F474161

General Info

Members Datasets Scaffolds Average Seq Length
671 375 1342 90

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_11218803|Ga0207657_112188032
Length 102
Sequence MAHKKGVGSSRNGRDSNPKYRGVKKYGGERVTAGNIIVRQCGTKWHPGNNVGLGTDYTIYALIDGVVKFEHKSKTRQQVSVYPVQQAETVTVDAPAGEAAVA

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
91 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
92 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
96 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
97 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
119 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
183 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
184 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
188 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
195 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
196 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
197 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
198 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
199 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
202 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
210 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
223 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
224 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
225 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
226 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
227 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
228 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
232 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
237 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
240 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
241 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
248 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
249 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
250 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
256 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
257 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
262 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
281 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
292 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
293 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
294 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
295 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
307 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
308 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
309 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
310 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
311 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
312 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
313 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
314 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
315 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
316 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
317 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
318 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
319 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
320 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
321 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
322 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
323 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
324 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
325 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
326 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
327 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
328 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
331 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
340 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
341 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
344 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
347 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
348 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.63
Metatranscriptomes 12.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.15
Nodule 0
Rhizoplane 2.68
Rhizosphere 94.49
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_11218803 3300025919 Bacteria 571
2 JGI24749J21850_1018704 3300002076 Bacteria 978
3 Ga0058861_10054482 3300004800 Bacteria 917
4 Ga0058861_11909276 3300004800 Bacteria 535
5 Ga0058862_10148224 3300004803 Bacteria 991
6 Ga0065704_10011346 3300005289 Bacteria 2894
7 Ga0065712_10070847 3300005290 Bacteria 5655
8 Ga0065712_10209544 3300005290 Bacteria 1078
9 Ga0065712_10350179 3300005290 Bacteria 788
10 Ga0065715_10324645 3300005293 Bacteria 995
11 Ga0065707_11063374 3300005295 Bacteria 524
12 Ga0070658_10001643 3300005327 Bacteria 18890
13 Ga0070658_10099512 3300005327 Bacteria 2403
14 Ga0070658_10156359 3300005327 Bacteria 1911
15 Ga0070658_10257093 3300005327 Bacteria 1482
16 Ga0070658_10591545 3300005327 Bacteria 961
17 Ga0070676_10528110 3300005328 Bacteria 842
18 Ga0070676_10925647 3300005328 Bacteria 650
19 Ga0070676_11007070 3300005328 Bacteria 626
20 Ga0070676_11371042 3300005328 Bacteria 542
21 Ga0070683_100052735 3300005329 Bacteria 3769
22 Ga0070683_100211683 3300005329 Bacteria 1841
23 Ga0070683_100673603 3300005329 Bacteria 990
24 Ga0070683_101866762 3300005329 Bacteria 577
25 Ga0070690_100308472 3300005330 Bacteria 1137
26 Ga0070690_100443005 3300005330 Bacteria 961
27 Ga0070670_100034433 3300005331 Bacteria 4358
28 Ga0070677_10015372 3300005333 Bacteria 2712
29 Ga0070666_10151395 3300005335 Bacteria 1618
30 Ga0070680_100000402 3300005336 Bacteria 29560
31 Ga0070680_100005402 3300005336 Bacteria 9672
32 Ga0070680_100009849 3300005336 Bacteria 7354
33 Ga0070680_100244752 3300005336 Bacteria 1516
34 Ga0070680_101094536 3300005336 Bacteria 689
35 Ga0070682_100881037 3300005337 Bacteria 734
36 Ga0070660_100006938 3300005339 Bacteria 7855
37 Ga0070660_101109956 3300005339 Bacteria 669
38 Ga0070689_100040115 3300005340 Bacteria 3588
39 Ga0070691_10047050 3300005341 Bacteria 2051
40 Ga0070687_100006777 3300005343 Bacteria 4721
41 Ga0070661_100007955 3300005344 Bacteria 7323
42 Ga0070661_100398709 3300005344 Bacteria 1087
43 Ga0070661_100610721 3300005344 Bacteria 882
44 Ga0070661_100617817 3300005344 Bacteria 877
45 Ga0070661_100785526 3300005344 Bacteria 780
46 Ga0070661_101927445 3300005344 Bacteria 502
47 Ga0070692_10050171 3300005345 Bacteria 2166
48 Ga0070692_10507538 3300005345 Bacteria 783
49 Ga0070669_100021040 3300005353 Bacteria 4661
50 Ga0070669_100458420 3300005353 Bacteria 1052
51 Ga0070675_100014159 3300005354 Bacteria 6287
