | 3300026089 | Ga0207648_10052785 | Ga0207648_100527852 | 371 |
| 23 | 3300005330 | Ga0070690_100052813 | Ga0070690_1000528133 | 372 |
| 24 | 3300005340 | Ga0070689_100065057 | Ga0070689_1000650573 | 372 |
| 25 | 3300005354 | Ga0070675_100040413 | Ga0070675_1000404132 | 372 |
| 26 | 3300005544 | Ga0070686_100008636 | Ga0070686_1000086364 | 372 |
| 27 | 3300005564 | Ga0070664_100205394 | Ga0070664_1002053942 | 372 |
| 28 | 3300005615 | Ga0070702_100009538 | Ga0070702_1000095381 | 372 |
| 29 | 3300025901 | Ga0207688_10145581 | Ga0207688_101455811 | 372 |
| 30 | 3300025907 | Ga0207645_10090423 | Ga0207645_100904232 | 372 |
| 31 | 3300025931 | Ga0207644_10201161 | Ga0207644_102011611 | 372 |
| 32 | 3300025940 | Ga0207691_10056602 | Ga0207691_100566023 | 372 |
| 33 | 3300025945 | Ga0207679_10013108 | Ga0207679_100131083 | 372 |
| 34 | 3300026023 | Ga0207677_10041580 | Ga0207677_100415802 | 372 |
| 35 | 3300026035 | Ga0207703_10395356 | Ga0207703_103953561 | 372 |
| 36 | 3300026121 | Ga0207683_10051263 | Ga0207683_100512632 | 372 |
| 37 | iso_pu_bacteria | 2739367866 | 2740032167 | 374 |
| 38 | 3300005337 | Ga0070682_100001276 | Ga0070682_1000012764 | 375 |
| 39 | 3300005459 | Ga0068867_100011283 | Ga0068867_1000112834 | 376 |
| 40 | 3300009176 | Ga0105242_10012376 | Ga0105242_100123765 | 376 |
| 41 | 3300026089 | Ga0207648_10018930 | Ga0207648_100189303 | 376 |
| 42 | 3300028794 | Ga0307515_10000001 | Ga0307515_100000013667 | 376 |
| 43 | iso_pu_bacteria | 2884634485 | 2884637318 | 376 |
| 44 | iso_pu_bacteria | 2919692658 | 2919697545 | 376 |
| 45 | 3300005339 | Ga0070660_100000201 | Ga0070660_10000020111 | 377 |
| 46 | 3300025919 | Ga0207657_10001516 | Ga0207657_1000151613 | 377 |
| 47 | 3300046616 | Ga0495668_0004556 | Ga0495668_0004556_1522_2676 | 377 |
| 48 | iso_pu_bacteria | 2585428115 | 2587945381 | 377 |
| 49 | iso_pu_bacteria | 2839989709 | 2839991403 | 377 |
| 50 | iso_pu_bacteria | 2910245624 | 2910247858 | 377 |
| 51 | iso_pu_bacteria | 2511231000 | 2511231035 | 378 |
| 52 | iso_pu_bacteria | 2523533629 | 2524006166 | 378 |
| 53 | iso_pu_bacteria | 2582581281 | 2585156499 | 378 |
| 54 | iso_pu_bacteria | 2582581282 | 2585160850 | 378 |
| 55 | iso_pu_bacteria | 2585428061 | 2587752268 | 378 |
| 56 | iso_pu_bacteria | 2818991442 | 2819571871 | 378 |
| 57 | iso_pu_bacteria | 2821136567 | 2821141885 | 378 |
| 58 | iso_pu_bacteria | 2884634485 | 2884636702 | 378 |
| 59 | iso_pu_bacteria | 2904467357 | 2904469702 | 378 |
| 60 | iso_pu_bacteria | 2929921140 | 2929927737 | 378 |
| 61 | iso_pu_bacteria | 2582581278 | 2585143660 | 379 |
| 62 | iso_pu_bacteria | 2585428045 | 2587680048 | 379 |
| 63 | iso_pu_bacteria | 2585428060 | 2587748704 | 379 |
| 64 | iso_pu_bacteria | 2585428182 | 2588211563 | 379 |
| 65 | iso_pu_bacteria | 2585428183 | 2588215947 | 379 |
| 66 | iso_pu_bacteria | 2585428184 | 2588219369 | 379 |
| 67 | iso_pu_bacteria | 2585428185 | 2588224851 | 379 |
| 68 | iso_pu_bacteria | 2585428187 | 2588234683 | 379 |
| 69 | iso_pu_bacteria | 2588253712 | 2588447638 | 379 |
| 70 | iso_pu_bacteria | 2588254255 | 2590603268 | 379 |
| 71 | iso_pu_bacteria | 2588254257 | 2590610281 | 379 |
| 72 | iso_pu_bacteria | 2728369107 | 2729200689 | 379 |
| 73 | iso_pu_bacteria | 2738541273 | 2738698321 | 379 |
| 74 | iso_pu_bacteria | 2738543014 | 2739252647 | 379 |
| 75 | iso_pu_bacteria | 2739367874 | 2740060501 | 379 |
| 76 | iso_pu_bacteria | 2751185877 | 2753674271 | 379 |
| 77 | iso_pu_bacteria | 2765235839 | 2765575759 | 379 |
| 78 | iso_pu_bacteria | 2772190705 | 2772606100 | 379 |
| 79 | iso_pu_bacteria | 2775506739 | 2775674264 | 379 |
| 80 | iso_pu_bacteria | 2816332188 | 2816875598 | 379 |
| 81 | iso_pu_bacteria | 2842083920 | 2842086327 | 379 |
| 82 | iso_pu_bacteria | 2871720351 | 2871723679 | 379 |
| 83 | iso_pu_bacteria | 2889290771 | 2889293745 | 379 |
| 84 | iso_pu_bacteria | 2905999023 | 2906001110 | 379 |
| 85 | iso_pu_bacteria | 2919097161 | 2919100760 | 379 |
| 86 | iso_pu_bacteria | 2919399522 | 2919403122 | 379 |
| 87 | iso_pu_bacteria | 2945924605 | 2945924730 | 379 |
| 88 | iso_pu_bacteria | 2946019816 | 2946024154 | 379 |
| 89 | iso_pu_bacteria | 2977243572 | 2977247682 | 379 |
| 90 | iso_pu_bacteria | 2984572630 | 2984574515 | 379 |
| 91 | iso_pu_bacteria | 2984606641 | 2984607966 | 379 |
| 92 | iso_pu_bacteria | 2993372514 | 2993375024 | 379 |
| 93 | iso_pu_bacteria | 2993480792 | 2993481888 | 379 |
| 94 | 3300030521 | Ga0307511_10000228 | Ga0307511_1000022824 | 380 |
| 95 | 3300032004 | Ga0307414_10000118 | Ga0307414_100001186 | 380 |
| 96 | 3300032004 | Ga0307414_10002983 | Ga0307414_100029838 | 380 |
| 97 | 3300032004 | Ga0307414_10025499 | Ga0307414_100254992 | 380 |
| 98 | 3300044842 | Ga0466957_0057610 | Ga0466957_0057610_257_1444 | 380 |
| 99 | 3300003316 | rootH1_10079717 | rootH1_100797171 | 381 |
| 100 | 3300003323 | rootH1_10098969 | rootH1_100989697 | 381 |
| 101 | 3300005334 | Ga0068869_100018653 | Ga0068869_1000186531 | 381 |
| 102 | 3300005340 | Ga0070689_100107592 | Ga0070689_1001075922 | 381 |
| 103 | 3300005471 | Ga0070698_100168177 | Ga0070698_1001681771 | 381 |
| 104 | 3300005563 | Ga0068855_100078179 | Ga0068855_1000781792 | 381 |
| 105 | 3300005577 | Ga0068857_100012331 | Ga0068857_1000123315 | 381 |
| 106 | 3300005614 | Ga0068856_100025473 | Ga0068856_1000254732 | 381 |
| 107 | 3300005617 | Ga0068859_100141676 | Ga0068859_1001416761 | 381 |
| 108 | 3300005843 | Ga0068860_100007137 | Ga0068860_1000071374 | 381 |
| 109 | 3300005844 | Ga0068862_100035626 | Ga0068862_1000356262 | 381 |
| 110 | 3300006195 | Ga0075366_10121674 | Ga0075366_101216741 | 381 |
| 111 | 3300006358 | Ga0068871_100082353 | Ga0068871_1000823532 | 381 |
| 112 | 3300006931 | Ga0097620_100141676 | Ga0097620_1001416761 | 381 |
| 113 | 3300009093 | Ga0105240_10000040 | Ga0105240_1000004038 | 381 |
| 114 | 3300009174 | Ga0105241_10023896 | Ga0105241_100238963 | 381 |
| 115 | 3300009545 | Ga0105237_10008509 | Ga0105237_100085094 | 381 |
| 116 | 3300009553 | Ga0105249_10003252 | Ga0105249_1000325211 | 381 |
| 117 | 3300010375 | Ga0105239_10000133 | Ga0105239_1000013361 | 381 |
| 118 | 3300010375 | Ga0105239_10003358 | Ga0105239_100033582 | 381 |
| 119 | 3300013100 | Ga0157373_10151782 | Ga0157373_101517822 | 381 |
| 120 | 3300013102 | Ga0157371_10021384 | Ga0157371_100213842 | 381 |
| 121 | 3300013296 | Ga0157374_10139202 | Ga0157374_101392021 | 381 |
| 122 | 3300013297 | Ga0157378_10346894 | Ga0157378_103468941 | 381 |
| 123 | 3300013306 | Ga0163162_10001289 | Ga0163162_1000128925 | 381 |
| 124 | 3300013307 | Ga0157372_10042920 | Ga0157372_100429205 | 381 |
| 125 | 3300025246 | Ga0209646_1000876 | Ga0209646_10008761 | 381 |
| 126 | 3300025297 | Ga0209758_1005981 | Ga0209758_10059814 | 381 |
| 127 | 3300025302 | Ga0207426_1011838 | Ga0207426_10118382 | 381 |
| 128 | 3300025911 | Ga0207654_10014404 | Ga0207654_100144043 | 381 |
| 129 | 3300025913 | Ga0207695_10000041 | Ga0207695_10000041201 | 381 |
| 130 | 3300025914 | Ga0207671_10146567 | Ga0207671_101465672 | 381 |
| 131 | 3300025936 | Ga0207670_10085741 | Ga0207670_100857412 | 381 |
| 132 | 3300025949 | Ga0207667_10024878 | Ga0207667_100248785 | 381 |
| 133 | 3300025961 | Ga0207712_10005321 | Ga0207712_100053212 | 381 |
| 134 | 3300026023 | Ga0207677_10160302 | Ga0207677_101603022 | 381 |
| 135 | 3300026078 | Ga0207702_10091585 | Ga0207702_100915852 | 381 |
| 136 | 3300026089 | Ga0207648_10125193 | Ga0207648_101251932 | 381 |
| 137 | 3300026116 | Ga0207674_10134557 | Ga0207674_101345572 | 381 |
| 138 | 3300031456 | Ga0307513_10128346 | Ga0307513_101283462 | 381 |
| 139 | 3300031507 | Ga0307509_10201839 | Ga0307509_102018393 | 381 |
| 140 | 3300035695 | Ga0373927_0016164 | Ga0373927_0016164_3118_4281 | 381 |
| 141 | 3300037418 | Ga0395900_0166678 | Ga0395900_0166678_62_1222 | 381 |
| 142 | 3300037471 | Ga0395905_0020312 | Ga0395905_0020312_4863_6023 | 381 |
| 143 | 3300041404 | Ga0439436_0000451 | Ga0439436_0000451_3096_4289 | 381 |
| 144 | 3300041456 | Ga0451795_1332565 | Ga0451795_1332565_221_1387 | 381 |
| 145 | 3300041512 | Ga0451853_1731523 | Ga0451853_1731523_38_1201 | 381 |
| 146 | 3300042007 | Ga0439449_0059057 | Ga0439449_0059057_215_1378 | 381 |
| 147 | 3300042014 | Ga0439457_000066 | Ga0439457_000066_1388_2581 | 381 |
| 148 | 3300042015 | Ga0439462_0018605 | Ga0439462_0018605_590_1783 | 381 |
| 149 | 3300042876 | Ga0451577_0001198 | Ga0451577_0001198_19982_21148 | 381 |
| 150 | 3300044656 | Ga0466969_0000004 | Ga0466969_0000004_65281_66471 | 381 |
| 151 | 3300044658 | Ga0466972_0000017 | Ga0466972_0000017_90508_91776 | 381 |
| 152 | 3300044684 | Ga0466966_0000295 | Ga0466966_0000295_17503_18693 | 381 |
| 153 | 3300044706 | Ga0466964_0027934 | Ga0466964_0027934_680_1870 | 381 |
| 154 | 3300044712 | Ga0453684_0001619 | Ga0453684_0001619_8245_9411 | 381 |
| 155 | 3300044842 | Ga0466957_0001466 | Ga0466957_0001466_5788_6981 | 381 |
| 156 | 3300045049 | Ga0466959_0000004 | Ga0466959_0000004_201473_202663 | 381 |
| 157 | 3300047471 | Ga0495684_0152327 | Ga0495684_0152327_228_1388 | 381 |
| 158 | 3300049579 | Ga0501043_0135302 | Ga0501043_0135302_13_1206 | 381 |
| 159 | 3300049581 | Ga0501047_0025590 | Ga0501047_0025590_3766_4929 | 381 |
| 160 | 3300049581 | Ga0501047_0057178 | Ga0501047_0057178_2350_3543 | 381 |
| 161 | 3300049581 | Ga0501047_0090965 | Ga0501047_0090965_629_1819 | 381 |
| 162 | 3300049674 | Ga0501242_000579 | Ga0501242_000579_831_1994 | 381 |
| 163 | 3300049686 | Ga0501257_006977 | Ga0501257_006977_1156_2319 | 381 |
| 164 | 3300049688 | Ga0501259_001418 | Ga0501259_001418_1903_3066 | 381 |
| 165 | 3300049705 | Ga0501225_0005736 | Ga0501225_0005736_2294_3487 | 381 |
| 166 | 3300049823 | Ga0501044_0022628 | Ga0501044_0022628_730_1923 | 381 |
| 167 | 3300050493 | nmdc:mga0k408_27448_c1 | nmdc:mga0k408_27448_c1_2026_3189 | 381 |
| 168 | 3300053086 | Ga0500578_0087192 | Ga0500578_0087192_352_1614 | 381 |
| 169 | 3300053092 | Ga0500583_0000062 | Ga0500583_0000062_47525_48718 | 381 |
| 170 | 3300053092 | Ga0500583_0000276 | Ga0500583_0000276_16335_17498 | 381 |
| 171 | 3300053147 | Ga0500589_025059 | Ga0500589_025059_221_1384 | 381 |
| 172 | 3300053156 | Ga0500622_0034403 | Ga0500622_0034403_460_1623 | 381 |
| 173 | iso_pu_bacteria | 2738541278 | 2738724497 | 381 |
| 174 | 3300002077 | JGI24744J21845_10007449 | JGI24744J21845_100074492 | 382 |
| 175 | 3300003320 | rootH2_10009982 | rootH2_100099822 | 382 |
| 176 | 3300003320 | rootH2_10037920 | rootH2_100379202 | 382 |
| 177 | 3300003320 | rootH2_10050136 | rootH2_100501362 | 382 |
| 178 | 3300003320 | rootH2_10076592 | rootH2_100765922 | 382 |
| 179 | 3300003354 | JGI25160J50197_1002332 | JGI25160J50197_10023324 | 382 |
| 180 | 3300003790 | Ga0055528_1000307 | Ga0055528_10003073 | 382 |
| 181 | 3300003790 | Ga0055528_1007947 | Ga0055528_10079472 | 382 |
| 182 | 3300003791 | Ga0055530_10001712 | Ga0055530_1000171211 | 382 |
| 183 | 3300003794 | Ga0055531_10029535 | Ga0055531_100295352 | 382 |
| 184 | 3300004625 | Ga0055543_1006891 | Ga0055543_10068912 | 382 |
| 185 | 3300005262 | Ga0065165_1000722 | Ga0065165_100072222 | 382 |
| 186 | 3300005289 | Ga0065704_10020003 | Ga0065704_100200032 | 382 |
| 187 | 3300005295 | Ga0065707_10159377 | Ga0065707_101593772 | 382 |
| 188 | 3300005327 | Ga0070658_10036022 | Ga0070658_100360223 | 382 |
| 189 | 3300005327 | Ga0070658_10063362 | Ga0070658_100633622 | 382 |
| 190 | 3300005327 | Ga0070658_10076384 | Ga0070658_100763842 | 382 |
| 191 | 3300005327 | Ga0070658_10101670 | Ga0070658_101016702 | 382 |
| 192 | 3300005328 | Ga0070676_10005231 | Ga0070676_100052315 | 382 |
| 193 | 3300005328 | Ga0070676_10061783 | Ga0070676_100617832 | 382 |
| 194 | 3300005329 | Ga0070683_100131528 | Ga0070683_1001315283 | 382 |
| 195 | 3300005330 | Ga0070690_100138638 | Ga0070690_1001386381 | 382 |
| 196 | 3300005330 | Ga0070690_100149921 | Ga0070690_1001499211 | 382 |
| 197 | 3300005334 | Ga0068869_100029041 | Ga0068869_1000290412 | 382 |
| 198 | 3300005334 | Ga0068869_100052755 | Ga0068869_1000527552 | 382 |