52 Ga0070671_100100960 3300005355 Bacteria 2421
53 Ga0070674_100018717 3300005356 Bacteria 4386
54 Ga0070673_100019969 3300005364 Bacteria 4823
55 Ga0070688_100071768 3300005365 Bacteria 2217
56 Ga0070659_100792984 3300005366 Bacteria 823
57 Ga0070667_100125230 3300005367 Bacteria 2239
58 Ga0070667_100296151 3300005367 Bacteria 1456
59 Ga0070709_10010674 3300005434 Bacteria 5094
60 Ga0070714_100018253 3300005435 Bacteria 5694
61 Ga0070713_100088098 3300005436 Bacteria 2664
62 Ga0070713_100178642 3300005436 Bacteria 1906
63 Ga0070711_100174696 3300005439 Bacteria 1640
64 Ga0070705_101185131 3300005440 Bacteria 629
65 Ga0070700_101130405 3300005441 Bacteria 651
66 Ga0070694_100058699 3300005444 Bacteria 2618
67 Ga0070694_101183537 3300005444 Bacteria 640
68 Ga0070708_100000070 3300005445 Bacteria 67477
69 Ga0070708_100000704 3300005445 Bacteria 25483
70 Ga0070663_100113855 3300005455 Bacteria 2036
71 Ga0070663_100176671 3300005455 Bacteria 1654
72 Ga0070678_101154874 3300005456 Bacteria 717
73 Ga0070662_100409902 3300005457 Bacteria 1120
74 Ga0070681_10001683 3300005458 Bacteria 19769
75 Ga0070681_10005971 3300005458 Bacteria 11796
76 Ga0070681_10063684 3300005458 Bacteria 3659
77 Ga0070681_11281139 3300005458 Bacteria 656
78 Ga0068867_100044387 3300005459 Bacteria 3256
79 Ga0070685_10046847 3300005466 Bacteria 2484
80 Ga0070707_100002634 3300005468 Bacteria 17066
81 Ga0070707_100116782 3300005468 Bacteria 2590
82 Ga0070679_100001713 3300005530 Bacteria 19769
83 Ga0070679_100002458 3300005530 Bacteria 16781
84 Ga0070679_100005557 3300005530 Bacteria 11682
85 Ga0070679_100008561 3300005530 Bacteria 9637
86 Ga0070679_100038712 3300005530 Bacteria 4740
87 Ga0070679_100182964 3300005530 Bacteria 2067
88 Ga0070679_100207092 3300005530 Bacteria 1926
89 Ga0070679_100518804 3300005530 Bacteria 1135
90 Ga0070679_101308516 3300005530 Bacteria 670
91 Ga0070684_100008750 3300005535 Bacteria 7938
92 Ga0070684_100039340 3300005535 Bacteria 4066
93 Ga0070684_100148099 3300005535 Bacteria 2125
94 Ga0070684_100165745 3300005535 Bacteria 2005
95 Ga0070684_100771412 3300005535 Bacteria 898
96 Ga0070684_100820907 3300005535 Bacteria 870
97 Ga0070684_101086754 3300005535 Bacteria 751
98 Ga0070684_101513350 3300005535 Bacteria 632
99 Ga0068853_100841994 3300005539 Bacteria 879
100 Ga0068853_101953614 3300005539 Bacteria 569
101 Ga0070686_100178640 3300005544 Bacteria 1506
102 Ga0070686_100752751 3300005544 Bacteria 781
103 Ga0070695_101380892 3300005545 Bacteria 584
104 Ga0070696_100019274 3300005546 Bacteria 4619
105 Ga0070696_100652059 3300005546 Bacteria 853
106 Ga0070696_101936536 3300005546 Bacteria 511
107 Ga0070693_100520423 3300005547 Bacteria 847
108 Ga0070693_100961749 3300005547 Bacteria 644
109 Ga0070665_100781140 3300005548 Bacteria 968
110 Ga0068855_100005434 3300005563 Bacteria 15539
111 Ga0068855_100110120 3300005563 Bacteria 3162
112 Ga0068855_100179820 3300005563 Bacteria 2392
113 Ga0068855_100322273 3300005563 Bacteria 1708
114 Ga0070664_100392909 3300005564 Bacteria 1267
115 Ga0070664_101023713 3300005564 Bacteria 776
116 Ga0068857_100174305 3300005577 Bacteria 1956
117 Ga0068857_100460853 3300005577 Bacteria 1189
118 Ga0068854_100026703 3300005578 Bacteria 3971
119 Ga0068856_100111198 3300005614 Bacteria 2737
120 Ga0068856_100250300 3300005614 Bacteria 1787
121 Ga0068856_100460907 3300005614 Bacteria 1292
122 Ga0068856_101477591 3300005614 Bacteria 694
123 Ga0070702_101830756 3300005615 Bacteria 508
124 Ga0068852_100423577 3300005616 Bacteria 1313
125 Ga0068859_100183649 3300005617 Bacteria 2175
126 Ga0068864_100004940 3300005618 Bacteria 10925
127 Ga0068864_100636256 3300005618 Bacteria 1038
128 Ga0068866_10022515 3300005718 Bacteria 2917
129 Ga0068863_102586409 3300005841 Bacteria 517
130 Ga0068858_100063157 3300005842 Bacteria 3426
131 Ga0068862_100857008 3300005844 Bacteria 891
132 Ga0081539_10017757 3300005985 Bacteria 4974
133 Ga0070715_10902307 3300006163 Bacteria 544
134 Ga0070716_101669225 3300006173 Bacteria 525
135 Ga0097621_100735085 3300006237 Bacteria 911
136 Ga0075428_100123692 3300006844 Bacteria 2816
137 Ga0075428_100257904 3300006844 Bacteria 1878
138 Ga0075430_100002964 3300006846 Bacteria 14214
139 Ga0075430_100108528 3300006846 Bacteria 2315
140 Ga0075431_100539168 3300006847 Bacteria 1155
141 Ga0075433_10172312 3300006852 Bacteria 1926
142 Ga0075429_100372749 3300006880 Bacteria 1250
143 Ga0068865_100587566 3300006881 Bacteria 940
144 Ga0068865_101274703 3300006881 Bacteria 653
145 Ga0097620_100183649 3300006931 Bacteria 2175
146 Ga0105240_10112296 3300009093 Bacteria 3295
147 Ga0105240_10402365 3300009093 Bacteria 1542
148 Ga0105240_10963645 3300009093 Bacteria 914
149 Ga0105240_11383274 3300009093 Bacteria 740
150 Ga0111539_10008609 3300009094 Bacteria 12960
151 Ga0111539_10112566 3300009094 Bacteria 3192
152 Ga0111539_10656851 3300009094 Bacteria 1221
153 Ga0105245_10066188 3300009098 Bacteria 3270
154 Ga0114129_10006882 3300009147 Bacteria 16169
155 Ga0114129_10058436 3300009147 Bacteria 5394
156 Ga0114129_10458278 3300009147 Bacteria 1671
157 Ga0114129_11728720 3300009147 Bacteria 763
158 Ga0105243_10242997 3300009148 Bacteria 1603
159 Ga0105243_10678069 3300009148 Bacteria 1002
160 Ga0105241_10049604 3300009174 Bacteria 3197
161 Ga0105241_11358373 3300009174 Bacteria 679
162 Ga0105242_10019656 3300009176 Bacteria 5293
163 Ga0105242_10234283 3300009176 Bacteria 1647
164 Ga0105248_10163727 3300009177 Bacteria 2508
165 Ga0105248_10234190 3300009177 Bacteria 2067
166 Ga0105248_10534046 3300009177 Bacteria 1323
167 Ga0105237_10635874 3300009545 Bacteria 1074
168 Ga0105237_11360933 3300009545 Bacteria 716
169 Ga0105238_10051392 3300009551 Bacteria 4146
170 Ga0105238_10331197 3300009551 Bacteria 1509
171 Ga0105238_10930263 3300009551 Bacteria 888
172 Ga0105238_12841957 3300009551 Bacteria 520
173 Ga0105249_12141613 3300009553 Bacteria 632
174 Ga0105249_13521517 3300009553 Bacteria 504
175 Ga0130087_1026956 3300009828 Bacteria 640
176 Ga0130086_1045134 3300009829 Bacteria 640
177 Ga0130084_1105561 3300009835 Bacteria 640
178 Ga0099796_10500395 3300010159 Bacteria 544
179 Ga0105246_10444372 3300011119 Bacteria 1088
180 Ga0105246_10724613 3300011119 Bacteria 874
181 Ga0157325_1001936 3300012485 Bacteria 1006
182 Ga0157335_1032789 3300012492 Bacteria 552
183 Ga0157313_1061104 3300012503 Bacteria 515
184 Ga0157373_10048812 3300013100 Bacteria 3018
185 Ga0157373_10186725 3300013100 Bacteria 1460
186 Ga0157373_10243453 3300013100 Bacteria 1271
187 Ga0157371_10180209 3300013102 Bacteria 1511
188 Ga0157371_11190789 3300013102 Bacteria 587
189 Ga0157370_10004185 3300013104 Bacteria 16695