| 199 | 3300005334 | Ga0068869_100085349 | Ga0068869_1000853491 | 382 |
| 200 | 3300005335 | Ga0070666_10000031 | Ga0070666_1000003121 | 382 |
| 201 | 3300005335 | Ga0070666_10015920 | Ga0070666_100159202 | 382 |
| 202 | 3300005335 | Ga0070666_10158582 | Ga0070666_101585822 | 382 |
| 203 | 3300005336 | Ga0070680_100019674 | Ga0070680_1000196743 | 382 |
| 204 | 3300005336 | Ga0070680_100052971 | Ga0070680_1000529712 | 382 |
| 205 | 3300005336 | Ga0070680_100139304 | Ga0070680_1001393041 | 382 |
| 206 | 3300005337 | Ga0070682_100000152 | Ga0070682_10000015245 | 382 |
| 207 | 3300005337 | Ga0070682_100032428 | Ga0070682_1000324283 | 382 |
| 208 | 3300005338 | Ga0068868_100037647 | Ga0068868_1000376473 | 382 |
| 209 | 3300005338 | Ga0068868_100341245 | Ga0068868_1003412451 | 382 |
| 210 | 3300005339 | Ga0070660_100027411 | Ga0070660_1000274113 | 382 |
| 211 | 3300005339 | Ga0070660_100032879 | Ga0070660_1000328792 | 382 |
| 212 | 3300005340 | Ga0070689_100004257 | Ga0070689_1000042573 | 382 |
| 213 | 3300005340 | Ga0070689_100214550 | Ga0070689_1002145501 | 382 |
| 214 | 3300005343 | Ga0070687_100016820 | Ga0070687_1000168202 | 382 |
| 215 | 3300005343 | Ga0070687_100067809 | Ga0070687_1000678092 | 382 |
| 216 | 3300005344 | Ga0070661_100223479 | Ga0070661_1002234791 | 382 |
| 217 | 3300005354 | Ga0070675_100061496 | Ga0070675_1000614962 | 382 |
| 218 | 3300005354 | Ga0070675_100078587 | Ga0070675_1000785872 | 382 |
| 219 | 3300005354 | Ga0070675_100107187 | Ga0070675_1001071872 | 382 |
| 220 | 3300005355 | Ga0070671_100033594 | Ga0070671_1000335943 | 382 |
| 221 | 3300005364 | Ga0070673_100034978 | Ga0070673_1000349784 | 382 |
| 222 | 3300005364 | Ga0070673_100052550 | Ga0070673_1000525502 | 382 |
| 223 | 3300005365 | Ga0070688_100003898 | Ga0070688_1000038982 | 382 |
| 224 | 3300005365 | Ga0070688_100121359 | Ga0070688_1001213591 | 382 |
| 225 | 3300005365 | Ga0070688_100122504 | Ga0070688_1001225041 | 382 |
| 226 | 3300005366 | Ga0070659_100004878 | Ga0070659_1000048786 | 382 |
| 227 | 3300005367 | Ga0070667_100004341 | Ga0070667_1000043417 | 382 |
| 228 | 3300005367 | Ga0070667_100017484 | Ga0070667_1000174843 | 382 |
| 229 | 3300005367 | Ga0070667_100095160 | Ga0070667_1000951601 | 382 |
| 230 | 3300005367 | Ga0070667_100184404 | Ga0070667_1001844042 | 382 |
| 231 | 3300005441 | Ga0070700_100056409 | Ga0070700_1000564092 | 382 |
| 232 | 3300005455 | Ga0070663_100224131 | Ga0070663_1002241311 | 382 |
| 233 | 3300005457 | Ga0070662_100074215 | Ga0070662_1000742151 | 382 |
| 234 | 3300005458 | Ga0070681_10016117 | Ga0070681_100161172 | 382 |
| 235 | 3300005458 | Ga0070681_10078377 | Ga0070681_100783772 | 382 |
| 236 | 3300005466 | Ga0070685_10004480 | Ga0070685_100044803 | 382 |
| 237 | 3300005466 | Ga0070685_10023197 | Ga0070685_100231972 | 382 |
| 238 | 3300005471 | Ga0070698_100001241 | Ga0070698_10000124114 | 382 |
| 239 | 3300005471 | Ga0070698_100003438 | Ga0070698_10000343813 | 382 |
| 240 | 3300005530 | Ga0070679_100000836 | Ga0070679_1000008363 | 382 |
| 241 | 3300005530 | Ga0070679_100034505 | Ga0070679_1000345053 | 382 |
| 242 | 3300005535 | Ga0070684_100000232 | Ga0070684_1000002321 | 382 |
| 243 | 3300005535 | Ga0070684_100145662 | Ga0070684_1001456622 | 382 |
| 244 | 3300005539 | Ga0068853_100000103 | Ga0068853_10000010326 | 382 |
| 245 | 3300005539 | Ga0068853_100015582 | Ga0068853_1000155823 | 382 |
| 246 | 3300005539 | Ga0068853_100040621 | Ga0068853_1000406212 | 382 |
| 247 | 3300005539 | Ga0068853_100108228 | Ga0068853_1001082282 | 382 |
| 248 | 3300005539 | Ga0068853_100312223 | Ga0068853_1003122231 | 382 |
| 249 | 3300005543 | Ga0070672_100079740 | Ga0070672_1000797402 | 382 |
| 250 | 3300005547 | Ga0070693_100129416 | Ga0070693_1001294162 | 382 |
| 251 | 3300005548 | Ga0070665_100004340 | Ga0070665_1000043404 | 382 |
| 252 | 3300005548 | Ga0070665_100202416 | Ga0070665_1002024162 | 382 |
| 253 | 3300005563 | Ga0068855_100031705 | Ga0068855_1000317053 | 382 |
| 254 | 3300005563 | Ga0068855_100041522 | Ga0068855_1000415227 | 382 |
| 255 | 3300005563 | Ga0068855_100113607 | Ga0068855_1001136073 | 382 |
| 256 | 3300005563 | Ga0068855_100127024 | Ga0068855_1001270242 | 382 |
| 257 | 3300005563 | Ga0068855_100133045 | Ga0068855_1001330451 | 382 |
| 258 | 3300005577 | Ga0068857_100003404 | Ga0068857_10000340413 | 382 |
| 259 | 3300005577 | Ga0068857_100004875 | Ga0068857_10000487510 | 382 |
| 260 | 3300005577 | Ga0068857_100103068 | Ga0068857_1001030682 | 382 |
| 261 | 3300005578 | Ga0068854_100091866 | Ga0068854_1000918662 | 382 |
| 262 | 3300005614 | Ga0068856_100123380 | Ga0068856_1001233803 | 382 |
| 263 | 3300005614 | Ga0068856_100165314 | Ga0068856_1001653141 | 382 |
| 264 | 3300005614 | Ga0068856_100270077 | Ga0068856_1002700772 | 382 |
| 265 | 3300005614 | Ga0068856_100282956 | Ga0068856_1002829562 | 382 |
| 266 | 3300005616 | Ga0068852_100001078 | Ga0068852_10000107810 | 382 |
| 267 | 3300005616 | Ga0068852_100011910 | Ga0068852_1000119107 | 382 |
| 268 | 3300005616 | Ga0068852_100063037 | Ga0068852_1000630372 | 382 |
| 269 | 3300005617 | Ga0068859_100000045 | Ga0068859_100000045125 | 382 |
| 270 | 3300005617 | Ga0068859_100030038 | Ga0068859_1000300383 | 382 |
| 271 | 3300005617 | Ga0068859_100033339 | Ga0068859_1000333392 | 382 |
| 272 | 3300005617 | Ga0068859_100094941 | Ga0068859_1000949412 | 382 |
| 273 | 3300005617 | Ga0068859_100097286 | Ga0068859_1000972862 | 382 |
| 274 | 3300005618 | Ga0068864_100001622 | Ga0068864_10000162219 | 382 |
| 275 | 3300005618 | Ga0068864_100045766 | Ga0068864_1000457663 | 382 |
| 276 | 3300005719 | Ga0068861_100003382 | Ga0068861_1000033825 | 382 |
| 277 | 3300005840 | Ga0068870_10036100 | Ga0068870_100361002 | 382 |
| 278 | 3300005841 | Ga0068863_100003089 | Ga0068863_1000030896 | 382 |
| 279 | 3300005841 | Ga0068863_100006337 | Ga0068863_10000633710 | 382 |
| 280 | 3300005841 | Ga0068863_100271972 | Ga0068863_1002719721 | 382 |
| 281 | 3300005842 | Ga0068858_100024945 | Ga0068858_1000249453 | 382 |
| 282 | 3300005842 | Ga0068858_100084450 | Ga0068858_1000844502 | 382 |
| 283 | 3300005842 | Ga0068858_100126819 | Ga0068858_1001268192 | 382 |
| 284 | 3300005843 | Ga0068860_100001289 | Ga0068860_10000128917 | 382 |
| 285 | 3300005843 | Ga0068860_100010059 | Ga0068860_1000100595 | 382 |
| 286 | 3300005843 | Ga0068860_100011449 | Ga0068860_1000114496 | 382 |
| 287 | 3300005843 | Ga0068860_100044074 | Ga0068860_1000440742 | 382 |
| 288 | 3300005983 | Ga0081540_1021338 | Ga0081540_10213382 | 382 |
| 289 | 3300006195 | Ga0075366_10017458 | Ga0075366_100174583 | 382 |
| 290 | 3300006237 | Ga0097621_100001013 | Ga0097621_1000010134 | 382 |
| 291 | 3300006237 | Ga0097621_100011779 | Ga0097621_1000117796 | 382 |
| 292 | 3300006237 | Ga0097621_100154600 | Ga0097621_1001546002 | 382 |
| 293 | 3300006237 | Ga0097621_100163905 | Ga0097621_1001639052 | 382 |
| 294 | 3300006358 | Ga0068871_100007075 | Ga0068871_1000070757 | 382 |
| 295 | 3300006358 | Ga0068871_100015208 | Ga0068871_1000152082 | 382 |
| 296 | 3300006358 | Ga0068871_100173743 | Ga0068871_1001737432 | 382 |
| 297 | 3300006358 | Ga0068871_100279132 | Ga0068871_1002791322 | 382 |
| 298 | 3300006844 | Ga0075428_100010044 | Ga0075428_1000100447 | 382 |
| 299 | 3300006844 | Ga0075428_100048626 | Ga0075428_1000486262 | 382 |
| 300 | 3300006846 | Ga0075430_100034545 | Ga0075430_1000345452 | 382 |
| 301 | 3300006847 | Ga0075431_100009298 | Ga0075431_1000092984 | 382 |
| 302 | 3300006847 | Ga0075431_100028606 | Ga0075431_1000286062 | 382 |
| 303 | 3300006880 | Ga0075429_100006202 | Ga0075429_1000062028 | 382 |
| 304 | 3300006881 | Ga0068865_100081601 | Ga0068865_1000816011 | 382 |
| 305 | 3300006931 | Ga0097620_100000045 | Ga0097620_10000004516 | 382 |
| 306 | 3300006931 | Ga0097620_100030038 | Ga0097620_1000300383 | 382 |
| 307 | 3300006931 | Ga0097620_100033339 | Ga0097620_1000333392 | 382 |
| 308 | 3300006931 | Ga0097620_100094942 | Ga0097620_1000949422 | 382 |
| 309 | 3300006931 | Ga0097620_100097286 | Ga0097620_1000972862 | 382 |
| 310 | 3300009093 | Ga0105240_10001675 | Ga0105240_1000167513 | 382 |
| 311 | 3300009093 | Ga0105240_10016117 | Ga0105240_100161176 | 382 |
| 312 | 3300009093 | Ga0105240_10016598 | Ga0105240_100165986 | 382 |
| 313 | 3300009093 | Ga0105240_10019498 | Ga0105240_100194987 | 382 |
| 314 | 3300009093 | Ga0105240_10022970 | Ga0105240_100229705 | 382 |
| 315 | 3300009093 | Ga0105240_10030232 | Ga0105240_100302324 | 382 |
| 316 | 3300009093 | Ga0105240_10049425 | Ga0105240_100494255 | 382 |
| 317 | 3300009093 | Ga0105240_10060410 | Ga0105240_100604102 | 382 |
| 318 | 3300009094 | Ga0111539_10061973 | Ga0111539_100619733 | 382 |
| 319 | 3300009094 | Ga0111539_10085088 | Ga0111539_100850882 | 382 |
| 320 | 3300009094 | Ga0111539_10127052 | Ga0111539_101270522 | 382 |
| 321 | 3300009094 | Ga0111539_10157559 | Ga0111539_101575592 | 382 |
| 322 | 3300009101 | Ga0105247_10001867 | Ga0105247_100018676 | 382 |
| 323 | 3300009101 | Ga0105247_10048650 | Ga0105247_100486505 | 382 |
| 324 | 3300009147 | Ga0114129_10005331 | Ga0114129_1000533120 | 382 |
| 325 | 3300009147 | Ga0114129_10022630 | Ga0114129_100226303 | 382 |
| 326 | 3300009174 | Ga0105241_10001060 | Ga0105241_1000106021 | 382 |
| 327 | 3300009174 | Ga0105241_10009040 | Ga0105241_100090402 | 382 |
| 328 | 3300009174 | Ga0105241_10134609 | Ga0105241_101346092 | 382 |
| 329 | 3300009174 | Ga0105241_10345116 | Ga0105241_103451161 | 382 |
| 330 | 3300009176 | Ga0105242_10111192 | Ga0105242_101111922 | 382 |
| 331 | 3300009176 | Ga0105242_10136704 | Ga0105242_101367042 | 382 |
| 332 | 3300009545 | Ga0105237_10000710 | Ga0105237_1000071029 | 382 |
| 333 | 3300009545 | Ga0105237_10002600 | Ga0105237_100026002 | 382 |
| 334 | 3300009545 | Ga0105237_10006952 | Ga0105237_100069528 | 382 |
| 335 | 3300009545 | Ga0105237_10012157 | Ga0105237_100121572 | 382 |
| 336 | 3300009545 | Ga0105237_10017744 | Ga0105237_100177442 | 382 |
| 337 | 3300009545 | Ga0105237_10056726 | Ga0105237_100567262 | 382 |
| 338 | 3300009545 | Ga0105237_10081659 | Ga0105237_100816593 | 382 |
| 339 | 3300009551 | Ga0105238_10021649 | Ga0105238_100216493 | 382 |
| 340 | 3300009551 | Ga0105238_10043345 | Ga0105238_100433453 | 382 |
| 341 | 3300009553 | Ga0105249_10002002 | Ga0105249_100020029 | 382 |
| 342 | 3300009553 | Ga0105249_10002678 | Ga0105249_100026786 | 382 |
| 343 | 3300009553 | Ga0105249_10025900 | Ga0105249_100259002 | 382 |
| 344 | 3300009553 | Ga0105249_10066632 | Ga0105249_100666325 | 382 |
| 345 | 3300009553 | Ga0105249_10078162 | Ga0105249_100781622 | 382 |
| 346 | 3300009553 | Ga0105249_10223003 | Ga0105249_102230032 | 382 |
| 347 | 3300009553 | Ga0105249_10350883 | Ga0105249_103508831 | 382 |
| 348 | 3300010375 | Ga0105239_10000155 | Ga0105239_1000015518 | 382 |
| 349 | 3300010375 | Ga0105239_10002424 | Ga0105239_100024244 | 382 |
| 350 | 3300010375 | Ga0105239_10012014 | Ga0105239_100120149 | 382 |
| 351 | 3300010375 | Ga0105239_10041014 | Ga0105239_100410142 | 382 |
| 352 | 3300010375 | Ga0105239_10081324 | Ga0105239_100813243 | 382 |
| 353 | 3300010375 | Ga0105239_10198320 | Ga0105239_101983201 | 382 |
| 354 | 3300010375 | Ga0105239_10205777 | Ga0105239_102057772 | 382 |
| 355 | 3300011119 | Ga0105246_10058294 | Ga0105246_100582941 | 382 |
| 356 | 3300011119 | Ga0105246_10083019 | Ga0105246_100830192 | 382 |
| 357 | 3300013100 | Ga0157373_10000006 | Ga0157373_1000000659 | 382 |
| 358 | 3300013100 | Ga0157373_10008939 | Ga0157373_100089395 | 382 |
| 359 | 3300013100 | Ga0157373_10091116 | Ga0157373_100911161 | 382 |
| 360 | 3300013102 | Ga0157371_10018427 | Ga0157371_100184273 | 382 |
| 361 | 3300013102 | Ga0157371_10021719 | Ga0157371_100217193 | 382 |
| 362 | 3300013102 | Ga0157371_10123604 | Ga0157371_101236041 | 382 |
| 363 | 3300013102 | Ga0157371_10202293 | Ga0157371_102022931 | 382 |
| 364 | 3300013104 | Ga0157370_10000585 | Ga0157370_1000058536 | 382 |
| 365 | 3300013104 | Ga0157370_10001018 | Ga0157370_1000101829 | 382 |
| 366 | 3300013104 | Ga0157370_10138597 | Ga0157370_101385972 | 382 |
| 367 | 3300013104 | Ga0157370_10162662 | Ga0157370_101626622 | 382 |