190 Ga0157370_10007097 3300013104 Bacteria 12231
191 Ga0157370_10048185 3300013104 Bacteria 4082
192 Ga0157370_10421646 3300013104 Bacteria 1228
193 Ga0157370_10541157 3300013104 Bacteria 1068
194 Ga0157370_10885479 3300013104 Bacteria 810
195 Ga0157370_11157183 3300013104 Bacteria 698
196 Ga0157369_10005628 3300013105 Bacteria 14554
197 Ga0157369_10140935 3300013105 Bacteria 2551
198 Ga0157369_10170497 3300013105 Bacteria 2293
199 Ga0157369_10220058 3300013105 Bacteria 1987
200 Ga0157369_11923227 3300013105 Bacteria 600
201 Ga0157374_10809504 3300013296 Bacteria 953
202 Ga0157378_10531260 3300013297 Bacteria 1179
203 Ga0157378_10696318 3300013297 Bacteria 1035
204 Ga0163162_10664137 3300013306 Bacteria 1165
205 Ga0163162_11154420 3300013306 Bacteria 878
206 Ga0157372_10004251 3300013307 Bacteria 15310
207 Ga0157372_10017275 3300013307 Bacteria 7746
208 Ga0157372_10018444 3300013307 Bacteria 7501
209 Ga0157372_10067261 3300013307 Bacteria 4026
210 Ga0157372_10077078 3300013307 Bacteria 3764
211 Ga0157372_10138874 3300013307 Bacteria 2799
212 Ga0157372_12951258 3300013307 Bacteria 544
213 Ga0157375_10237805 3300013308 Bacteria 1981
214 Ga0157375_11782238 3300013308 Bacteria 730
215 Ga0163163_10114086 3300014325 Bacteria 2732
216 Ga0163163_11352269 3300014325 Bacteria 774
217 Ga0163163_11971187 3300014325 Bacteria 644
218 Ga0163163_12891334 3300014325 Bacteria 536
219 Ga0157380_10636205 3300014326 Bacteria 1062
220 Ga0157380_11924027 3300014326 Bacteria 652
221 Ga0157377_10244326 3300014745 Bacteria 1160
222 Ga0157379_10819322 3300014968 Bacteria 879
223 Ga0157376_10548245 3300014969 Bacteria 1144
224 Ga0182007_10123061 3300015262 Bacteria 869
225 Ga0182007_10204022 3300015262 Bacteria 692
226 Ga0182005_1016162 3300015265 Bacteria 2077
227 Ga0182005_1059471 3300015265 Bacteria 1044
228 Ga0163161_11079421 3300017792 Bacteria 689
229 Ga0197907_10283107 3300020069 Bacteria 593
230 Ga0197907_10859733 3300020069 Archaea 880
231 Ga0206356_10242011 3300020070 Bacteria 1022
232 Ga0206356_10661324 3300020070 Unclassified 814
233 Ga0206356_11063995 3300020070 Bacteria 606
234 Ga0206356_11103976 3300020070 Bacteria 605
235 Ga0206356_11566158 3300020070 Bacteria 519
236 Ga0206356_11586736 3300020070 Bacteria 1434
237 Ga0206349_1964416 3300020075 Unclassified 718
238 Ga0206355_1722446 3300020076 Bacteria 651
239 Ga0206351_10212952 3300020077 Bacteria 751
240 Ga0206351_10771098 3300020077 Bacteria 633
241 Ga0206352_10168891 3300020078 Bacteria 1262
242 Ga0206352_10676944 3300020078 Bacteria 795
243 Ga0206352_11034722 3300020078 Bacteria 699
244 Ga0206350_10954774 3300020080 Bacteria 670
245 Ga0206350_11658820 3300020080 Bacteria 899
246 Ga0206354_10384223 3300020081 Bacteria 574
247 Ga0206353_12053975 3300020082 Unclassified 676
248 Ga0154015_1303739 3300020610 Bacteria 1310
249 Ga0213873_10241754 3300021358 Bacteria 570
250 Ga0213876_10009030 3300021384 Bacteria 5369
251 Ga0213875_10101585 3300021388 Bacteria 1342
252 Ga0224712_10379870 3300022467 Unclassified 671
253 Ga0224712_10406688 3300022467 Bacteria 649
254 Ga0207697_10046022 3300025315 Bacteria 1796
255 Ga0207692_10221943 3300025898 Bacteria 1121
256 Ga0207692_10578642 3300025898 Bacteria 720
257 Ga0207642_10368154 3300025899 Bacteria 852
258 Ga0207642_10903739 3300025899 Bacteria 566
259 Ga0207688_10042210 3300025901 Bacteria 2539
260 Ga0207680_10137090 3300025903 Bacteria 1619
261 Ga0207685_10226856 3300025905 Bacteria 891
262 Ga0207699_10053203 3300025906 Bacteria 2400
263 Ga0207645_10805961 3300025907 Bacteria 638
264 Ga0207705_10001058 3300025909 Bacteria 22357
265 Ga0207705_10789468 3300025909 Bacteria 737
266 Ga0207654_10804024 3300025911 Bacteria 679
267 Ga0207707_10000099 3300025912 Bacteria 85950
268 Ga0207707_10004430 3300025912 Bacteria 12376
269 Ga0207707_10030000 3300025912 Bacteria 4754
270 Ga0207707_10743833 3300025912 Bacteria 820
271 Ga0207695_10042642 3300025913 Bacteria 4843
272 Ga0207695_10082319 3300025913 Bacteria 3255
273 Ga0207695_11696769 3300025913 Bacteria 513
274 Ga0207671_10194324 3300025914 Bacteria 1583
275 Ga0207671_10519527 3300025914 Bacteria 949
276 Ga0207663_10178858 3300025916 Bacteria 1513
277 Ga0207663_10190011 3300025916 Bacteria 1474
278 Ga0207660_10001128 3300025917 Bacteria 17885
279 Ga0207660_10001380 3300025917 Bacteria 16281
280 Ga0207660_10002181 3300025917 Bacteria 12963
281 Ga0207660_10212431 3300025917 Bacteria 1516
282 Ga0207660_10636133 3300025917 Bacteria 869
283 Ga0207660_11367984 3300025917 Bacteria 574
284 Ga0207662_10010873 3300025918 Bacteria 5031
285 Ga0207657_10002935 3300025919 Bacteria 18308
286 Ga0207649_10161898 3300025920 Bacteria 1551
287 Ga0207649_10164423 3300025920 Bacteria 1540
288 Ga0207649_11697576 3300025920 Bacteria 500
289 Ga0207652_10000212 3300025921 Bacteria 61500
290 Ga0207652_10004168 3300025921 Bacteria 11794
291 Ga0207652_10021055 3300025921 Bacteria 5379
292 Ga0207652_10033890 3300025921 Bacteria 4301
293 Ga0207652_10117777 3300025921 Bacteria 2360
294 Ga0207652_10247321 3300025921 Bacteria 1608
295 Ga0207652_11238523 3300025921 Bacteria 648
296 Ga0207652_11326285 3300025921 Bacteria 622
297 Ga0207646_10019235 3300025922 Bacteria 6349
298 Ga0207681_10051517 3300025923 Bacteria 2789
299 Ga0207694_10534844 3300025924 Bacteria 983
300 Ga0207694_10579693 3300025924 Bacteria 943
301 Ga0207694_10686459 3300025924 Bacteria 863
302 Ga0207650_10121511 3300025925 Bacteria 2034
303 Ga0207650_10183815 3300025925 Bacteria 1667
304 Ga0207659_10020472 3300025926 Bacteria 4374
305 Ga0207659_10623852 3300025926 Bacteria 920
306 Ga0207687_10131819 3300025927 Bacteria 1885
307 Ga0207700_10549020 3300025928 Bacteria 1025
308 Ga0207700_11120096 3300025928 Bacteria 703
309 Ga0207664_10023538 3300025929 Bacteria 4617
310 Ga0207664_10240494 3300025929 Bacteria 1576
311 Ga0207644_10135330 3300025931 Bacteria 1891
312 Ga0207690_10756746 3300025932 Bacteria 801
313 Ga0207706_10319742 3300025933 Bacteria 1351
314 Ga0207686_10259107 3300025934 Bacteria 1274
315 Ga0207670_10095321 3300025936 Bacteria 2113
316 Ga0207670_10477287 3300025936 Bacteria 1009
317 Ga0207670_11643886 3300025936 Bacteria 546
318 Ga0207669_11772035 3300025937 Bacteria 527
319 Ga0207669_11795936 3300025937 Bacteria 524
320 Ga0207704_11222970 3300025938 Bacteria 641
321 Ga0207665_10143533 3300025939 Bacteria 1705
322 Ga0207691_10022471 3300025940 Bacteria 5948
323 Ga0207691_10988315 3300025940 Bacteria 703
324 Ga0207711_10175097 3300025941 Bacteria 1949
325 Ga0207711_10974685 3300025941 Bacteria 787
326 Ga0207661_10038157 3300025944 Bacteria 3763
327 Ga0207661_10129689 3300025944 Bacteria 2158
328 Ga0207661_10255708 3300025944 Bacteria 1558