| 368 | 3300013104 | Ga0157370_10266930 | Ga0157370_102669301 | 382 |
| 369 | 3300013105 | Ga0157369_10036682 | Ga0157369_100366823 | 382 |
| 370 | 3300013105 | Ga0157369_10044601 | Ga0157369_100446012 | 382 |
| 371 | 3300013296 | Ga0157374_10053493 | Ga0157374_100534931 | 382 |
| 372 | 3300013296 | Ga0157374_10134520 | Ga0157374_101345202 | 382 |
| 373 | 3300013297 | Ga0157378_10010333 | Ga0157378_100103337 | 382 |
| 374 | 3300013297 | Ga0157378_10016998 | Ga0157378_100169985 | 382 |
| 375 | 3300013297 | Ga0157378_10069852 | Ga0157378_100698522 | 382 |
| 376 | 3300013306 | Ga0163162_10006376 | Ga0163162_100063767 | 382 |
| 377 | 3300013306 | Ga0163162_10033897 | Ga0163162_100338972 | 382 |
| 378 | 3300013306 | Ga0163162_10040893 | Ga0163162_100408932 | 382 |
| 379 | 3300013306 | Ga0163162_10120363 | Ga0163162_101203632 | 382 |
| 380 | 3300013306 | Ga0163162_10510372 | Ga0163162_105103721 | 382 |
| 381 | 3300013307 | Ga0157372_10000294 | Ga0157372_1000029435 | 382 |
| 382 | 3300013307 | Ga0157372_10000582 | Ga0157372_1000058229 | 382 |
| 383 | 3300013307 | Ga0157372_10018908 | Ga0157372_100189083 | 382 |
| 384 | 3300013307 | Ga0157372_10024498 | Ga0157372_100244984 | 382 |
| 385 | 3300013307 | Ga0157372_10070836 | Ga0157372_100708363 | 382 |
| 386 | 3300013307 | Ga0157372_10153881 | Ga0157372_101538812 | 382 |
| 387 | 3300013307 | Ga0157372_10214981 | Ga0157372_102149812 | 382 |
| 388 | 3300013308 | Ga0157375_10096980 | Ga0157375_100969801 | 382 |
| 389 | 3300013308 | Ga0157375_10179898 | Ga0157375_101798982 | 382 |
| 390 | 3300014325 | Ga0163163_10040361 | Ga0163163_100403613 | 382 |
| 391 | 3300014325 | Ga0163163_10069315 | Ga0163163_100693153 | 382 |
| 392 | 3300014325 | Ga0163163_10227992 | Ga0163163_102279922 | 382 |
| 393 | 3300014325 | Ga0163163_10285138 | Ga0163163_102851382 | 382 |
| 394 | 3300014497 | Ga0182008_10000003 | Ga0182008_10000003231 | 382 |
| 395 | 3300014745 | Ga0157377_10007687 | Ga0157377_100076873 | 382 |
| 396 | 3300014969 | Ga0157376_10063722 | Ga0157376_100637221 | 382 |
| 397 | 3300017792 | Ga0163161_10032678 | Ga0163161_100326781 | 382 |
| 398 | 3300017792 | Ga0163161_10213990 | Ga0163161_102139901 | 382 |
| 399 | 3300017792 | Ga0163161_10225004 | Ga0163161_102250042 | 382 |
| 400 | 3300025208 | Ga0209436_102850 | Ga0209436_1028506 | 382 |
| 401 | 3300025273 | Ga0209673_1000242 | Ga0209673_100024238 | 382 |
| 402 | 3300025297 | Ga0209758_1008438 | Ga0209758_10084384 | 382 |
| 403 | 3300025298 | Ga0209050_1000298 | Ga0209050_100029854 | 382 |
| 404 | 3300025302 | Ga0207426_1001104 | Ga0207426_100110415 | 382 |
| 405 | 3300025302 | Ga0207426_1003320 | Ga0207426_10033206 | 382 |
| 406 | 3300025304 | Ga0209257_1001270 | Ga0209257_10012704 | 382 |
| 407 | 3300025900 | Ga0207710_10001020 | Ga0207710_100010202 | 382 |
| 408 | 3300025900 | Ga0207710_10024388 | Ga0207710_100243885 | 382 |
| 409 | 3300025903 | Ga0207680_10000381 | Ga0207680_100003816 | 382 |
| 410 | 3300025903 | Ga0207680_10157501 | Ga0207680_101575012 | 382 |
| 411 | 3300025904 | Ga0207647_10009037 | Ga0207647_100090376 | 382 |
| 412 | 3300025904 | Ga0207647_10052313 | Ga0207647_100523132 | 382 |
| 413 | 3300025907 | Ga0207645_10022683 | Ga0207645_100226831 | 382 |
| 414 | 3300025908 | Ga0207643_10002262 | Ga0207643_100022627 | 382 |
| 415 | 3300025911 | Ga0207654_10002167 | Ga0207654_1000216712 | 382 |
| 416 | 3300025911 | Ga0207654_10014389 | Ga0207654_100143891 | 382 |
| 417 | 3300025911 | Ga0207654_10021660 | Ga0207654_100216602 | 382 |
| 418 | 3300025911 | Ga0207654_10166300 | Ga0207654_101663001 | 382 |
| 419 | 3300025912 | Ga0207707_10247460 | Ga0207707_102474601 | 382 |
| 420 | 3300025913 | Ga0207695_10000282 | Ga0207695_1000028259 | 382 |
| 421 | 3300025913 | Ga0207695_10000363 | Ga0207695_1000036358 | 382 |
| 422 | 3300025913 | Ga0207695_10000647 | Ga0207695_1000064754 | 382 |
| 423 | 3300025913 | Ga0207695_10002667 | Ga0207695_1000266713 | 382 |
| 424 | 3300025913 | Ga0207695_10029084 | Ga0207695_100290846 | 382 |
| 425 | 3300025913 | Ga0207695_10061184 | Ga0207695_100611842 | 382 |
| 426 | 3300025914 | Ga0207671_10007629 | Ga0207671_1000762910 | 382 |
| 427 | 3300025914 | Ga0207671_10020255 | Ga0207671_100202553 | 382 |
| 428 | 3300025914 | Ga0207671_10021298 | Ga0207671_100212982 | 382 |
| 429 | 3300025917 | Ga0207660_10009202 | Ga0207660_100092022 | 382 |
| 430 | 3300025919 | Ga0207657_10020393 | Ga0207657_100203933 | 382 |
| 431 | 3300025919 | Ga0207657_10034034 | Ga0207657_100340342 | 382 |
| 432 | 3300025920 | Ga0207649_10021758 | Ga0207649_100217583 | 382 |
| 433 | 3300025921 | Ga0207652_10008365 | Ga0207652_100083653 | 382 |
| 434 | 3300025921 | Ga0207652_10009232 | Ga0207652_100092323 | 382 |
| 435 | 3300025923 | Ga0207681_10016298 | Ga0207681_100162982 | 382 |
| 436 | 3300025923 | Ga0207681_10024666 | Ga0207681_100246663 | 382 |
| 437 | 3300025924 | Ga0207694_10046142 | Ga0207694_100461422 | 382 |
| 438 | 3300025924 | Ga0207694_10151790 | Ga0207694_101517902 | 382 |
| 439 | 3300025926 | Ga0207659_10067709 | Ga0207659_100677092 | 382 |
| 440 | 3300025933 | Ga0207706_10009214 | Ga0207706_100092147 | 382 |
| 441 | 3300025933 | Ga0207706_10028796 | Ga0207706_100287964 | 382 |
| 442 | 3300025934 | Ga0207686_10001766 | Ga0207686_1000176610 | 382 |
| 443 | 3300025934 | Ga0207686_10100521 | Ga0207686_101005212 | 382 |
| 444 | 3300025936 | Ga0207670_10004749 | Ga0207670_100047496 | 382 |
| 445 | 3300025936 | Ga0207670_10005483 | Ga0207670_100054833 | 382 |
| 446 | 3300025937 | Ga0207669_10002707 | Ga0207669_100027072 | 382 |
| 447 | 3300025940 | Ga0207691_10001776 | Ga0207691_1000177619 | 382 |
| 448 | 3300025942 | Ga0207689_10002278 | Ga0207689_1000227810 | 382 |
| 449 | 3300025942 | Ga0207689_10005867 | Ga0207689_1000586712 | 382 |
| 450 | 3300025942 | Ga0207689_10009880 | Ga0207689_100098802 | 382 |
| 451 | 3300025942 | Ga0207689_10024182 | Ga0207689_100241824 | 382 |
| 452 | 3300025944 | Ga0207661_10022325 | Ga0207661_100223252 | 382 |
| 453 | 3300025944 | Ga0207661_10025164 | Ga0207661_100251641 | 382 |
| 454 | 3300025945 | Ga0207679_10188528 | Ga0207679_101885281 | 382 |
| 455 | 3300025949 | Ga0207667_10000403 | Ga0207667_100004033 | 382 |
| 456 | 3300025949 | Ga0207667_10002943 | Ga0207667_1000294320 | 382 |
| 457 | 3300025949 | Ga0207667_10069889 | Ga0207667_100698892 | 382 |
| 458 | 3300025949 | Ga0207667_10083746 | Ga0207667_100837462 | 382 |
| 459 | 3300025949 | Ga0207667_10260123 | Ga0207667_102601232 | 382 |
| 460 | 3300025960 | Ga0207651_10014588 | Ga0207651_100145882 | 382 |
| 461 | 3300025961 | Ga0207712_10002600 | Ga0207712_100026005 | 382 |
| 462 | 3300025961 | Ga0207712_10002732 | Ga0207712_100027327 | 382 |
| 463 | 3300025961 | Ga0207712_10007140 | Ga0207712_100071403 | 382 |
| 464 | 3300025961 | Ga0207712_10020061 | Ga0207712_100200613 | 382 |
| 465 | 3300025981 | Ga0207640_10035820 | Ga0207640_100358202 | 382 |
| 466 | 3300025986 | Ga0207658_10003968 | Ga0207658_100039686 | 382 |
| 467 | 3300025986 | Ga0207658_10118474 | Ga0207658_101184743 | 382 |
| 468 | 3300026035 | Ga0207703_10009138 | Ga0207703_100091385 | 382 |
| 469 | 3300026035 | Ga0207703_10046177 | Ga0207703_100461772 | 382 |
| 470 | 3300026035 | Ga0207703_10092251 | Ga0207703_100922512 | 382 |
| 471 | 3300026041 | Ga0207639_10000812 | Ga0207639_1000081216 | 382 |
| 472 | 3300026041 | Ga0207639_10007187 | Ga0207639_100071876 | 382 |
| 473 | 3300026041 | Ga0207639_10073213 | Ga0207639_100732132 | 382 |
| 474 | 3300026041 | Ga0207639_10079850 | Ga0207639_100798502 | 382 |
| 475 | 3300026041 | Ga0207639_10098994 | Ga0207639_100989942 | 382 |
| 476 | 3300026075 | Ga0207708_10035730 | Ga0207708_100357302 | 382 |
| 477 | 3300026078 | Ga0207702_10116976 | Ga0207702_101169762 | 382 |
| 478 | 3300026078 | Ga0207702_10210810 | Ga0207702_102108102 | 382 |
| 479 | 3300026088 | Ga0207641_10000133 | Ga0207641_1000013367 | 382 |
| 480 | 3300026088 | Ga0207641_10000549 | Ga0207641_1000054916 | 382 |
| 481 | 3300026088 | Ga0207641_10033652 | Ga0207641_100336523 | 382 |
| 482 | 3300026089 | Ga0207648_10027799 | Ga0207648_100277995 | 382 |
| 483 | 3300026089 | Ga0207648_10102280 | Ga0207648_101022801 | 382 |
| 484 | 3300026095 | Ga0207676_10021480 | Ga0207676_100214804 | 382 |
| 485 | 3300026095 | Ga0207676_10276046 | Ga0207676_102760461 | 382 |
| 486 | 3300026095 | Ga0207676_10381976 | Ga0207676_103819761 | 382 |
| 487 | 3300026095 | Ga0207676_10415124 | Ga0207676_104151241 | 382 |
| 488 | 3300026116 | Ga0207674_10000600 | Ga0207674_1000060041 | 382 |
| 489 | 3300026116 | Ga0207674_10000755 | Ga0207674_1000075518 | 382 |
| 490 | 3300026116 | Ga0207674_10049258 | Ga0207674_100492582 | 382 |
| 491 | 3300026116 | Ga0207674_10172946 | Ga0207674_101729462 | 382 |
| 492 | 3300026116 | Ga0207674_10199914 | Ga0207674_101999141 | 382 |
| 493 | 3300026118 | Ga0207675_100005880 | Ga0207675_1000058806 | 382 |
| 494 | 3300026118 | Ga0207675_100039927 | Ga0207675_1000399273 | 382 |
| 495 | 3300026142 | Ga0207698_10004932 | Ga0207698_100049329 | 382 |
| 496 | 3300026142 | Ga0207698_10037744 | Ga0207698_100377442 | 382 |
| 497 | 3300028379 | Ga0268266_10000026 | Ga0268266_10000026227 | 382 |
| 498 | 3300028381 | Ga0268264_10000015 | Ga0268264_10000015124 | 382 |
| 499 | 3300028381 | Ga0268264_10000019 | Ga0268264_10000019221 | 382 |
| 500 | 3300028381 | Ga0268264_10000054 | Ga0268264_10000054149 | 382 |
| 501 | 3300028381 | Ga0268264_10001568 | Ga0268264_100015685 | 382 |
| 502 | 3300028381 | Ga0268264_10008314 | Ga0268264_100083146 | 382 |
| 503 | 3300028381 | Ga0268264_10019724 | Ga0268264_100197242 | 382 |
| 504 | 3300028381 | Ga0268264_10049395 | Ga0268264_100493952 | 382 |
| 505 | 3300028653 | Ga0265323_10000858 | Ga0265323_100008584 | 382 |
| 506 | 3300028666 | Ga0265336_10018321 | Ga0265336_100183212 | 382 |
| 507 | 3300028786 | Ga0307517_10000651 | Ga0307517_1000065143 | 382 |
| 508 | 3300031251 | Ga0265327_10021796 | Ga0265327_100217962 | 382 |
| 509 | 3300031344 | Ga0265316_10000401 | Ga0265316_1000040123 | 382 |
| 510 | 3300031344 | Ga0265316_10007723 | Ga0265316_100077233 | 382 |
| 511 | 3300031712 | Ga0265342_10069366 | Ga0265342_100693661 | 382 |
| 512 | 3300031730 | Ga0307516_10001571 | Ga0307516_1000157122 | 382 |
| 513 | 3300031730 | Ga0307516_10069974 | Ga0307516_100699742 | 382 |
| 514 | 3300033180 | Ga0307510_10000650 | Ga0307510_1000065017 | 382 |
| 515 | 3300035172 | Ga0373955_0044342 | Ga0373955_0044342_425_1588 | 382 |
| 516 | 3300036401 | Ga0373937_0026430 | Ga0373937_0026430_1727_2890 | 382 |
| 517 | 3300037312 | Ga0395899_0009711 | Ga0395899_0009711_1807_2970 | 382 |
| 518 | 3300037418 | Ga0395900_0008178 | Ga0395900_0008178_4348_5511 | 382 |
| 519 | 3300037418 | Ga0395900_0169069 | Ga0395900_0169069_328_1491 | 382 |
| 520 | 3300037466 | Ga0395898_0011708 | Ga0395898_0011708_1720_2883 | 382 |
| 521 | 3300038443 | Ga0395901_0014250 | Ga0395901_0014250_1997_3160 | 382 |
| 522 | 3300041411 | Ga0439466_0013706 | Ga0439466_0013706_47_1198 | 382 |
| 523 | 3300041486 | Ga0451807_2302037 | Ga0451807_2302037_1047_2210 | 382 |
| 524 | 3300042004 | Ga0439445_0020832 | Ga0439445_0020832_430_1590 | 382 |
| 525 | 3300042876 | Ga0451577_0009122 | Ga0451577_0009122_4604_5776 | 382 |
| 526 | 3300042876 | Ga0451577_0191664 | Ga0451577_0191664_251_1411 | 382 |
| 527 | 3300044658 | Ga0466972_0000500 | Ga0466972_0000500_17152_18318 | 382 |
| 528 | 3300044693 | Ga0466961_0011193 | Ga0466961_0011193_3822_4991 | 382 |
| 529 | 3300044712 | Ga0453684_0001281 | Ga0453684_0001281_52800_53972 | 382 |
| 530 | 3300044712 | Ga0453684_0003038 | Ga0453684_0003038_7930_9102 | 382 |
| 531 | 3300044765 | Ga0466970_0018872 | Ga0466970_0018872_157_1326 | 382 |
| 532 | 3300044765 | Ga0466970_0031131 | Ga0466970_0031131_493_1662 | 382 |
| 533 | 3300045049 | Ga0466959_0000566 | Ga0466959_0000566_9850_11019 | 382 |
| 534 | 3300046453 | Ga0495627_044018 | Ga0495627_044018_36_1199 | 382 |
| 535 | 3300046454 | Ga0495592_0081730 | Ga0495592_0081730_1076_2239 | 382 |
| 536 | 3300046460 | Ga0495638_0031527 | Ga0495638_0031527_1518_2687 | 382 |