329 Ga0207661_10626052 3300025944 Bacteria 988
330 Ga0207661_11748971 3300025944 Bacteria 567
331 Ga0207661_12133542 3300025944 Bacteria 506
332 Ga0207679_10067841 3300025945 Bacteria 2677
333 Ga0207679_10134463 3300025945 Bacteria 1989
334 Ga0207679_10391160 3300025945 Bacteria 1221
335 Ga0207679_11637189 3300025945 Bacteria 590
336 Ga0207667_10263305 3300025949 Bacteria 1763
337 Ga0207667_10543749 3300025949 Bacteria 1175
338 Ga0207651_10181860 3300025960 Bacteria 1668
339 Ga0207640_10009189 3300025981 Bacteria 5523
340 Ga0207658_10447355 3300025986 Bacteria 1143
341 Ga0207677_12038298 3300026023 Bacteria 533
342 Ga0207703_10500919 3300026035 Bacteria 1140
343 Ga0207639_11479529 3300026041 Bacteria 637
344 Ga0207639_11725182 3300026041 Bacteria 587
345 Ga0207678_10145640 3300026067 Bacteria 2022
346 Ga0207678_10265623 3300026067 Bacteria 1471
347 Ga0207708_11158639 3300026075 Bacteria 675
348 Ga0207702_10116872 3300026078 Bacteria 2381
349 Ga0207702_10706360 3300026078 Bacteria 994
350 Ga0207648_10436219 3300026089 Bacteria 1191
351 Ga0207676_10050921 3300026095 Bacteria 3231
352 Ga0207676_10166700 3300026095 Bacteria 1915
353 Ga0207676_11950133 3300026095 Bacteria 586
354 Ga0207674_10117984 3300026116 Bacteria 2624
355 Ga0207674_10171324 3300026116 Bacteria 2124
356 Ga0207698_10056212 3300026142 Bacteria 3038
357 Ga0207698_10372040 3300026142 Bacteria 1357
358 Ga0207698_11686905 3300026142 Bacteria 649
359 Ga0268266_10999231 3300028379 Bacteria 810
360 Ga0307509_10177268 3300031507 Bacteria 2002
361 Ga0307408_100587580 3300031548 Bacteria 988
362 Ga0307408_100588815 3300031548 Bacteria 987
363 Ga0316575_10056283 3300031665 Bacteria 1567
364 Ga0307516_10419543 3300031730 Bacteria 996
365 Ga0307413_10790141 3300031824 Bacteria 797
366 Ga0307413_11353036 3300031824 Bacteria 625
367 Ga0326468_10013012 3300031889 Bacteria 885
368 Ga0307412_10885357 3300031911 Bacteria 781
369 Ga0307412_11444863 3300031911 Bacteria 624
370 Ga0307416_100219520 3300032002 Bacteria 1822
371 Ga0307416_100646770 3300032002 Bacteria 1142
372 Ga0307416_102110305 3300032002 Bacteria 665
373 Ga0307411_10547193 3300032005 Bacteria 987
374 Ga0316593_10372680 3300032168 Bacteria 549
375 Ga0316586_1093094 3300033527 Bacteria 571
376 Ga0316587_1070531 3300033529 Unclassified 654
377 Ga0373930_0164315 3300034816 Bacteria 563
378 Ga0373926_0193429 3300035083 Bacteria 782
379 Ga0373934_0023791 3300035086 Bacteria 2368
380 Ga0373934_0053514 3300035086 Bacteria 1601
381 Ga0373934_0087727 3300035086 Bacteria 1252
382 Ga0373944_0317046 3300035089 Bacteria 588
383 Ga0373952_0040408 3300035092 Bacteria 1076
384 Ga0373923_0018623 3300035111 Bacteria 2676
385 Ga0373936_0279884 3300035113 Bacteria 750
386 Ga0373941_0242742 3300035115 Bacteria 700
387 Ga0373945_0320795 3300035116 Bacteria 667
388 Ga0373945_0580572 3300035116 Bacteria 505
389 Ga0373953_0165514 3300035117 Bacteria 951
390 Ga0373953_0512510 3300035117 Bacteria 532
391 Ga0373954_0103033 3300035118 Bacteria 1378
392 Ga0373956_0020144 3300035119 Bacteria 2835
393 Ga0373956_0330564 3300035119 Bacteria 726
394 Ga0373956_0341661 3300035119 Bacteria 713
395 Ga0373957_0075272 3300035120 Bacteria 1326
396 Ga0373943_0492089 3300035170 Bacteria 716
397 Ga0373955_0004386 3300035172 Bacteria 6241
398 Ga0373955_0890725 3300035172 Bacteria 547
399 Ga0316574_0216855 3300035398 Bacteria 1227
400 Ga0373924_0064022 3300035410 Bacteria 1543
401 Ga0373931_0041531 3300035691 Bacteria 2416
402 Ga0373935_0450755 3300035692 Bacteria 929
403 Ga0373927_0024381 3300035695 Bacteria 3957
404 Ga0373927_0420489 3300035695 Bacteria 882
405 Ga0373933_0038098 3300035724 Unclassified 2824
406 Ga0373933_0136034 3300035724 Bacteria 1548
407 Ga0373947_0020196 3300035725 Bacteria 3845
408 Ga0373947_0104775 3300035725 Bacteria 1781
409 Ga0373937_0004796 3300036401 Bacteria 11487
410 Ga0373937_0067003 3300036401 Bacteria 3307
411 Ga0373937_0129700 3300036401 Bacteria 2354
412 Ga0395905_0000342 3300037471 Bacteria 66255
413 Ga0436364_0277118 3300037853 Bacteria 709
414 Ga0436364_0282766 3300037853 Bacteria 1585
415 Ga0436364_1088487 3300037853 Bacteria 26750
416 Ga0436364_1459429 3300037853 Bacteria 1208
417 Ga0436365_0186605 3300039437 Bacteria 574
418 Ga0436365_0408614 3300039437 Bacteria 606
419 Ga0436365_1103562 3300039437 Bacteria 5681
420 Ga0436365_1281712 3300039437 Bacteria 80367
421 Ga0436363_0463508 3300039450 Bacteria 1792
422 Ga0436362_0326645 3300039453 Bacteria 1616
423 Ga0436362_0543638 3300039453 Bacteria 2383
424 Ga0436362_0826790 3300039453 Bacteria 1656
425 Ga0451789_0803394 3300041443 Bacteria 681
426 Ga0451795_0205060 3300041456 Bacteria 1325
427 Ga0451795_1285107 3300041456 Bacteria 678
428 Ga0451805_051290 3300041461 Bacteria 521
429 Ga0451837_1138682 3300041494 Bacteria 1054
430 Ga0451837_1625572 3300041494 Bacteria 516
431 Ga0451839_0310862 3300041496 Bacteria 878
432 Ga0451855_1204312 3300041511 Bacteria 656
433 Ga0451853_0278828 3300041512 Bacteria 837
434 Ga0451577_0003423 3300042876 Bacteria 17680
435 Ga0451577_0051202 3300042876 Bacteria 3686
436 Ga0451577_0125951 3300042876 Bacteria 2295
437 Ga0451577_0777376 3300042876 Bacteria 865
438 Ga0466972_0037592 3300044658 Bacteria 2366
439 Ga0453684_0000368 3300044712 Bacteria 185018
440 Ga0453684_0018982 3300044712 Bacteria 10504
441 Ga0453684_0021439 3300044712 Bacteria 9652
442 Ga0453684_0941284 3300044712 Bacteria 922
443 Ga0466960_0210631 3300044901 Bacteria 1065
444 Ga0466960_0326110 3300044901 Bacteria 871
445 Ga0451576_0034615 3300045051 Bacteria 5364
446 Ga0451576_0164650 3300045051 Bacteria 2314
447 Ga0451576_1167254 3300045051 Bacteria 805
448 Ga0466958_0644116 3300045836 Bacteria 690
449 Ga0466967_0217030 3300045976 Bacteria 1816
450 Ga0495592_0156700 3300046454 Bacteria 1570
451 Ga0495592_0274236 3300046454 Bacteria 1105
452 Ga0495592_0668233 3300046454 Unclassified 628
453 Ga0495591_174878 3300046458 Bacteria 512
454 Ga0495629_0008581 3300046459 Bacteria 7524
455 Ga0495629_0643966 3300046459 Bacteria 707
456 Ga0495651_0012740 3300046462 Bacteria 6491
457 Ga0495653_0062468 3300046463 Bacteria 2814
458 Ga0495580_0035491 3300046472 Bacteria 3586
459 Ga0495580_1091098 3300046472 Bacteria 505
460 Ga0495582_0009599 3300046473 Bacteria 5329
461 Ga0495582_0190358 3300046473 Bacteria 1170
462 Ga0495605_0417837 3300046474 Bacteria 556
463 Ga0495639_0115641 3300046475 Bacteria 1276
464 Ga0495662_0096387 3300046476 Bacteria 1446
465 Ga0495594_0004951 3300046499 Bacteria 6853
466 Ga0495594_0011811 3300046499 Bacteria 4542
467 Ga0495594_0013256 3300046499 Bacteria 4301
468 Ga0495594_0227591 3300046499 Bacteria 1063
469 Ga0495594_0382744 3300046499 Bacteria 801
470 Ga0495596_0130580 3300046500 Bacteria 975
471 Ga0495608_0139217 3300046511 Bacteria 1550
472 Ga0495618_0377469 3300046514 Bacteria 870
473 Ga0495620_0379138 3300046515 Bacteria 536
474 Ga0495628_0006841 3300046516 Bacteria 9908
475 Ga0495628_0997080 3300046516 Bacteria 576
476 Ga0495628_1085014 3300046516 Bacteria 547
477 Ga0495630_0072553 3300046517 Bacteria 2591
478 Ga0495630_0547342 3300046517 Bacteria 887
479 Ga0495644_0461978 3300046523 Bacteria 506
480 Ga0495663_0225222 3300046525 Bacteria 660
481 Ga0495666_0067565 3300046526 Bacteria 1703
482 Ga0495652_0016691 3300046529 Bacteria 6562
483 Ga0495652_0101896 3300046529 Bacteria 2327
484 Ga0495652_0156104 3300046529 Bacteria 1777
485 Ga0495665_0097749 3300046531 Bacteria 1541
486 Ga0495665_0145827 3300046531 Bacteria 1236
487 Ga0495640_0249387 3300046533 Bacteria 1112
488 Ga0495586_0086566 3300046535 Bacteria 1727
489 Ga0495586_0259481 3300046535 Bacteria 992
490 Ga0495586_0323997 3300046535 Bacteria 884
491 Ga0495586_0518006 3300046535 Bacteria 688
492 Ga0495586_0642988 3300046535 Bacteria 613
493 Ga0495587_0001748 3300046536 Bacteria 14511
494 Ga0495587_0003628 3300046536 Bacteria 10273
495 Ga0495587_0111185 3300046536 Bacteria 1574
496 Ga0495587_0276540 3300046536 Bacteria 941
497 Ga0495621_0042420 3300046539 Bacteria 1601
498 Ga0495645_0000624 3300046543 Bacteria 24390
499 Ga0495645_0001304 3300046543 Bacteria 16944
500 Ga0495645_0300190 3300046543 Bacteria 1049
501 Ga0495667_0001036 3300046559 Bacteria 18031
502 Ga0495667_0114183 3300046559 Bacteria 1745
503 Ga0495667_0546471 3300046559 Bacteria 724
504 Ga0495634_0536353 3300046642 Bacteria 683
505 Ga0495635_0081858 3300046663 Bacteria 2209
506 Ga0495635_0510811 3300046663 Bacteria 790
507 Ga0495657_0122684 3300046675 Bacteria 1635
508 Ga0495599_0002824 3300046678 Bacteria 10117
509 Ga0495599_0016832 3300046678 Bacteria 4541
510 Ga0495599_0472940 3300046678 Bacteria 740
511 Ga0495623_0010743 3300046679 Bacteria 5926
512 Ga0495623_0058568 3300046679 Bacteria 2421
513 Ga0495623_0422955 3300046679 Bacteria 713
514 Ga0495646_0141238 3300046680 Bacteria 1346
515 Ga0495658_0547045 3300046683 Bacteria 741
516 Ga0495613_0127850 3300046689 Bacteria 1821
517 Ga0495613_0828933 3300046689 Bacteria 602
518 Ga0495600_0268774 3300046809 Bacteria 1082
519 Ga0495581_0115079 3300047315 Bacteria 1564
520 Ga0495581_0258031 3300047315 Bacteria 1019
521 Ga0495581_0303932 3300047315 Bacteria 932
522 Ga0495604_0007160 3300047317 Bacteria 8835
523 Ga0495604_0312480 3300047317 Bacteria 1052
524 Ga0495636_0218081 3300047318 Bacteria 875
525 Ga0495674_0162012 3300047319 Bacteria 1871
526 Ga0495674_0235463 3300047319 Bacteria 1510
527 Ga0495672_0005772 3300047320 Bacteria 9735
528 Ga0495675_0011632 3300047444 Bacteria 5525
529 Ga0495675_0019342 3300047444 Bacteria 4325
530 Ga0495675_0026530 3300047444 Bacteria 3694
531 Ga0495675_0167913 3300047444 Bacteria 1349
532 Ga0495684_0009487 3300047471 Bacteria 7507
533 Ga0495684_0283912 3300047471 Bacteria 1193
534 Ga0495684_0505822 3300047471 Bacteria 830
535 Ga0495593_0390154 3300047673 Bacteria 696
536 Ga0495593_0463598 3300047673 Bacteria 634
537 Ga0495602_0027305 3300048088 Bacteria 5487
538 Ga0495602_0247780 3300048088 Bacteria 1329
539 Ga0496101_0021835 3300048904 Bacteria 4398
540 Ga0496101_0701870 3300048904 Bacteria 799
541 Ga0496108_0422345 3300048911 Bacteria 1164
542 Ga0496108_0493116 3300048911 Bacteria 1070
543 Ga0496109_0035287 3300048912 Bacteria 4510
544 Ga0496109_0305320 3300048912 Bacteria 1501
545 Ga0496110_0389635 3300048913 Bacteria 1270
546 Ga0496111_0760573 3300048914 Bacteria 702
547 Ga0496112_0000518 3300048915 Bacteria 26254
548 Ga0496112_0097418 3300048915 Bacteria 2912
549 Ga0496113_0117577 3300048916 Bacteria 2076
550 Ga0496113_0411128 3300048916 Bacteria 1087
551 Ga0496115_0108596 3300048918 Bacteria 2278
552 Ga0496115_0919269 3300048918 Bacteria 674
553 Ga0501304_021403 3300049160 Bacteria 643
554 Ga0501291_009084 3300049514 Bacteria 1387
555 Ga0501294_015791 3300049517 Bacteria 782
556 Ga0501297_021242 3300049520 Bacteria 814
557 Ga0501298_085637 3300049521 Bacteria 699
558 Ga0501324_024502 3300049540 Bacteria 633
559 Ga0501031_0649868 3300049568 Bacteria 678
560 Ga0501032_0457921 3300049569 Bacteria 817
561 Ga0501032_0578801 3300049569 Bacteria 715
562 Ga0501033_0380100 3300049570 Bacteria 987
563 Ga0501034_0811287 3300049571 Bacteria 828
564 Ga0501036_1240186 3300049572 Bacteria 607
565 Ga0501038_0786054 3300049574 Bacteria 708
566 Ga0501043_0085156 3300049579 Bacteria 2484
567 Ga0501046_0354771 3300049580 Bacteria 1064
568 Ga0501047_0648229 3300049581 Bacteria 875
569 Ga0501070_0338420 3300049586 Bacteria 1222
570 Ga0501070_0409862 3300049586 Bacteria 1095
571 Ga0501070_0560905 3300049586 Bacteria 913
572 Ga0501075_0348146 3300049591 Bacteria 1129
573 Ga0501202_002634 3300049652 Bacteria 3027
574 Ga0501216_151204 3300049660 Bacteria 552
575 Ga0501217_039933 3300049661 Bacteria 1191
576 Ga0501223_008659 3300049663 Bacteria 2071
577 Ga0501224_014464 3300049664 Bacteria 1167
578 Ga0501227_088626 3300049665 Bacteria 815
579 Ga0501230_131396 3300049667 Bacteria 560
580 Ga0501235_011994 3300049669 Bacteria 1905
581 Ga0501239_018431 3300049672 Bacteria 839
582 Ga0501256_008217 3300049685 Bacteria 970
583 Ga0501257_027830 3300049686 Bacteria 1354
584 Ga0501259_063149 3300049688 Bacteria 778
585 Ga0501234_038825 3300049707 Bacteria 777
586 Ga0501081_1550313 3300049743 Bacteria 503
587 Ga0501083_0553999 3300049744 Bacteria 748
588 Ga0501232_005732 3300049757 Bacteria 1247
589 Ga0501241_046011 3300049758 Bacteria 854
590 Ga0501264_024551 3300049761 Unclassified 660
591 Ga0501267_027419 3300049764 Bacteria 657
592 Ga0501273_013905 3300049770 Bacteria 1031
593 Ga0501278_041510 3300049774 Bacteria 503
594 Ga0501035_1279353 3300049822 Bacteria 566
595 Ga0501044_0149789 3300049823 Bacteria 2316
596 Ga0501044_0919315 3300049823 Bacteria 749
597 Ga0501212_009888 3300049851 Bacteria 1352
598 Ga0501220_08993 3300049852 Bacteria 533
599 nmdc:mga05p37_1489461_c1 3300050507 Bacteria 675
600 nmdc:mga05p37_25528_c2 3300050507 Bacteria 6703
601 nmdc:mga05p37_548879_c1 3300050507 Bacteria 1316
602 nmdc:mga09592_378498_c1 3300050508 Bacteria 1224
603 nmdc:mga0qj67_113311_c1 3300050509 Bacteria 2190
604 nmdc:mga0qj67_167202_c1 3300050509 Bacteria 1786
605 nmdc:mga06r32_1029249_c1 3300050510 Bacteria 775
606 nmdc:mga06r32_78412_c1 3300050510 Bacteria 3211
607 nmdc:mga08y16_137813_c1 3300050511 Bacteria 2537
608 nmdc:mga08y16_913644_c1 3300050511 Bacteria 863
609 nmdc:mga08x19_27335_c1 3300050514 Bacteria 3567
610 nmdc:mga0a205_163153_c1 3300050515 Bacteria 2124
611 Ga0495601_0173757 3300053077 Bacteria 1408
612 Ga0495601_0179519 3300053077 Unclassified 1384
613 Ga0495601_0323424 3300053077 Bacteria 1004
614 Ga0495612_0003892 3300053078 Bacteria 6191
615 Ga0495595_0033583 3300053084 Bacteria 2316
616 Ga0495595_0256958 3300053084 Bacteria 875
617 Ga0495595_0674271 3300053084 Bacteria 530
618 Ga0495619_0031783 3300053085 Bacteria 3422
619 Ga0495619_0567805 3300053085 Bacteria 777
620 Ga0500604_0147639 3300053151 Bacteria 797
621 Ga0590071_070936 3300059421 Bacteria 859
622 Ga0587093_088741 3300059478 Unclassified 543
623 Ga0587066_025394 3300059490 Unclassified 1016
624 Ga0587066_030331 3300059490 Bacteria 960
625 Ga0587070_126220 3300059491 Unclassified 617
626 Ga0587073_0029412 3300059492 Unclassified 1123
627 Ga0587073_0031134 3300059492 Bacteria 1102
628 Ga0587073_0141363 3300059492 Unclassified 671
629 Ga0587077_042371 3300059493 Bacteria 919
630 Ga0587077_187206 3300059493 Bacteria 565
631 Ga0587077_222106 3300059493 Bacteria 533
632 Ga0587080_022144 3300059503 Unclassified 1050
633 Ga0587082_025394 3300059504 Unclassified 996
634 Ga0587082_055157 3300059504 Bacteria 769
635 Ga0587083_0096208 3300059505 Unclassified 730
636 Ga0587083_0197053 3300059505 Unclassified 573
637 Ga0587085_149431 3300059506 Unclassified 537
638 Ga0587090_042832 3300059510 Bacteria 803
639 Ga0587091_035376 3300059511 Bacteria 959
640 Ga0587092_083527 3300059512 Unclassified 634
641 Ga0587106_009906 3300059605 Unclassified 1222
642 Ga0587106_069259 3300059605 Bacteria 665
643 Ga0587106_120054 3300059605 Bacteria 557
644 Ga0587106_127087 3300059605 Bacteria 547
645 Ga0587099_014083 3300059622 Unclassified 840
646 Ga0587109_075906 3300059624 Bacteria 735
647 Ga0587115_090413 3300059626 Unclassified 555
648 Ga0587117_120097 3300059627 Unclassified 520
649 Ga0587128_024226 3300059630 Bacteria 957
650 Ga0587128_044436 3300059630 Unclassified 789
651 Ga0587128_056829 3300059630 Bacteria 729
652 Ga0587128_151621 3300059630 Unclassified 528
653 Ga0587062_087302 3300059639 Unclassified 589
654 Ga0587067_020823 3300059640 Unclassified 1125
655 Ga0587067_037531 3300059640 Bacteria 926
656 Ga0587067_060184 3300059640 Bacteria 794
657 Ga0587068_049130 3300059641 Unclassified 785
658 Ga0587072_046881 3300059643 Bacteria 856
659 Ga0587072_088117 3300059643 Bacteria 680
660 Ga0587075_024996 3300059644 Unclassified 915
661 Ga0587076_015962 3300059645 Unclassified 1179
662 Ga0587076_048243 3300059645 Bacteria 821
663 Ga0587079_078305 3300059647 Bacteria 751
664 Ga0587102_013332 3300059649 Unclassified 849
665 Ga0587102_046511 3300059649 Bacteria 574
666 Ga0587102_055763 3300059649 Unclassified 542
667 Ga0587107_050506 3300059652 Unclassified 704
668 Ga0587114_014904 3300059655 Bacteria 1021
669 Ga0587119_064382 3300059658 Unclassified 571
670 Ga0587071_025830 3300060344 Bacteria 1104
671 Ga0501082_0621305 3300060353 Bacteria 946
672 Ga0207657_11218803
673 JGI24749J21850_1018704
674 Ga0058861_10054482
675 Ga0058861_11909276
676 Ga0058862_10148224
677 Ga0065704_10011346
678 Ga0065712_10070847
679 Ga0065712_10209544
680 Ga0065712_10350179
681 Ga0065715_10324645
682 Ga0065707_11063374
683 Ga0070658_10001643
684 Ga0070658_10099512
685 Ga0070658_10156359
686 Ga0070658_10257093
687 Ga0070658_10591545
688 Ga0070676_10528110
689 Ga0070676_10925647
690 Ga0070676_11007070
691 Ga0070676_11371042
692 Ga0070683_100052735
693 Ga0070683_100211683
694 Ga0070683_100673603
695 Ga0070683_101866762
696 Ga0070690_100308472
697 Ga0070690_100443005
698 Ga0070670_100034433
699 Ga0070677_10015372
700 Ga0070666_10151395
701 Ga0070680_100000402
702 Ga0070680_100005402
703 Ga0070680_100009849
704 Ga0070680_100244752
705 Ga0070680_101094536
706 Ga0070682_100881037
707 Ga0070660_100006938
708 Ga0070660_101109956
709 Ga0070689_100040115
710 Ga0070691_10047050
711 Ga0070687_100006777
712 Ga0070661_100007955
713 Ga0070661_100398709
714 Ga0070661_100610721
715 Ga0070661_100617817
716 Ga0070661_100785526
717 Ga0070661_101927445
718 Ga0070692_10050171
719 Ga0070692_10507538
720 Ga0070669_100021040
721 Ga0070669_100458420
722 Ga0070675_100014159
723 Ga0070671_100100960
724 Ga0070674_100018717
725 Ga0070673_100019969
726 Ga0070688_100071768
727 Ga0070659_100792984
728 Ga0070667_100125230
729 Ga0070667_100296151
730 Ga0070709_10010674
731 Ga0070714_100018253
732 Ga0070713_100088098
733 Ga0070713_100178642
734 Ga0070711_100174696
735 Ga0070705_101185131
736 Ga0070700_101130405
737 Ga0070694_100058699
738 Ga0070694_101183537
739 Ga0070708_100000070
740 Ga0070708_100000704
741 Ga0070663_100113855
742 Ga0070663_100176671
743 Ga0070678_101154874
744 Ga0070662_100409902
745 Ga0070681_10001683
746 Ga0070681_10005971
747 Ga0070681_10063684
748 Ga0070681_11281139
749 Ga0068867_100044387
750 Ga0070685_10046847
751 Ga0070707_100002634
752 Ga0070707_100116782
753 Ga0070679_100001713
754 Ga0070679_100002458
755 Ga0070679_100005557
756 Ga0070679_100008561
757 Ga0070679_100038712
758 Ga0070679_100182964
759 Ga0070679_100207092
760 Ga0070679_100518804
761 Ga0070679_101308516
762 Ga0070684_100008750
763 Ga0070684_100039340
764 Ga0070684_100148099
765 Ga0070684_100165745
766 Ga0070684_100771412
767 Ga0070684_100820907
768 Ga0070684_101086754
769 Ga0070684_101513350
770 Ga0068853_100841994
771 Ga0068853_101953614
772 Ga0070686_100178640
773 Ga0070686_100752751
774 Ga0070695_101380892
775 Ga0070696_100019274
776 Ga0070696_100652059
777 Ga0070696_101936536
778 Ga0070693_100520423
779 Ga0070693_100961749
780 Ga0070665_100781140
781 Ga0068855_100005434
782 Ga0068855_100110120
783 Ga0068855_100179820
784 Ga0068855_100322273
785 Ga0070664_100392909
786 Ga0070664_101023713
787 Ga0068857_100174305
788 Ga0068857_100460853
789 Ga0068854_100026703
790 Ga0068856_100111198
791 Ga0068856_100250300
792 Ga0068856_100460907
793 Ga0068856_101477591
794 Ga0070702_101830756
795 Ga0068852_100423577
796 Ga0068859_100183649
797 Ga0068864_100004940
798 Ga0068864_100636256
799 Ga0068866_10022515
800 Ga0068863_102586409
801 Ga0068858_100063157
802 Ga0068862_100857008
803 Ga0081539_10017757
804 Ga0070715_10902307
805 Ga0070716_101669225
806 Ga0097621_100735085
807 Ga0075428_100123692
808 Ga0075428_100257904
809 Ga0075430_100002964
810 Ga0075430_100108528
811 Ga0075431_100539168
812 Ga0075433_10172312
813 Ga0075429_100372749
814 Ga0068865_100587566
815 Ga0068865_101274703
816 Ga0097620_100183649
817 Ga0105240_10112296
818 Ga0105240_10402365
819 Ga0105240_10963645
820 Ga0105240_11383274
821 Ga0111539_10008609
822 Ga0111539_10112566
823 Ga0111539_10656851
824 Ga0105245_10066188
825 Ga0114129_10006882
826 Ga0114129_10058436
827 Ga0114129_10458278
828 Ga0114129_11728720
829 Ga0105243_10242997
830 Ga0105243_10678069
831 Ga0105241_10049604
832 Ga0105241_11358373
833 Ga0105242_10019656
834 Ga0105242_10234283
835 Ga0105248_10163727
836 Ga0105248_10234190
837 Ga0105248_10534046
838 Ga0105237_10635874
839 Ga0105237_11360933
840 Ga0105238_10051392
841 Ga0105238_10331197
842 Ga0105238_10930263
843 Ga0105238_12841957
844 Ga0105249_12141613
845 Ga0105249_13521517
846 Ga0130087_1026956
847 Ga0130086_1045134
848 Ga0130084_1105561
849 Ga0099796_10500395
850 Ga0105246_10444372
851 Ga0105246_10724613
852 Ga0157325_1001936
853 Ga0157335_1032789
854 Ga0157313_1061104
855 Ga0157373_10048812
856 Ga0157373_10186725
857 Ga0157373_10243453
858 Ga0157371_10180209
859 Ga0157371_11190789
860 Ga0157370_10004185
861 Ga0157370_10007097
862 Ga0157370_10048185
863 Ga0157370_10421646
864 Ga0157370_10541157
865 Ga0157370_10885479
866 Ga0157370_11157183
867 Ga0157369_10005628
868 Ga0157369_10140935
869 Ga0157369_10170497
870 Ga0157369_10220058
871 Ga0157369_11923227
872 Ga0157374_10809504
873 Ga0157378_10531260
874 Ga0157378_10696318
875 Ga0163162_10664137
876 Ga0163162_11154420
877 Ga0157372_10004251
878 Ga0157372_10017275
879 Ga0157372_10018444
880 Ga0157372_10067261
881 Ga0157372_10077078
882 Ga0157372_10138874
883 Ga0157372_12951258
884 Ga0157375_10237805
885 Ga0157375_11782238
886 Ga0163163_10114086
887 Ga0163163_11352269
888 Ga0163163_11971187
889 Ga0163163_12891334
890 Ga0157380_10636205
891 Ga0157380_11924027
892 Ga0157377_10244326
893 Ga0157379_10819322
894 Ga0157376_10548245
895 Ga0182007_10123061
896 Ga0182007_10204022
897 Ga0182005_1016162
898 Ga0182005_1059471
899 Ga0163161_11079421
900 Ga0197907_10283107
901 Ga0197907_10859733
902 Ga0206356_10242011
903 Ga0206356_10661324
904 Ga0206356_11063995
905 Ga0206356_11103976
906 Ga0206356_11566158
907 Ga0206356_11586736
908 Ga0206349_1964416
909 Ga0206355_1722446
910 Ga0206351_10212952
911 Ga0206351_10771098
912 Ga0206352_10168891
913 Ga0206352_10676944
914 Ga0206352_11034722
915 Ga0206350_10954774
916 Ga0206350_11658820
917 Ga0206354_10384223
918 Ga0206353_12053975
919 Ga0154015_1303739
920 Ga0213873_10241754
921 Ga0213876_10009030
922 Ga0213875_10101585
923 Ga0224712_10379870
924 Ga0224712_10406688
925 Ga0207697_10046022
926 Ga0207692_10221943
927 Ga0207692_10578642
928 Ga0207642_10368154
929 Ga0207642_10903739
930 Ga0207688_10042210
931 Ga0207680_10137090
932 Ga0207685_10226856
933 Ga0207699_10053203
934 Ga0207645_10805961
935 Ga0207705_10001058
936 Ga0207705_10789468
937 Ga0207654_10804024
938 Ga0207707_10000099
939 Ga0207707_10004430
940 Ga0207707_10030000
941 Ga0207707_10743833
942 Ga0207695_10042642
943 Ga0207695_10082319
944 Ga0207695_11696769
945 Ga0207671_10194324
946 Ga0207671_10519527
947 Ga0207663_10178858
948 Ga0207663_10190011
949 Ga0207660_10001128
950 Ga0207660_10001380
951 Ga0207660_10002181
952 Ga0207660_10212431
953 Ga0207660_10636133
954 Ga0207660_11367984
955 Ga0207662_10010873
956 Ga0207657_10002935
957 Ga0207649_10161898
958 Ga0207649_10164423
959 Ga0207649_11697576
960 Ga0207652_10000212
961 Ga0207652_10004168
962 Ga0207652_10021055
963 Ga0207652_10033890
964 Ga0207652_10117777
965 Ga0207652_10247321
966 Ga0207652_11238523
967 Ga0207652_11326285
968 Ga0207646_10019235
969 Ga0207681_10051517
970 Ga0207694_10534844
971 Ga0207694_10579693
972 Ga0207694_10686459
973 Ga0207650_10121511
974 Ga0207650_10183815
975 Ga0207659_10020472
976 Ga0207659_10623852
977 Ga0207687_10131819
978 Ga0207700_10549020
979 Ga0207700_11120096
980 Ga0207664_10023538
981 Ga0207664_10240494
982 Ga0207644_10135330
983 Ga0207690_10756746
984 Ga0207706_10319742
985 Ga0207686_10259107
986 Ga0207670_10095321
987 Ga0207670_10477287
988 Ga0207670_11643886
989 Ga0207669_11772035
990 Ga0207669_11795936
991 Ga0207704_11222970
992 Ga0207665_10143533
993 Ga0207691_10022471
994 Ga0207691_10988315
995 Ga0207711_10175097
996 Ga0207711_10974685
997 Ga0207661_10038157
998 Ga0207661_10129689
999 Ga0207661_10255708
1000 Ga0207661_10626052
1001 Ga0207661_11748971
1002 Ga0207661_12133542
1003 Ga0207679_10067841
1004 Ga0207679_10134463
1005 Ga0207679_10391160
1006 Ga0207679_11637189
1007 Ga0207667_10263305
1008 Ga0207667_10543749
1009 Ga0207651_10181860
1010 Ga0207640_10009189
1011 Ga0207658_10447355
1012 Ga0207677_12038298
1013 Ga0207703_10500919
1014 Ga0207639_11479529
1015 Ga0207639_11725182
1016 Ga0207678_10145640
1017 Ga0207678_10265623
1018 Ga0207708_11158639
1019 Ga0207702_10116872
1020 Ga0207702_10706360
1021 Ga0207648_10436219
1022 Ga0207676_10050921
1023 Ga0207676_10166700
1024 Ga0207676_11950133
1025 Ga0207674_10117984
1026 Ga0207674_10171324
1027 Ga0207698_10056212
1028 Ga0207698_10372040
1029 Ga0207698_11686905
1030 Ga0268266_10999231
1031 Ga0307509_10177268
1032 Ga0307408_100587580
1033 Ga0307408_100588815
1034 Ga0316575_10056283
1035 Ga0307516_10419543
1036 Ga0307413_10790141
1037 Ga0307413_11353036
1038 Ga0326468_10013012
1039 Ga0307412_10885357
1040 Ga0307412_11444863
1041 Ga0307416_100219520
1042 Ga0307416_100646770
1043 Ga0307416_102110305
1044 Ga0307411_10547193
1045 Ga0316593_10372680
1046 Ga0316586_1093094
1047 Ga0316587_1070531
1048 Ga0373930_0164315
1049 Ga0373926_0193429
1050 Ga0373934_0023791
1051 Ga0373934_0053514
1052 Ga0373934_0087727
1053 Ga0373944_0317046
1054 Ga0373952_0040408
1055 Ga0373923_0018623
1056 Ga0373936_0279884
1057 Ga0373941_0242742
1058 Ga0373945_0320795
1059 Ga0373945_0580572
1060 Ga0373953_0165514
1061 Ga0373953_0512510
1062 Ga0373954_0103033
1063 Ga0373956_0020144
1064 Ga0373956_0330564
1065 Ga0373956_0341661
1066 Ga0373957_0075272
1067 Ga0373943_0492089
1068 Ga0373955_0004386
1069 Ga0373955_0890725
1070 Ga0316574_0216855
1071 Ga0373924_0064022
1072 Ga0373931_0041531
1073 Ga0373935_0450755
1074 Ga0373927_0024381
1075 Ga0373927_0420489
1076 Ga0373933_0038098
1077 Ga0373933_0136034
1078 Ga0373947_0020196
1079 Ga0373947_0104775
1080 Ga0373937_0004796
1081 Ga0373937_0067003
1082 Ga0373937_0129700
1083 Ga0395905_0000342
1084 Ga0436364_0277118
1085 Ga0436364_0282766
1086 Ga0436364_1088487
1087 Ga0436364_1459429
1088 Ga0436365_0186605
1089 Ga0436365_0408614
1090 Ga0436365_1103562
1091 Ga0436365_1281712
1092 Ga0436363_0463508
1093 Ga0436362_0326645
1094 Ga0436362_0543638
1095 Ga0436362_0826790
1096 Ga0451789_0803394
1097 Ga0451795_0205060
1098 Ga0451795_1285107
1099 Ga0451805_051290
1100 Ga0451837_1138682
1101 Ga0451837_1625572
1102 Ga0451839_0310862
1103 Ga0451855_1204312
1104 Ga0451853_0278828
1105 Ga0451577_0003423
1106 Ga0451577_0051202
1107 Ga0451577_0125951
1108 Ga0451577_0777376
1109 Ga0466972_0037592
1110 Ga0453684_0000368
1111 Ga0453684_0018982
1112 Ga0453684_0021439
1113 Ga0453684_0941284
1114 Ga0466960_0210631
1115 Ga0466960_0326110
1116 Ga0451576_0034615
1117 Ga0451576_0164650
1118 Ga0451576_1167254
1119 Ga0466958_0644116
1120 Ga0466967_0217030
1121 Ga0495592_0156700
1122 Ga0495592_0274236
1123 Ga0495592_0668233
1124 Ga0495591_174878
1125 Ga0495629_0008581
1126 Ga0495629_0643966
1127 Ga0495651_0012740
1128 Ga0495653_0062468
1129 Ga0495580_0035491
1130 Ga0495580_1091098
1131 Ga0495582_0009599
1132 Ga0495582_0190358
1133 Ga0495605_0417837
1134 Ga0495639_0115641
1135 Ga0495662_0096387
1136 Ga0495594_0004951
1137 Ga0495594_0011811
1138 Ga0495594_0013256
1139 Ga0495594_0227591
1140 Ga0495594_0382744
1141 Ga0495596_0130580
1142 Ga0495608_0139217
1143 Ga0495618_0377469
1144 Ga0495620_0379138
1145 Ga0495628_0006841
1146 Ga0495628_0997080
1147 Ga0495628_1085014
1148 Ga0495630_0072553
1149 Ga0495630_0547342
1150 Ga0495644_0461978
1151 Ga0495663_0225222
1152 Ga0495666_0067565
1153 Ga0495652_0016691
1154 Ga0495652_0101896
1155 Ga0495652_0156104
1156 Ga0495665_0097749
1157 Ga0495665_0145827
1158 Ga0495640_0249387
1159 Ga0495586_0086566
1160 Ga0495586_0259481
1161 Ga0495586_0323997
1162 Ga0495586_0518006
1163 Ga0495586_0642988
1164 Ga0495587_0001748
1165 Ga0495587_0003628
1166 Ga0495587_0111185
1167 Ga0495587_0276540
1168 Ga0495621_0042420
1169 Ga0495645_0000624
1170 Ga0495645_0001304
1171 Ga0495645_0300190
1172 Ga0495667_0001036
1173 Ga0495667_0114183
1174 Ga0495667_0546471
1175 Ga0495634_0536353
1176 Ga0495635_0081858
1177 Ga0495635_0510811
1178 Ga0495657_0122684
1179 Ga0495599_0002824
1180 Ga0495599_0016832
1181 Ga0495599_0472940
1182 Ga0495623_0010743
1183 Ga0495623_0058568
1184 Ga0495623_0422955
1185 Ga0495646_0141238
1186 Ga0495658_0547045
1187 Ga0495613_0127850
1188 Ga0495613_0828933
1189 Ga0495600_0268774
1190 Ga0495581_0115079
1191 Ga0495581_0258031
1192 Ga0495581_0303932
1193 Ga0495604_0007160
1194 Ga0495604_0312480
1195 Ga0495636_0218081
1196 Ga0495674_0162012
1197 Ga0495674_0235463
1198 Ga0495672_0005772
1199 Ga0495675_0011632
1200 Ga0495675_0019342
1201 Ga0495675_0026530
1202 Ga0495675_0167913
1203 Ga0495684_0009487
1204 Ga0495684_0283912
1205 Ga0495684_0505822
1206 Ga0495593_0390154
1207 Ga0495593_0463598
1208 Ga0495602_0027305
1209 Ga0495602_0247780
1210 Ga0496101_0021835
1211 Ga0496101_0701870
1212 Ga0496108_0422345
1213 Ga0496108_0493116
1214 Ga0496109_0035287
1215 Ga0496109_0305320
1216 Ga0496110_0389635
1217 Ga0496111_0760573
1218 Ga0496112_0000518
1219 Ga0496112_0097418
1220 Ga0496113_0117577
1221 Ga0496113_0411128
1222 Ga0496115_0108596
1223 Ga0496115_0919269
1224 Ga0501304_021403
1225 Ga0501291_009084
1226 Ga0501294_015791
1227 Ga0501297_021242
1228 Ga0501298_085637
1229 Ga0501324_024502
1230 Ga0501031_0649868
1231 Ga0501032_0457921
1232 Ga0501032_0578801
1233 Ga0501033_0380100
1234 Ga0501034_0811287
1235 Ga0501036_1240186
1236 Ga0501038_0786054
1237 Ga0501043_0085156
1238 Ga0501046_0354771
1239 Ga0501047_0648229
1240 Ga0501070_0338420
1241 Ga0501070_0409862
1242 Ga0501070_0560905
1243 Ga0501075_0348146
1244 Ga0501202_002634
1245 Ga0501216_151204
1246 Ga0501217_039933
1247 Ga0501223_008659
1248 Ga0501224_014464
1249 Ga0501227_088626
1250 Ga0501230_131396
1251 Ga0501235_011994
1252 Ga0501239_018431
1253 Ga0501256_008217
1254 Ga0501257_027830
1255 Ga0501259_063149
1256 Ga0501234_038825
1257 Ga0501081_1550313
1258 Ga0501083_0553999
1259 Ga0501232_005732
1260 Ga0501241_046011
1261 Ga0501264_024551
1262 Ga0501267_027419
1263 Ga0501273_013905
1264 Ga0501278_041510
1265 Ga0501035_1279353
1266 Ga0501044_0149789
1267 Ga0501044_0919315
1268 Ga0501212_009888
1269 Ga0501220_08993
1270 nmdc:mga05p37_1489461_c1
1271 nmdc:mga05p37_25528_c2
1272 nmdc:mga05p37_548879_c1
1273 nmdc:mga09592_378498_c1
1274 nmdc:mga0qj67_113311_c1
1275 nmdc:mga0qj67_167202_c1
1276 nmdc:mga06r32_1029249_c1
1277 nmdc:mga06r32_78412_c1
1278 nmdc:mga08y16_137813_c1
1279 nmdc:mga08y16_913644_c1
1280 nmdc:mga08x19_27335_c1
1281 nmdc:mga0a205_163153_c1
1282 Ga0495601_0173757
1283 Ga0495601_0179519
1284 Ga0495601_0323424
1285 Ga0495612_0003892
1286 Ga0495595_0033583
1287 Ga0495595_0256958
1288 Ga0495595_0674271
1289 Ga0495619_0031783
1290 Ga0495619_0567805
1291 Ga0500604_0147639
1292 Ga0590071_070936
1293 Ga0587093_088741
1294 Ga0587066_025394
1295 Ga0587066_030331
1296 Ga0587070_126220
1297 Ga0587073_0029412
1298 Ga0587073_0031134
1299 Ga0587073_0141363
1300 Ga0587077_042371
1301 Ga0587077_187206
1302 Ga0587077_222106
1303 Ga0587080_022144
1304 Ga0587082_025394
1305 Ga0587082_055157
1306 Ga0587083_0096208
1307 Ga0587083_0197053
1308 Ga0587085_149431
1309 Ga0587090_042832
1310 Ga0587091_035376
1311 Ga0587092_083527
1312 Ga0587106_009906
1313 Ga0587106_069259
1314 Ga0587106_120054
1315 Ga0587106_127087
1316 Ga0587099_014083
1317 Ga0587109_075906
1318 Ga0587115_090413
1319 Ga0587117_120097
1320 Ga0587128_024226
1321 Ga0587128_044436
1322 Ga0587128_056829
1323 Ga0587128_151621
1324 Ga0587062_087302
1325 Ga0587067_020823
1326 Ga0587067_037531
1327 Ga0587067_060184
1328 Ga0587068_049130
1329 Ga0587072_046881
1330 Ga0587072_088117
1331 Ga0587075_024996
1332 Ga0587076_015962
1333 Ga0587076_048243
1334 Ga0587079_078305
1335 Ga0587102_013332
1336 Ga0587102_046511
1337 Ga0587102_055763
1338 Ga0587107_050506
1339 Ga0587114_014904
1340 Ga0587119_064382
1341 Ga0587071_025830
1342 Ga0501082_0621305

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9697 21 83
7pkt-assembly1.cif.gz_u large subunit of the chlamydomonas reinhardtii mitoribosome 0.949 21 85
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9231 18 84
8c94-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9155 18 84
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9129 21 83
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9697 21 83 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9129 21 83 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8846 29 82 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8543 29 82 2.40.50.100
af_O59821_2_44_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8389 29 82 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A432T7Q1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9955 25 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-K2DRZ8-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9905 22 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A328ESH9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.979 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A660TPI7-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.971 21 85 GO:0003735
GO:0006412
GO:0022625
AF-A0A432T7Q1-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9631 25 83 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map