| 537 | 3300046463 | Ga0495653_0118277 | Ga0495653_0118277_164_1327 | 382 |
| 538 | 3300046507 | Ga0495606_0003999 | Ga0495606_0003999_4158_5324 | 382 |
| 539 | 3300046511 | Ga0495608_0063346 | Ga0495608_0063346_989_2152 | 382 |
| 540 | 3300046517 | Ga0495630_0060363 | Ga0495630_0060363_61_1224 | 382 |
| 541 | 3300046524 | Ga0495648_0001530 | Ga0495648_0001530_7139_8308 | 382 |
| 542 | 3300046525 | Ga0495663_0000680 | Ga0495663_0000680_9007_10158 | 382 |
| 543 | 3300046537 | Ga0495598_0009585 | Ga0495598_0009585_220_1419 | 382 |
| 544 | 3300046539 | Ga0495621_0005078 | Ga0495621_0005078_2129_3328 | 382 |
| 545 | 3300046558 | Ga0495633_0000022 | Ga0495633_0000022_159441_160604 | 382 |
| 546 | 3300046648 | Ga0495611_0001127 | Ga0495611_0001127_11681_12850 | 382 |
| 547 | 3300046648 | Ga0495611_0033424 | Ga0495611_0033424_580_1776 | 382 |
| 548 | 3300046660 | Ga0495625_0178743 | Ga0495625_0178743_200_1369 | 382 |
| 549 | 3300046678 | Ga0495599_0114542 | Ga0495599_0114542_97_1260 | 382 |
| 550 | 3300047320 | Ga0495672_0019138 | Ga0495672_0019138_2369_3562 | 382 |
| 551 | 3300047443 | Ga0495687_000031 | Ga0495687_000031_105059_106228 | 382 |
| 552 | 3300047472 | Ga0495686_0000128 | Ga0495686_0000128_140691_141860 | 382 |
| 553 | 3300047472 | Ga0495686_0021354 | Ga0495686_0021354_201_1397 | 382 |
| 554 | 3300048913 | Ga0496110_0114393 | Ga0496110_0114393_1208_2371 | 382 |
| 555 | 3300048924 | Ga0496121_0000010 | Ga0496121_0000010_107968_109137 | 382 |
| 556 | 3300049569 | Ga0501032_0002044 | Ga0501032_0002044_8117_9277 | 382 |
| 557 | 3300049570 | Ga0501033_0021393 | Ga0501033_0021393_2668_3828 | 382 |
| 558 | 3300049571 | Ga0501034_0009033 | Ga0501034_0009033_7169_8329 | 382 |
| 559 | 3300049571 | Ga0501034_0015128 | Ga0501034_0015128_6278_7477 | 382 |
| 560 | 3300049572 | Ga0501036_0011432 | Ga0501036_0011432_5888_7087 | 382 |
| 561 | 3300049573 | Ga0501037_0006267 | Ga0501037_0006267_2280_3440 | 382 |
| 562 | 3300049573 | Ga0501037_0032056 | Ga0501037_0032056_158_1357 | 382 |
| 563 | 3300049574 | Ga0501038_0011204 | Ga0501038_0011204_5075_6274 | 382 |
| 564 | 3300049574 | Ga0501038_0028995 | Ga0501038_0028995_2427_3587 | 382 |
| 565 | 3300049579 | Ga0501043_0007889 | Ga0501043_0007889_1980_3179 | 382 |
| 566 | 3300049579 | Ga0501043_0015301 | Ga0501043_0015301_3701_4861 | 382 |
| 567 | 3300049580 | Ga0501046_0011009 | Ga0501046_0011009_268_1467 | 382 |
| 568 | 3300049581 | Ga0501047_0045479 | Ga0501047_0045479_17_1177 | 382 |
| 569 | 3300049581 | Ga0501047_0071567 | Ga0501047_0071567_382_1581 | 382 |
| 570 | 3300049581 | Ga0501047_0195725 | Ga0501047_0195725_410_1570 | 382 |
| 571 | 3300049582 | Ga0501048_0048606 | Ga0501048_0048606_1295_2494 | 382 |
| 572 | 3300049586 | Ga0501070_0013567 | Ga0501070_0013567_2206_3405 | 382 |
| 573 | 3300049588 | Ga0501072_0153683 | Ga0501072_0153683_197_1363 | 382 |
| 574 | 3300049589 | Ga0501073_0003476 | Ga0501073_0003476_4464_5663 | 382 |
| 575 | 3300049590 | Ga0501074_0003529 | Ga0501074_0003529_3593_4792 | 382 |
| 576 | 3300049744 | Ga0501083_0096139 | Ga0501083_0096139_469_1668 | 382 |
| 577 | 3300049758 | Ga0501241_000383 | Ga0501241_000383_4300_5469 | 382 |
| 578 | 3300049822 | Ga0501035_0002820 | Ga0501035_0002820_15428_16627 | 382 |
| 579 | 3300049822 | Ga0501035_0033250 | Ga0501035_0033250_2301_3461 | 382 |
| 580 | 3300049823 | Ga0501044_0002356 | Ga0501044_0002356_18368_19528 | 382 |
| 581 | 3300049823 | Ga0501044_0030671 | Ga0501044_0030671_2532_3731 | 382 |
| 582 | 3300050493 | nmdc:mga0k408_11249_c2 | nmdc:mga0k408_11249_c2_2395_3591 | 382 |
| 583 | 3300050507 | nmdc:mga05p37_38869_c1 | nmdc:mga05p37_38869_c1_1924_3123 | 382 |
| 584 | 3300050508 | nmdc:mga09592_20617_c1 | nmdc:mga09592_20617_c1_1618_2817 | 382 |
| 585 | 3300050508 | nmdc:mga09592_44624_c1 | nmdc:mga09592_44624_c1_234_1433 | 382 |
| 586 | 3300050510 | nmdc:mga06r32_138949_c1 | nmdc:mga06r32_138949_c1_746_1906 | 382 |
| 587 | 3300050510 | nmdc:mga06r32_48218_c1 | nmdc:mga06r32_48218_c1_664_1863 | 382 |
| 588 | 3300050511 | nmdc:mga08y16_109132_c1 | nmdc:mga08y16_109132_c1_688_1908 | 382 |
| 589 | 3300050511 | nmdc:mga08y16_135439_c1 | nmdc:mga08y16_135439_c1_843_2021 | 382 |
| 590 | 3300050511 | nmdc:mga08y16_94718_c1 | nmdc:mga08y16_94718_c1_543_1742 | 382 |
| 591 | 3300053088 | Ga0500644_0000593 | Ga0500644_0000593_8407_9570 | 382 |
| 592 | 3300053090 | Ga0500646_0001495 | Ga0500646_0001495_2646_3809 | 382 |
| 593 | 3300053092 | Ga0500583_0001457 | Ga0500583_0001457_5379_6548 | 382 |
| 594 | 3300053109 | Ga0500569_000223 | Ga0500569_000223_5538_6701 | 382 |
| 595 | 3300053130 | Ga0500642_0016477 | Ga0500642_0016477_1372_2541 | 382 |
| 596 | 3300053134 | Ga0500658_0007468 | Ga0500658_0007468_653_1816 | 382 |
| 597 | 3300053139 | Ga0500568_0000511 | Ga0500568_0000511_138_1331 | 382 |
| 598 | 3300053142 | Ga0500577_0001525 | Ga0500577_0001525_782_1945 | 382 |
| 599 | 3300053156 | Ga0500622_0000144 | Ga0500622_0000144_23346_24506 | 382 |
| 600 | 3300053156 | Ga0500622_0000926 | Ga0500622_0000926_427_1596 | 382 |
| 601 | 3300054114 | Ga0501084_0064508 | Ga0501084_0064508_121_1320 | 382 |
| 602 | 3300001915 | JGI24741J21665_1002211 | JGI24741J21665_10022116 | 383 |
| 603 | 3300003323 | rootH1_10259345 | rootH1_102593454 | 383 |
| 604 | 3300003761 | Ga0055535_1007746 | Ga0055535_10077462 | 383 |
| 605 | 3300003784 | Ga0055534_1014363 | Ga0055534_10143631 | 383 |
| 606 | 3300005329 | Ga0070683_100004016 | Ga0070683_1000040164 | 383 |
| 607 | 3300005339 | Ga0070660_100063853 | Ga0070660_1000638533 | 383 |
| 608 | 3300005347 | Ga0070668_100049616 | Ga0070668_1000496163 | 383 |
| 609 | 3300005353 | Ga0070669_100110056 | Ga0070669_1001100562 | 383 |
| 610 | 3300005471 | Ga0070698_100010706 | Ga0070698_1000107068 | 383 |
| 611 | 3300005535 | Ga0070684_100004401 | Ga0070684_1000044013 | 383 |
| 612 | 3300009036 | Ga0105244_10000160 | Ga0105244_1000016066 | 383 |
| 613 | 3300009093 | Ga0105240_10044822 | Ga0105240_100448222 | 383 |
| 614 | 3300009093 | Ga0105240_10126436 | Ga0105240_101264363 | 383 |
| 615 | 3300009148 | Ga0105243_10000734 | Ga0105243_1000073424 | 383 |
| 616 | 3300010375 | Ga0105239_10059834 | Ga0105239_100598341 | 383 |
| 617 | 3300013104 | Ga0157370_10033056 | Ga0157370_100330563 | 383 |
| 618 | 3300013105 | Ga0157369_10302959 | Ga0157369_103029592 | 383 |
| 619 | 3300013296 | Ga0157374_10000025 | Ga0157374_1000002570 | 383 |
| 620 | 3300013307 | Ga0157372_10013871 | Ga0157372_100138713 | 383 |
| 621 | 3300013308 | Ga0157375_10000209 | Ga0157375_1000020922 | 383 |
| 622 | 3300013308 | Ga0157375_10216686 | Ga0157375_102166862 | 383 |
| 623 | 3300014969 | Ga0157376_10000892 | Ga0157376_1000089210 | 383 |
| 624 | 3300015261 | Ga0182006_1000001 | Ga0182006_1000001923 | 383 |
| 625 | 3300025242 | Ga0209258_100075 | Ga0209258_10007537 | 383 |
| 626 | 3300025254 | Ga0209148_1000085 | Ga0209148_1000085193 | 383 |
| 627 | 3300025291 | Ga0209675_1003045 | Ga0209675_10030455 | 383 |
| 628 | 3300025728 | Ga0207655_1000016 | Ga0207655_1000016511 | 383 |
| 629 | 3300025909 | Ga0207705_10009260 | Ga0207705_100092607 | 383 |
| 630 | 3300025923 | Ga0207681_10227426 | Ga0207681_102274262 | 383 |
| 631 | 3300025935 | Ga0207709_10000355 | Ga0207709_100003554 | 383 |
| 632 | 3300025972 | Ga0207668_10096611 | Ga0207668_100966113 | 383 |
| 633 | 3300026142 | Ga0207698_10327172 | Ga0207698_103271721 | 383 |
| 634 | 3300031911 | Ga0307412_10000036 | Ga0307412_10000036137 | 383 |
| 635 | 3300031911 | Ga0307412_10000677 | Ga0307412_1000067718 | 383 |
| 636 | 3300031911 | Ga0307412_10009055 | Ga0307412_100090553 | 383 |
| 637 | 3300032002 | Ga0307416_100000006 | Ga0307416_10000000619 | 383 |
| 638 | 3300032004 | Ga0307414_10000043 | Ga0307414_1000004337 | 383 |
| 639 | 3300032004 | Ga0307414_10037854 | Ga0307414_100378543 | 383 |
| 640 | 3300041413 | Ga0439465_0000069 | Ga0439465_0000069_1186_2379 | 383 |
| 641 | 3300046453 | Ga0495627_000081 | Ga0495627_000081_24_1178 | 383 |
| 642 | 3300046500 | Ga0495596_0002543 | Ga0495596_0002543_4607_5758 | 383 |
| 643 | 3300046507 | Ga0495606_0050953 | Ga0495606_0050953_569_1723 | 383 |
| 644 | 3300046512 | Ga0495610_0000005 | Ga0495610_0000005_123505_124659 | 383 |
| 645 | 3300046519 | Ga0495632_0002129 | Ga0495632_0002129_501_1655 | 383 |
| 646 | 3300046525 | Ga0495663_0005383 | Ga0495663_0005383_1346_2500 | 383 |
| 647 | 3300046530 | Ga0495654_0000003 | Ga0495654_0000003_752605_753759 | 383 |
| 648 | 3300046558 | Ga0495633_0000114 | Ga0495633_0000114_61_1215 | 383 |
| 649 | 3300046558 | Ga0495633_0031288 | Ga0495633_0031288_810_1964 | 383 |
| 650 | 3300046660 | Ga0495625_0002476 | Ga0495625_0002476_9210_10364 | 383 |
| 651 | 3300047472 | Ga0495686_0062493 | Ga0495686_0062493_1091_2245 | 383 |
| 652 | 3300048906 | Ga0496103_0078546 | Ga0496103_0078546_18_1169 | 383 |
| 653 | 3300048919 | Ga0496116_0000029 | Ga0496116_0000029_3925_5076 | 383 |
| 654 | 3300048920 | Ga0496117_0000007 | Ga0496117_0000007_3129_4280 | 383 |
| 655 | 3300048921 | Ga0496118_0015187 | Ga0496118_0015187_2865_4016 | 383 |
| 656 | 3300048921 | Ga0496118_0099818 | Ga0496118_0099818_59_1213 | 383 |
| 657 | 3300048922 | Ga0496119_0000007 | Ga0496119_0000007_3196_4347 | 383 |
| 658 | 3300048923 | Ga0496120_0067739 | Ga0496120_0067739_469_1620 | 383 |
| 659 | 3300048925 | Ga0496122_0000946 | Ga0496122_0000946_14484_15638 | 383 |
| 660 | 3300048925 | Ga0496122_0001893 | Ga0496122_0001893_3936_5087 | 383 |
| 661 | 3300048925 | Ga0496122_0001900 | Ga0496122_0001900_3851_5002 | 383 |
| 662 | 3300048925 | Ga0496122_0001976 | Ga0496122_0001976_4209_5405 | 383 |
| 663 | 3300048925 | Ga0496122_0002061 | Ga0496122_0002061_3196_4347 | 383 |
| 664 | 3300048926 | Ga0496123_0001726 | Ga0496123_0001726_24446_25597 | 383 |
| 665 | 3300048926 | Ga0496123_0008606 | Ga0496123_0008606_111_1307 | 383 |
| 666 | 3300048927 | Ga0496124_0001116 | Ga0496124_0001116_38504_39655 | 383 |
| 667 | 3300048928 | Ga0496125_0001777 | Ga0496125_0001777_3782_4933 | 383 |
| 668 | 3300048928 | Ga0496125_0017671 | Ga0496125_0017671_3107_4258 | 383 |
| 669 | 3300048929 | Ga0496126_0004748 | Ga0496126_0004748_11840_12991 | 383 |
| 670 | 3300049758 | Ga0501241_000002 | Ga0501241_000002_153631_154788 | 383 |
| 671 | 3300049766 | Ga0501269_000379 | Ga0501269_000379_66_1223 | 383 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pp9-assembly2.cif.gz_C | 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a | 0.8217 | 55 | 119 |
| 5c82-assembly1.cif.gz_A-2 | crystal structure of nourseothricin acetyltransferase | 0.7959 | 55 | 119 |
| 1p0h-assembly1.cif.gz_A | crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex | 0.7597 | 1 | 369 |
| 1p0h-assembly1.cif.gz_A | crystal structure of rv0819 from mycobacterium tuberculosis mshd-mycothiol synthase coenzyme a complex | 0.7574 | 1 | 369 |
| 6sll-assembly1.cif.gz_B | diaminobutyrate acetyltransferase ecta from paenibacillus lautus in complex with its substrate l-2,4-diaminobutyric acid (dab) and coenzyme a | 0.7548 | 195 | 331 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q46840_21_390_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8803 | 5 | 371 | 3.40.630.30 |
| af_Q46840_21_390_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8715 | 5 | 371 | 3.40.630.30 |
| af_K7KMF1_95_188_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.794 | 55 | 115 | 3.40.630.30 |
| af_Q555H5_1389_1473_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7895 | 259 | 323 | 3.40.630.30 |
| 2d4oA00 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.7791 | 57 | 115 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A848NBQ9-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9917 | 1 | 380 |
|
| AF-A0A5C7EWC3-F1-model_v4 | GNAT family N-acetyltransferase | 0.9906 | 3 | 383 |
|
| AF-A0A0Q5QCL4-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9894 | 1 | 383 |
|
| AF-A0A0Q5QCL4-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9868 | 1 | 383 |
|
| AF-A0A381F7K6-F1-model_v4 | N-acetyltransferase domain-containing protein | 0.9858 | 1 | 383 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar