F474104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 390 | 669 | 324 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0091814|Ga0395901_0091814_1092_2183 |
| Length | 363 |
| Sequence | VLFFFAIARVPTTTSGQKIADYPRFLQRWMYMKFRKIGVLLGGLSSERDVSLRTGEAVLEALRARGHEAVPIYVDHDVDIALRQEQIDVAFIALHGRWGEDGCIQGLLELQGIPYTGSDVMSSALAMHKGKAKELFRLHNLPTPAYYTLAPEDCADLPGVHGDFGFPCVVKPIREGSSVGVTICHTLDDLGPAVERAFAFDDEVLVERFISGKEISVAVLGDRALGAVEIAPREGFYDYQNKYTRGATDYFVPPRLSPERYRGVLAQALRAHIALGCHGATRVDMMVSESGNEYILEVNTVPGLTPTSLLPKIADAAGISFGELCELMLAGASLSSRRGRGERRVVQRTFVGEDRREPAPPAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2684623219 | Planctomyces sp. SH-PL14 | Isolate | Unclassified |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 8 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 111 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 178 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 181 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 182 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 186 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 187 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 203 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 205 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 206 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 211 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 212 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 215 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 216 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 217 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 218 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 228 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 231 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 232 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 235 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 269 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 270 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 271 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 272 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 273 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 274 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 275 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 276 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 277 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 278 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 279 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 305 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 306 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 307 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 308 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 309 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 310 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 311 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 312 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 313 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 314 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 315 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 316 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 317 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 318 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 319 | 3300049678 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought | Metagenome | Rhizosphere |
| 320 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 321 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 322 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 323 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 324 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 325 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 326 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 327 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 328 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 329 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 330 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 331 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 332 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 338 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 339 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 340 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 341 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 342 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 344 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 345 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 346 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 347 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 348 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 349 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 353 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 365 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 368 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 369 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 370 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 371 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 372 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 373 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 374 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 376 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 377 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 378 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 379 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 380 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 381 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 385 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 386 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 389 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 390 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.85 |
| Metatranscriptomes | 0 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.88 |
| Nodule | 0 |
| Rhizoplane | 0.6 |
| Rhizosphere | 91.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_13535307 | 2162886012 | Unclassified | 1268 |
| 2 | JGI24746J21847_1003444 | 3300001977 | Unclassified | 2490 |
| 3 | JGI24737J22298_10032482 | 3300001990 | Unclassified | 1625 |
| 4 | JGI24743J22301_10000044 | 3300001991 | Bacteria | 11132 |
| 5 | JGI24738J21930_10015755 | 3300002075 | Unclassified | 1603 |
| 6 | JGI24035J26624_1001644 | 3300002126 | Unclassified | 2102 |
| 7 | JGI24033J26618_1000066 | 3300002155 | Bacteria | 15346 |
| 8 | rootH2_10011145 | 3300003320 | Bacteria | 22144 |
| 9 | rootL2_10039822 | 3300003322 | Bacteria | 2025 |
| 10 | rootL2_10074460 | 3300003322 | Bacteria | 2868 |
| 11 | rootL2_10156277 | 3300003322 | Bacteria | 2243 |
| 12 | rootL2_10186783 | 3300003322 | Bacteria | 5939 |
| 13 | rootH1_10001752 | 3300003323 | Bacteria | 14969 |
| 14 | Ga0055530_10014664 | 3300003791 | Bacteria | 2598 |
| 15 | Ga0065707_10027286 | 3300005295 | Bacteria | 1901 |
| 16 | Ga0065707_10099442 | 3300005295 | Bacteria | 3006 |
| 17 | Ga0065707_10100377 | 3300005295 | Unclassified | 2933 |
| 18 | Ga0070658_10032927 | 3300005327 | Bacteria | 4168 |
| 19 | Ga0070676_10001419 | 3300005328 | Bacteria | 12100 |
| 20 | Ga0070676_10064494 | 3300005328 | Unclassified | 2184 |
| 21 | Ga0070690_100000348 | 3300005330 | Bacteria | 23853 |
| 22 | Ga0070690_100015663 | 3300005330 | Bacteria | 4529 |
| 23 | Ga0070690_100027931 | 3300005330 | Bacteria | 3492 |
| 24 | Ga0070690_100030630 | 3300005330 | Bacteria | 3345 |
| 25 | Ga0070670_100015844 | 3300005331 | Bacteria | 6469 |
| 26 | Ga0070670_100206980 | 3300005331 | Bacteria | 1705 |
| 27 | Ga0070677_10030097 | 3300005333 | Bacteria | 2064 |
| 28 | Ga0068869_100086837 | 3300005334 | Unclassified | 2346 |
| 29 | Ga0068869_100091429 | 3300005334 | Bacteria | 2289 |
| 30 | Ga0070666_10012329 | 3300005335 | Bacteria | 5389 |
| 31 | Ga0070680_100004415 | 3300005336 | Bacteria | 10586 |
| 32 | Ga0070680_100031682 | 3300005336 | Bacteria | 4252 |
| 33 | Ga0070680_100033394 | 3300005336 | Bacteria | 4147 |
| 34 | Ga0070682_100016500 | 3300005337 | Bacteria | 4294 |
| 35 | Ga0070682_100063363 | 3300005337 | Bacteria | 2344 |
| 36 | Ga0070682_100082376 | 3300005337 | Bacteria | 2085 |
| 37 | Ga0068868_100019130 | 3300005338 | Bacteria | 5129 |
| 38 | Ga0068868_100038099 | 3300005338 | Bacteria | 3731 |
| 39 | Ga0070660_100029788 | 3300005339 | Bacteria | 4092 |
| 40 | Ga0070689_100000090 | 3300005340 | Bacteria | 52338 |
| 41 | Ga0070689_100001519 | 3300005340 | Bacteria | 14805 |
| 42 | Ga0070689_100004336 | 3300005340 | Bacteria | 9572 |
| 43 | Ga0070689_100009358 | 3300005340 | Bacteria | 6943 |
| 44 | Ga0070689_100129152 | 3300005340 | Bacteria | 2025 |
| 45 | Ga0070687_100001354 | 3300005343 | Bacteria | 8602 |
| 46 | Ga0070687_100023969 | 3300005343 | Bacteria | 2906 |
| 47 | Ga0070687_100027515 | 3300005343 | Bacteria | 2748 |
| 48 | Ga0070661_100000479 | 3300005344 | Bacteria | 30510 |
| 49 | Ga0070661_100018849 | 3300005344 | Bacteria | 4912 |
| 50 | Ga0070692_10054249 | 3300005345 | Bacteria | 2092 |
| 51 | Ga0070668_100013058 | 3300005347 | Bacteria | 6187 |
| 52 | Ga0070668_100071182 | 3300005347 | Unclassified | 2709 |
| 53 | Ga0070668_100147751 | 3300005347 | Bacteria | 1898 |
| 54 | Ga0070669_100007357 | 3300005353 | Bacteria | 7896 |
| 55 | Ga0070669_100014808 | 3300005353 | Bacteria | 5553 |
| 56 | Ga0070675_100013175 | 3300005354 | Bacteria | 6497 |
| 57 | Ga0070675_100041338 | 3300005354 | Bacteria | 3766 |
| 58 | Ga0070675_100157950 | 3300005354 | Bacteria | 1948 |
| 59 | Ga0070671_100514142 | 3300005355 | Bacteria | 1031 |
| 60 | Ga0070674_100000394 | 3300005356 | Bacteria | 21894 |
| 61 | Ga0070673_100139017 | 3300005364 | Unclassified | 2047 |
| 62 | Ga0070688_100000135 | 3300005365 | Bacteria | 39766 |
| 63 | Ga0070688_100002702 | 3300005365 | Bacteria | 8996 |
| 64 | Ga0070688_100045669 | 3300005365 | Bacteria | 2708 |
| 65 | Ga0070688_100269889 | 3300005365 | Bacteria | 1218 |
| 66 | Ga0070659_100000985 | 3300005366 | Bacteria | 20906 |
| 67 | Ga0070659_100019927 | 3300005366 | Bacteria | 5091 |
| 68 | Ga0070667_100056590 | 3300005367 | Bacteria | 3313 |
| 69 | Ga0070710_10068984 | 3300005437 | Bacteria | 2033 |
| 70 | Ga0070701_10045184 | 3300005438 | Unclassified | 2259 |
| 71 | Ga0070701_10080414 | 3300005438 | Bacteria | 1763 |
| 72 | Ga0070705_100006180 | 3300005440 | Bacteria | 5865 |
| 73 | Ga0070705_100038236 | 3300005440 | Bacteria | 2713 |
| 74 | Ga0070705_100060010 | 3300005440 | Bacteria | 2254 |
| 75 | Ga0070700_100000257 | 3300005441 | Bacteria | 28570 |
| 76 | Ga0070700_100173444 | 3300005441 | Bacteria | 1495 |
| 77 | Ga0070694_100006125 | 3300005444 | Bacteria | 7296 |
| 78 | Ga0070694_100012346 | 3300005444 | Bacteria | 5307 |
| 79 | Ga0070694_100112811 | 3300005444 | Bacteria | 1939 |
| 80 | Ga0070694_100171004 | 3300005444 | Bacteria | 1601 |
| 81 | Ga0070708_100104158 | 3300005445 | Bacteria | 2602 |
| 82 | Ga0070663_100247157 | 3300005455 | Unclassified | 1411 |
| 83 | Ga0070678_100002606 | 3300005456 | Bacteria | 9915 |
| 84 | Ga0070678_100151009 | 3300005456 | Bacteria | 1871 |
| 85 | Ga0070662_100003227 | 3300005457 | Bacteria | 10137 |
| 86 | Ga0070681_10001753 | 3300005458 | Bacteria | 19441 |
| 87 | Ga0070681_10003614 | 3300005458 | Bacteria | 14505 |
| 88 | Ga0070681_10049211 | 3300005458 | Bacteria | 4210 |
| 89 | Ga0070681_10218431 | 3300005458 | Bacteria | 1822 |
| 90 | Ga0070681_10253915 | 3300005458 | Bacteria | 1670 |
| 91 | Ga0068867_100001546 | 3300005459 | Bacteria | 15988 |
| 92 | Ga0068867_100002470 | 3300005459 | Bacteria | 13001 |
| 93 | Ga0068867_100170770 | 3300005459 | Bacteria | 1722 |
| 94 | Ga0070685_10000073 | 3300005466 | Bacteria | 59457 |
| 95 | Ga0070685_10001193 | 3300005466 | Bacteria | 13886 |
| 96 | Ga0070685_10075920 | 3300005466 | Unclassified | 2003 |
| 97 | Ga0070706_100000878 | 3300005467 | Bacteria | 33009 |
| 98 | Ga0070706_100002645 | 3300005467 | Bacteria | 17929 |
| 99 | Ga0070706_100021603 | 3300005467 | Bacteria | 5926 |
| 100 | Ga0070706_100031624 | 3300005467 | Bacteria | 4880 |
| 101 | Ga0070707_100000018 | 3300005468 | Bacteria | 137542 |
| 102 | Ga0070707_100024642 | 3300005468 | Bacteria | 5700 |
| 103 | Ga0070707_100037631 | 3300005468 | Bacteria | 4618 |
| 104 | Ga0070707_100162323 | 3300005468 | Unclassified | 2177 |
| 105 | Ga0070707_100489467 | 3300005468 | Unclassified | 1191 |
| 106 | Ga0070698_100000114 | 3300005471 | Bacteria | 68309 |
| 107 | Ga0070698_100011560 | 3300005471 | Bacteria | 9365 |
| 108 | Ga0070698_100082096 | 3300005471 | Bacteria | 3216 |
| 109 | Ga0070698_100142901 | 3300005471 | Bacteria | 2344 |
| 110 | Ga0070698_100164837 | 3300005471 | Bacteria | 2159 |
| 111 | Ga0070698_100335125 | 3300005471 | Bacteria | 1444 |
| 112 | Ga0070699_100005710 | 3300005518 | Bacteria | 10898 |
| 113 | Ga0070699_100070201 | 3300005518 | Bacteria | 3045 |
| 114 | Ga0070699_100082524 | 3300005518 | Bacteria | 2802 |
| 115 | Ga0070679_100001459 | 3300005530 | Bacteria | 20941 |
| 116 | Ga0070679_100047591 | 3300005530 | Bacteria | 4273 |
| 117 | Ga0070684_100078633 | 3300005535 | Bacteria | 2914 |
| 118 | Ga0070684_100503871 | 3300005535 | Bacteria | 1121 |
| 119 | Ga0070697_100089572 | 3300005536 | Bacteria | 2542 |
| 120 | Ga0070697_100090641 | 3300005536 | Bacteria | 2527 |
| 121 | Ga0070672_100006069 | 3300005543 | Bacteria | 8075 |
| 122 | Ga0070686_100000089 | 3300005544 | Bacteria | 64287 |
| 123 | Ga0070686_100004655 | 3300005544 | Bacteria | 7568 |
| 124 | Ga0070686_100010699 | 3300005544 | Bacteria | 5185 |
| 125 | Ga0070695_100007325 | 3300005545 | Bacteria | 6540 |
| 126 | Ga0070695_100015463 | 3300005545 | Unclassified | 4609 |
| 127 | Ga0070695_100150832 | 3300005545 | Bacteria | 1622 |
| 128 | Ga0070695_100248110 | 3300005545 | Unclassified | 1294 |
| 129 | Ga0070696_100047305 | 3300005546 | Bacteria | 2985 |
| 130 | Ga0070693_100041818 | 3300005547 | Unclassified | 2580 |
| 131 | Ga0070665_100002307 | 3300005548 | Bacteria | 21174 |
| 132 | Ga0070704_100027484 | 3300005549 | Bacteria | 3775 |
| 133 | Ga0070704_100054340 | 3300005549 | Unclassified | 2834 |
| 134 | Ga0070704_100070773 | 3300005549 | Bacteria | 2532 |
| 135 | Ga0070704_100080429 | 3300005549 | Bacteria | 2397 |
| 136 | Ga0068855_100174913 | 3300005563 | Bacteria | 2430 |
| 137 | Ga0068855_100392142 | 3300005563 | Bacteria | 1523 |
| 138 | Ga0070664_100006608 | 3300005564 | Bacteria | 9349 |
| 139 | Ga0070664_100021093 | 3300005564 | Bacteria | 5367 |
| 140 | Ga0068857_100059905 | 3300005577 | Unclassified | 3383 |
| 141 | Ga0068856_100000537 | 3300005614 | Bacteria | 41817 |
| 142 | Ga0068856_100058687 | 3300005614 | Bacteria | 3801 |
| 143 | Ga0068856_100186254 | 3300005614 | Bacteria | 2090 |
| 144 | Ga0068859_100002892 | 3300005617 | Bacteria | 17446 |
| 145 | Ga0068859_100119805 | 3300005617 | Bacteria | 2698 |
| 146 | Ga0068859_100400751 | 3300005617 | Bacteria | 1468 |
| 147 | Ga0068864_100175150 | 3300005618 | Bacteria | 1958 |
| 148 | Ga0068866_10054688 | 3300005718 | Bacteria | 2046 |
| 149 | Ga0068861_100163883 | 3300005719 | Bacteria | 1836 |
| 150 | Ga0068861_100218688 | 3300005719 | Bacteria | 1609 |
| 151 | Ga0068861_100369053 | 3300005719 | Bacteria | 1264 |
| 152 | Ga0068858_100135974 | 3300005842 | Bacteria | 2306 |
| 153 | Ga0068860_100017638 | 3300005843 | Bacteria | 6955 |
| 154 | Ga0068860_100245921 | 3300005843 | Unclassified | 1741 |
| 155 | Ga0068862_100007910 | 3300005844 | Bacteria | 8794 |
| 156 | Ga0068862_100021260 | 3300005844 | Bacteria | 5423 |
| 157 | Ga0068862_100164946 | 3300005844 | Bacteria | 1980 |
| 158 | Ga0068862_100347006 | 3300005844 | Bacteria | 1376 |
| 159 | Ga0081455_10000594 | 3300005937 | Bacteria | 46883 |
| 160 | Ga0070717_10024090 | 3300006028 | Bacteria | 4830 |
| 161 | Ga0075432_10001979 | 3300006058 | Bacteria | 6811 |
| 162 | Ga0070715_10035796 | 3300006163 | Bacteria | 2044 |
| 163 | Ga0097621_100009427 | 3300006237 | Bacteria | 7083 |
| 164 | Ga0097621_100037112 | 3300006237 | Bacteria | 3902 |
| 165 | Ga0068871_100005816 | 3300006358 | Bacteria | 8666 |
| 166 | Ga0068871_100110325 | 3300006358 | Unclassified | 2313 |
| 167 | Ga0075428_100256170 | 3300006844 | Bacteria | 1885 |
| 168 | Ga0075428_100295348 | 3300006844 | Unclassified | 1742 |
| 169 | Ga0075430_100001325 | 3300006846 | Bacteria | 19981 |
| 170 | Ga0075430_100001910 | 3300006846 | Bacteria | 17094 |
| 171 | Ga0075431_100003065 | 3300006847 | Bacteria | 16180 |
| 172 | Ga0075433_10002999 | 3300006852 | Bacteria | 12967 |
| 173 | Ga0075433_10076304 | 3300006852 | Bacteria | 2951 |
| 174 | Ga0075433_10111981 | 3300006852 | Unclassified | 2421 |
| 175 | Ga0075433_10214902 | 3300006852 | Bacteria | 1709 |
| 176 | Ga0075434_100050376 | 3300006871 | Unclassified | 4137 |
| 177 | Ga0075434_100119547 | 3300006871 | Bacteria | 2649 |
| 178 | Ga0075434_100141571 | 3300006871 | Unclassified | 2425 |
| 179 | Ga0075434_100473178 | 3300006871 | Bacteria | 1274 |
| 180 | Ga0075429_100001252 | 3300006880 | Bacteria | 20630 |
| 181 | Ga0075429_100005851 | 3300006880 | Bacteria | 10609 |
| 182 | Ga0075429_100082207 | 3300006880 | Bacteria | 2807 |
| 183 | Ga0075429_100098362 | 3300006880 | Unclassified | 2553 |
| 184 | Ga0075429_100144221 | 3300006880 | Unclassified | 2084 |
| 185 | Ga0068865_100004478 | 3300006881 | Bacteria | 8429 |
| 186 | Ga0068865_100010331 | 3300006881 | Bacteria | 5807 |
| 187 | Ga0075436_100149379 | 3300006914 | Bacteria | 1644 |
| 188 | Ga0097620_100002892 | 3300006931 | Bacteria | 17446 |
| 189 | Ga0097620_100119801 | 3300006931 | Bacteria | 2698 |
| 190 | Ga0097620_100400764 | 3300006931 | Bacteria | 1468 |
| 191 | Ga0075435_100045650 | 3300007076 | Bacteria | 3513 |
| 192 | Ga0075435_100097970 | 3300007076 | Bacteria | 2427 |
| 193 | Ga0111539_10007846 | 3300009094 | Bacteria | 13632 |
| 194 | Ga0111539_10012258 | 3300009094 | Bacteria | 10751 |
| 195 | Ga0111539_10260481 | 3300009094 | Bacteria | 2019 |
| 196 | Ga0111539_10497852 | 3300009094 | Bacteria | 1419 |
| 197 | Ga0105245_10000099 | 3300009098 | Bacteria | 83865 |
| 198 | Ga0105245_10029838 | 3300009098 | Bacteria | 4821 |
| 199 | Ga0105245_10118545 | 3300009098 | Unclassified | 2470 |
| 200 | Ga0105245_10252055 | 3300009098 | Bacteria | 1715 |
| 201 | Ga0114129_10023328 | 3300009147 | Bacteria | 8777 |
| 202 | Ga0114129_10067741 | 3300009147 | Bacteria | 4977 |
| 203 | Ga0114129_10106309 | 3300009147 | Bacteria | 3877 |
| 204 | Ga0114129_10126336 | 3300009147 | Bacteria | 3516 |
| 205 | Ga0114129_10279486 | 3300009147 | Bacteria | 2231 |
| 206 | Ga0105243_10004891 | 3300009148 | Bacteria | 10511 |
| 207 | Ga0105241_10040792 | 3300009174 | Bacteria | 3505 |
| 208 | Ga0105242_10013265 | 3300009176 | Bacteria | 6363 |
| 209 | Ga0105242_10045229 | 3300009176 | Bacteria | 3567 |
| 210 | Ga0105242_10087944 | 3300009176 | Unclassified | 2609 |
| 211 | Ga0105248_10000908 | 3300009177 | Bacteria | 33049 |
| 212 | Ga0105249_10007377 | 3300009553 | Bacteria | 9591 |
| 213 | Ga0105249_10048253 | 3300009553 | Bacteria | 3882 |
| 214 | Ga0105249_10148930 | 3300009553 | Bacteria | 2251 |
| 215 | Ga0105239_10001416 | 3300010375 | Bacteria | 31991 |
| 216 | Ga0105239_10005383 | 3300010375 | Bacteria | 15034 |
| 217 | Ga0105239_10022606 | 3300010375 | Bacteria | 6933 |
| 218 | Ga0105239_10231783 | 3300010375 | Bacteria | 2072 |
| 219 | Ga0105246_10000200 | 3300011119 | Bacteria | 30052 |
| 220 | Ga0105246_10110679 | 3300011119 | Unclassified | 2017 |
| 221 | Ga0157369_10036432 | 3300013105 | Bacteria | 5389 |
| 222 | Ga0157374_10011253 | 3300013296 | Bacteria | 7740 |
| 223 | Ga0157374_10036693 | 3300013296 | Bacteria | 4492 |
| 224 | Ga0157374_10128846 | 3300013296 | Unclassified | 2447 |
| 225 | Ga0157374_10189801 | 3300013296 | Bacteria | 2010 |
| 226 | Ga0157378_10000857 | 3300013297 | Bacteria | 28196 |
| 227 | Ga0157378_10011945 | 3300013297 | Bacteria | 7603 |
| 228 | Ga0157378_10013383 | 3300013297 | Bacteria | 7170 |
| 229 | Ga0163162_10005848 | 3300013306 | Bacteria | 11898 |
| 230 | Ga0163162_10192709 | 3300013306 | Bacteria | 2166 |
| 231 | Ga0157375_10002941 | 3300013308 | Bacteria | 14773 |
| 232 | Ga0157375_10103480 | 3300013308 | Bacteria | 2934 |
| 233 | Ga0157375_10189802 | 3300013308 | Bacteria | 2209 |
| 234 | Ga0163163_10199296 | 3300014325 | Bacteria | 2050 |
| 235 | Ga0157380_10014684 | 3300014326 | Bacteria | 5735 |
| 236 | Ga0157380_10240263 | 3300014326 | Bacteria | 1632 |
| 237 | Ga0157377_10019343 | 3300014745 | Bacteria | 3557 |
| 238 | Ga0157376_10003733 | 3300014969 | Bacteria | 10522 |
| 239 | Ga0157376_10055439 | 3300014969 | Bacteria | 3307 |
| 240 | Ga0157376_10192628 | 3300014969 | Bacteria | 1870 |
| 241 | Ga0213876_10028194 | 3300021384 | Bacteria | 2959 |
| 242 | Ga0209050_1000908 | 3300025298 | Bacteria | 39172 |
| 243 | Ga0207697_10000198 | 3300025315 | Bacteria | 32108 |
| 244 | Ga0207642_10037612 | 3300025899 | Bacteria | 2087 |
| 245 | Ga0207688_10003742 | 3300025901 | Bacteria | 8302 |
| 246 | Ga0207688_10004420 | 3300025901 | Bacteria | 7651 |
| 247 | Ga0207699_10151304 | 3300025906 | Bacteria | 1536 |
| 248 | Ga0207645_10000634 | 3300025907 | Bacteria | 29170 |
| 249 | Ga0207645_10001133 | 3300025907 | Bacteria | 22060 |
| 250 | Ga0207705_10110184 | 3300025909 | Bacteria | 2034 |
| 251 | Ga0207684_10000198 | 3300025910 | Bacteria | 95038 |
| 252 | Ga0207654_10034950 | 3300025911 | Bacteria | 2796 |
| 253 | Ga0207707_10010179 | 3300025912 | Bacteria | 8161 |
| 254 | Ga0207707_10269655 | 3300025912 | Bacteria | 1475 |
| 255 | Ga0207660_10012261 | 3300025917 | Bacteria | 5603 |
| 256 | Ga0207660_10014792 | 3300025917 | Bacteria | 5142 |
| 257 | Ga0207660_10125724 | 3300025917 | Bacteria | 1947 |
| 258 | Ga0207662_10007367 | 3300025918 | Bacteria | 5987 |
| 259 | Ga0207662_10025917 | 3300025918 | Bacteria | 3379 |
| 260 | Ga0207662_10280271 | 3300025918 | Bacteria | 1103 |
| 261 | Ga0207657_10005985 | 3300025919 | Bacteria | 12658 |
| 262 | Ga0207649_10000427 | 3300025920 | Bacteria | 30819 |
| 263 | Ga0207649_10116466 | 3300025920 | Unclassified | 1794 |
| 264 | Ga0207652_10017078 | 3300025921 | Bacteria | 5936 |
| 265 | Ga0207652_10126027 | 3300025921 | Bacteria | 2281 |
| 266 | Ga0207652_10219239 | 3300025921 | Bacteria | 1714 |
| 267 | Ga0207646_10000072 | 3300025922 | Bacteria | 141756 |
| 268 | Ga0207646_10043660 | 3300025922 | Bacteria | 4025 |
| 269 | Ga0207681_10001480 | 3300025923 | Bacteria | 15139 |
| 270 | Ga0207650_10118955 | 3300025925 | Unclassified | 2054 |
| 271 | Ga0207650_10277150 | 3300025925 | Bacteria | 1365 |
| 272 | Ga0207659_10027546 | 3300025926 | Bacteria | 3849 |
| 273 | Ga0207659_10084688 | 3300025926 | Unclassified | 2353 |
| 274 | Ga0207659_10168936 | 3300025926 | Bacteria | 1724 |
| 275 | Ga0207687_10000774 | 3300025927 | Bacteria | 21584 |
| 276 | Ga0207687_10136843 | 3300025927 | Bacteria | 1853 |
| 277 | Ga0207690_10054181 | 3300025932 | Bacteria | 2695 |
| 278 | Ga0207706_10000702 | 3300025933 | Bacteria | 35016 |
| 279 | Ga0207706_10003909 | 3300025933 | Bacteria | 14140 |
| 280 | Ga0207686_10005846 | 3300025934 | Bacteria | 6601 |
| 281 | Ga0207670_10000032 | 3300025936 | Bacteria | 112426 |
| 282 | Ga0207670_10000177 | 3300025936 | Bacteria | 42462 |
| 283 | Ga0207670_10104866 | 3300025936 | Bacteria | 2026 |
| 284 | Ga0207669_10035894 | 3300025937 | Bacteria | 2826 |
| 285 | Ga0207669_10287622 | 3300025937 | Bacteria | 1243 |
| 286 | Ga0207704_10011387 | 3300025938 | Bacteria | 4377 |
| 287 | Ga0207704_10111776 | 3300025938 | Bacteria | 1848 |
| 288 | Ga0207665_10060502 | 3300025939 | Bacteria | 2565 |
| 289 | Ga0207665_10064074 | 3300025939 | Bacteria | 2497 |
| 290 | Ga0207691_10000182 | 3300025940 | Bacteria | 59433 |
| 291 | Ga0207711_10001788 | 3300025941 | Bacteria | 19690 |
| 292 | Ga0207689_10072905 | 3300025942 | Bacteria | 2821 |
| 293 | Ga0207689_10283640 | 3300025942 | Bacteria | 1371 |
| 294 | Ga0207689_10325226 | 3300025942 | Bacteria | 1276 |
| 295 | Ga0207661_10025410 | 3300025944 | Bacteria | 4502 |
| 296 | Ga0207661_10032917 | 3300025944 | Bacteria | 4021 |
| 297 | Ga0207679_10004180 | 3300025945 | Bacteria | 8971 |
| 298 | Ga0207651_10116819 | 3300025960 | Unclassified | 2014 |
| 299 | Ga0207651_10225689 | 3300025960 | Bacteria | 1517 |
| 300 | Ga0207712_10052076 | 3300025961 | Bacteria | 2866 |
| 301 | Ga0207712_10053359 | 3300025961 | Bacteria | 2835 |
| 302 | Ga0207668_10006913 | 3300025972 | Bacteria | 6731 |
| 303 | Ga0207668_10122064 | 3300025972 | Unclassified | 1974 |
| 304 | Ga0207658_10008718 | 3300025986 | Bacteria | 6889 |
| 305 | Ga0207703_10151607 | 3300026035 | Unclassified | 2022 |
| 306 | Ga0207708_10000291 | 3300026075 | Bacteria | 39366 |
| 307 | Ga0207708_10000413 | 3300026075 | Bacteria | 33516 |
| 308 | Ga0207708_10151599 | 3300026075 | Bacteria | 1825 |
| 309 | Ga0207702_10003806 | 3300026078 | Bacteria | 13620 |
| 310 | Ga0207702_10150471 | 3300026078 | Bacteria | 2117 |
| 311 | Ga0207702_10208654 | 3300026078 | Bacteria | 1815 |
| 312 | Ga0207641_10127302 | 3300026088 | Bacteria | 2282 |
| 313 | Ga0207648_10000101 | 3300026089 | Bacteria | 82654 |
| 314 | Ga0207648_10085747 | 3300026089 | Bacteria | 2747 |
| 315 | Ga0207676_10061252 | 3300026095 | Bacteria | 2979 |
| 316 | Ga0207676_10340249 | 3300026095 | Bacteria | 1384 |
| 317 | Ga0207674_10004318 | 3300026116 | Bacteria | 17135 |
| 318 | Ga0207674_10313947 | 3300026116 | Bacteria | 1517 |
| 319 | Ga0207675_100074130 | 3300026118 | Bacteria | 3185 |
| 320 | Ga0207675_100134666 | 3300026118 | Bacteria | 2343 |
| 321 | Ga0207675_100200856 | 3300026118 | Bacteria | 1915 |
| 322 | Ga0207683_10000229 | 3300026121 | Bacteria | 49529 |
| 323 | Ga0207683_10028708 | 3300026121 | Bacteria | 4812 |
| 324 | Ga0209973_1000239 | 3300027252 | Unclassified | 3754 |
| 325 | Ga0209969_1002389 | 3300027360 | Bacteria | 2596 |
| 326 | Ga0209967_1000547 | 3300027364 | Bacteria | 4941 |
| 327 | Ga0209981_1002105 | 3300027378 | Unclassified | 2535 |
| 328 | Ga0209984_1000006 | 3300027424 | Bacteria | 23947 |
| 329 | Ga0210000_1000032 | 3300027462 | Bacteria | 21476 |
| 330 | Ga0209982_1000705 | 3300027552 | Unclassified | 4261 |
| 331 | Ga0209970_1006254 | 3300027614 | Bacteria | 1950 |
| 332 | Ga0209970_1007538 | 3300027614 | Unclassified | 1784 |
| 333 | Ga0210002_1000061 | 3300027617 | Bacteria | 16870 |
| 334 | Ga0209983_1000874 | 3300027665 | Bacteria | 6639 |
| 335 | Ga0209971_1000642 | 3300027682 | Bacteria | 9100 |
| 336 | Ga0209966_1000016 | 3300027695 | Bacteria | 73256 |
| 337 | Ga0209998_10000021 | 3300027717 | Bacteria | 70520 |
| 338 | Ga0209998_10019074 | 3300027717 | Bacteria | 1460 |
| 339 | Ga0209974_10000003 | 3300027876 | Bacteria | 65938 |
| 340 | Ga0209974_10000265 | 3300027876 | Bacteria | 16988 |
| 341 | Ga0207428_10001120 | 3300027907 | Bacteria | 29155 |
| 342 | Ga0207428_10006333 | 3300027907 | Bacteria | 10944 |
| 343 | Ga0268266_10044738 | 3300028379 | Bacteria | 3785 |
| 344 | Ga0268265_10013370 | 3300028380 | Bacteria | 5577 |
| 345 | Ga0268265_10028020 | 3300028380 | Bacteria | 4029 |
| 346 | Ga0268265_10311647 | 3300028380 | Bacteria | 1421 |
| 347 | Ga0268264_10398558 | 3300028381 | Bacteria | 1322 |
| 348 | Ga0265326_10005513 | 3300028558 | Bacteria | 3990 |
| 349 | Ga0307517_10031500 | 3300028786 | Bacteria | 6169 |
| 350 | Ga0307515_10015000 | 3300028794 | Bacteria | 14315 |
| 351 | Ga0265338_10030516 | 3300028800 | Bacteria | 5309 |
| 352 | Ga0265338_10087690 | 3300028800 | Bacteria | 2584 |
| 353 | Ga0265338_10203924 | 3300028800 | Bacteria | 1489 |
| 354 | Ga0265332_10020875 | 3300031238 | Bacteria | 2893 |
| 355 | Ga0265320_10083479 | 3300031240 | Bacteria | 1489 |
| 356 | Ga0265339_10020303 | 3300031249 | Unclassified | 3883 |
| 357 | Ga0265316_10000230 | 3300031344 | Bacteria | 64801 |
| 358 | Ga0265316_10001169 | 3300031344 | Bacteria | 28394 |
| 359 | Ga0307513_10010635 | 3300031456 | Bacteria | 11512 |
| 360 | Ga0307513_10186517 | 3300031456 | Bacteria | 1931 |
| 361 | Ga0307509_10000007 | 3300031507 | Bacteria | 409278 |
| 362 | Ga0307509_10010793 | 3300031507 | Bacteria | 11136 |
| 363 | Ga0307509_10100579 | 3300031507 | Bacteria | 2929 |
| 364 | Ga0307509_10128720 | 3300031507 | Bacteria | 2492 |
| 365 | Ga0307509_10136421 | 3300031507 | Bacteria | 2398 |
| 366 | Ga0307408_100038453 | 3300031548 | Bacteria | 3376 |
| 367 | Ga0316579_10003565 | 3300031691 | Bacteria | 6099 |
| 368 | Ga0265342_10000265 | 3300031712 | Bacteria | 58679 |
| 369 | Ga0265342_10031378 | 3300031712 | Bacteria | 3285 |
| 370 | Ga0316576_10000591 | 3300031727 | Bacteria | 17316 |
| 371 | Ga0316576_10011115 | 3300031727 | Bacteria | 5881 |
| 372 | Ga0307516_10013815 | 3300031730 | Bacteria | 8574 |
| 373 | Ga0307516_10114082 | 3300031730 | Bacteria | 2499 |
| 374 | Ga0307405_10010594 | 3300031731 | Bacteria | 4790 |
| 375 | Ga0307413_10017077 | 3300031824 | Bacteria | 3771 |
| 376 | Ga0307410_10050917 | 3300031852 | Bacteria | 2788 |
| 377 | Ga0307406_10003927 | 3300031901 | Bacteria | 8080 |
| 378 | Ga0307406_10052376 | 3300031901 | Bacteria | 2595 |
| 379 | Ga0307407_10005289 | 3300031903 | Bacteria | 5582 |
| 380 | Ga0307412_10000625 | 3300031911 | Bacteria | 20667 |
| 381 | Ga0307409_100124325 | 3300031995 | Bacteria | 2191 |
| 382 | Ga0307416_100294136 | 3300032002 | Bacteria | 1609 |
| 383 | Ga0307414_10009229 | 3300032004 | Bacteria | 5654 |
| 384 | Ga0307411_10008204 | 3300032005 | Bacteria | 5391 |
| 385 | Ga0307415_100060451 | 3300032126 | Unclassified | 2618 |
| 386 | Ga0307415_100115272 | 3300032126 | Bacteria | 2002 |
| 387 | Ga0307415_100131256 | 3300032126 | Bacteria | 1897 |
| 388 | Ga0373934_0000962 | 3300035086 | Bacteria | 10441 |
| 389 | Ga0373934_0059328 | 3300035086 | Unclassified | 1523 |
| 390 | Ga0373940_0035055 | 3300035088 | Unclassified | 1357 |
| 391 | Ga0373949_0001386 | 3300035090 | Bacteria | 6967 |
| 392 | Ga0373923_0020394 | 3300035111 | Bacteria | 2575 |
| 393 | Ga0373936_0000035 | 3300035113 | Bacteria | 108166 |
| 394 | Ga0373936_0085388 | 3300035113 | Unclassified | 1318 |
| 395 | Ga0373941_0015901 | 3300035115 | Bacteria | 2037 |
| 396 | Ga0373956_0059763 | 3300035119 | Bacteria | 1725 |
| 397 | Ga0373957_0009657 | 3300035120 | Bacteria | 3162 |
| 398 | Ga0373955_0008648 | 3300035172 | Bacteria | 4737 |
| 399 | Ga0373961_0000020 | 3300035241 | Bacteria | 100658 |
| 400 | Ga0316574_0072511 | 3300035398 | Bacteria | 2176 |
| 401 | Ga0373924_0027753 | 3300035410 | Bacteria | 2252 |
| 402 | Ga0373931_0040788 | 3300035691 | Bacteria | 2437 |
| 403 | Ga0373935_0012043 | 3300035692 | Bacteria | 5199 |
| 404 | Ga0373933_0004953 | 3300035724 | Bacteria | 7261 |
| 405 | Ga0373933_0007058 | 3300035724 | Bacteria | 6121 |
| 406 | Ga0373933_0069486 | 3300035724 | Bacteria | 2141 |
| 407 | Ga0373947_0016709 | 3300035725 | Bacteria | 4216 |
| 408 | Ga0373937_0031486 | 3300036401 | Bacteria | 4807 |
| 409 | Ga0373937_0040042 | 3300036401 | Bacteria | 4271 |
| 410 | Ga0373937_0079996 | 3300036401 | Bacteria | 3021 |
| 411 | Ga0316582_0075916 | 3300036647 | Bacteria | 2184 |
| 412 | Ga0316582_0218205 | 3300036647 | Bacteria | 1304 |
| 413 | Ga0316584_0000325 | 3300036712 | Bacteria | 24471 |
| 414 | Ga0316584_0091412 | 3300036712 | Bacteria | 2279 |
| 415 | Ga0373925_0070936 | 3300037068 | Bacteria | 2634 |
| 416 | Ga0373925_0154412 | 3300037068 | Bacteria | 1805 |
| 417 | Ga0395899_0000015 | 3300037312 | Bacteria | 470061 |
| 418 | Ga0395899_0004859 | 3300037312 | Bacteria | 10469 |
| 419 | Ga0395900_0044586 | 3300037418 | Bacteria | 4568 |
| 420 | Ga0395898_0000051 | 3300037466 | Bacteria | 281872 |
| 421 | Ga0395898_0139593 | 3300037466 | Bacteria | 2320 |
| 422 | Ga0316581_0073691 | 3300037588 | Bacteria | 1049 |
| 423 | Ga0395901_0091814 | 3300038443 | Bacteria | 3178 |
| 424 | Ga0400483_005312 | 3300039062 | Bacteria | 2420 |
| 425 | Ga0400483_224315 | 3300039062 | Bacteria | 8658 |
| 426 | Ga0436365_0014080 | 3300039437 | Bacteria | 1413 |
| 427 | Ga0439439_0015824 | 3300041406 | Bacteria | 1844 |
| 428 | Ga0439461_0037611 | 3300041410 | Bacteria | 1034 |
| 429 | Ga0439466_0017981 | 3300041411 | Bacteria | 2540 |
| 430 | Ga0439450_042759 | 3300042008 | Bacteria | 1057 |
| 431 | Ga0439452_004979 | 3300042010 | Bacteria | 4350 |
| 432 | Ga0451577_0053435 | 3300042876 | Bacteria | 3606 |
| 433 | Ga0451577_0180898 | 3300042876 | Unclassified | 1901 |
| 434 | Ga0451577_0223564 | 3300042876 | Bacteria | 1702 |
| 435 | Ga0451577_0521500 | 3300042876 | Unclassified | 1079 |
| 436 | Ga0466965_0007338 | 3300044683 | Bacteria | 5056 |
| 437 | Ga0453684_0331514 | 3300044712 | Bacteria | 1721 |
| 438 | Ga0466971_0000025 | 3300044719 | Bacteria | 62833 |
| 439 | Ga0451576_0001765 | 3300045051 | Bacteria | 35474 |
| 440 | Ga0451576_0019910 | 3300045051 | Bacteria | 7315 |
| 441 | Ga0451576_0093757 | 3300045051 | Bacteria | 3121 |
| 442 | Ga0451576_0713558 | 3300045051 | Bacteria | 1053 |
| 443 | Ga0466967_0220246 | 3300045976 | Bacteria | 1803 |
| 444 | Ga0495592_0005931 | 3300046454 | Bacteria | 9069 |
| 445 | Ga0495603_0079418 | 3300046455 | Bacteria | 1923 |
| 446 | Ga0495629_0013291 | 3300046459 | Bacteria | 5941 |
| 447 | Ga0495653_0062353 | 3300046463 | Bacteria | 2817 |
| 448 | Ga0495580_0115243 | 3300046472 | Bacteria | 1867 |
| 449 | Ga0495594_0002228 | 3300046499 | Bacteria | 10084 |
| 450 | Ga0495594_0025000 | 3300046499 | Bacteria | 3209 |
| 451 | Ga0495608_0012150 | 3300046511 | Bacteria | 5984 |
| 452 | Ga0495628_0007531 | 3300046516 | Bacteria | 9414 |
| 453 | Ga0495628_0216051 | 3300046516 | Bacteria | 1441 |
| 454 | Ga0495630_0444302 | 3300046517 | Bacteria | 994 |
| 455 | Ga0495632_0066854 | 3300046519 | Bacteria | 1734 |
| 456 | Ga0495637_0036110 | 3300046520 | Unclassified | 2155 |
| 457 | Ga0495652_0158488 | 3300046529 | Bacteria | 1760 |
| 458 | Ga0495587_0006735 | 3300046536 | Bacteria | 7481 |
| 459 | Ga0495587_0084415 | 3300046536 | Unclassified | 1839 |
| 460 | Ga0495667_0014196 | 3300046559 | Bacteria | 5378 |
| 461 | Ga0495635_0098788 | 3300046663 | Bacteria | 1995 |
| 462 | Ga0495635_0152579 | 3300046663 | Unclassified | 1573 |
| 463 | Ga0495659_0013982 | 3300046664 | Unclassified | 2620 |
| 464 | Ga0495657_0016534 | 3300046675 | Bacteria | 5375 |
| 465 | Ga0495657_0029598 | 3300046675 | Bacteria | 3839 |
| 466 | Ga0495658_0105600 | 3300046683 | Bacteria | 1687 |
| 467 | Ga0495670_0091914 | 3300046691 | Bacteria | 1554 |
| 468 | Ga0495581_0062198 | 3300047315 | Bacteria | 2157 |
| 469 | Ga0495604_0066471 | 3300047317 | Bacteria | 2742 |
| 470 | Ga0495604_0138540 | 3300047317 | Bacteria | 1741 |
| 471 | Ga0495676_0305523 | 3300047321 | Unclassified | 1072 |
| 472 | Ga0495680_0233916 | 3300047322 | Unclassified | 1307 |
| 473 | Ga0495675_0005566 | 3300047444 | Bacteria | 7686 |
| 474 | Ga0495686_0025513 | 3300047472 | Bacteria | 3873 |
| 475 | Ga0495602_0059350 | 3300048088 | Bacteria | 3340 |
| 476 | Ga0496102_0527918 | 3300048905 | Bacteria | 1103 |
| 477 | Ga0496108_0246796 | 3300048911 | Bacteria | 1553 |
| 478 | Ga0496115_0018467 | 3300048918 | Bacteria | 5354 |
| 479 | Ga0496115_0098672 | 3300048918 | Bacteria | 2393 |
| 480 | Ga0496125_0001254 | 3300048928 | Bacteria | 37859 |
| 481 | Ga0496125_0047635 | 3300048928 | Bacteria | 3581 |
| 482 | Ga0501290_000039 | 3300049513 | Bacteria | 16974 |
| 483 | Ga0501291_000019 | 3300049514 | Bacteria | 22541 |
| 484 | Ga0501292_000403 | 3300049515 | Bacteria | 5740 |
| 485 | Ga0501294_001525 | 3300049517 | Unclassified | 2317 |
| 486 | Ga0501295_000011 | 3300049518 | Bacteria | 23617 |
| 487 | Ga0501296_000029 | 3300049519 | Bacteria | 16252 |
| 488 | Ga0501296_006766 | 3300049519 | Unclassified | 1306 |
| 489 | Ga0501297_000006 | 3300049520 | Bacteria | 21954 |
| 490 | Ga0501298_000012 | 3300049521 | Bacteria | 19378 |
| 491 | Ga0501299_000715 | 3300049522 | Bacteria | 3988 |
| 492 | Ga0501300_000483 | 3300049523 | Bacteria | 5989 |
| 493 | Ga0501301_000228 | 3300049524 | Bacteria | 3249 |
| 494 | Ga0501303_000138 | 3300049526 | Bacteria | 6311 |
| 495 | Ga0501031_0002149 | 3300049568 | Bacteria | 12433 |
| 496 | Ga0501031_0013859 | 3300049568 | Bacteria | 5253 |
| 497 | Ga0501032_0000504 | 3300049569 | Bacteria | 31645 |
| 498 | Ga0501033_0000003 | 3300049570 | Bacteria | 586973 |
| 499 | Ga0501033_0000083 | 3300049570 | Bacteria | 89452 |
| 500 | Ga0501036_0036576 | 3300049572 | Bacteria | 4155 |
| 501 | Ga0501036_0053721 | 3300049572 | Bacteria | 3411 |
| 502 | Ga0501036_0101804 | 3300049572 | Bacteria | 2430 |
| 503 | Ga0501037_0000083 | 3300049573 | Bacteria | 86322 |
| 504 | Ga0501037_0013052 | 3300049573 | Bacteria | 6125 |
| 505 | Ga0501037_0042163 | 3300049573 | Bacteria | 3354 |
| 506 | Ga0501037_0097604 | 3300049573 | Unclassified | 2123 |
| 507 | Ga0501038_0000329 | 3300049574 | Bacteria | 40955 |
| 508 | Ga0501038_0006687 | 3300049574 | Bacteria | 10655 |
| 509 | Ga0501038_0022409 | 3300049574 | Bacteria | 5661 |
| 510 | Ga0501038_0032868 | 3300049574 | Bacteria | 4572 |
| 511 | Ga0501038_0039168 | 3300049574 | Bacteria | 4147 |
| 512 | Ga0501038_0110342 | 3300049574 | Bacteria | 2279 |
| 513 | Ga0501039_0002225 | 3300049575 | Bacteria | 14350 |
| 514 | Ga0501039_0002998 | 3300049575 | Bacteria | 12619 |
| 515 | Ga0501039_0013028 | 3300049575 | Bacteria | 6356 |
| 516 | Ga0501039_0030652 | 3300049575 | Bacteria | 4148 |
| 517 | Ga0501039_0431830 | 3300049575 | Bacteria | 1034 |
| 518 | Ga0501039_0501618 | 3300049575 | Bacteria | 953 |
| 519 | Ga0501040_0076133 | 3300049576 | Unclassified | 2320 |
| 520 | Ga0501041_0003147 | 3300049577 | Bacteria | 9494 |
| 521 | Ga0501041_0005224 | 3300049577 | Bacteria | 7582 |
| 522 | Ga0501041_0073022 | 3300049577 | Bacteria | 2108 |
| 523 | Ga0501042_0001893 | 3300049578 | Bacteria | 12585 |
| 524 | Ga0501042_0055737 | 3300049578 | Bacteria | 2821 |
| 525 | Ga0501043_0002418 | 3300049579 | Bacteria | 15801 |
| 526 | Ga0501043_0017594 | 3300049579 | Bacteria | 5604 |
| 527 | Ga0501043_0073429 | 3300049579 | Bacteria | 2687 |
| 528 | Ga0501046_0007844 | 3300049580 | Bacteria | 9366 |
| 529 | Ga0501046_0014946 | 3300049580 | Bacteria | 6531 |
| 530 | Ga0501047_0002692 | 3300049581 | Bacteria | 16920 |
| 531 | Ga0501047_0095852 | 3300049581 | Bacteria | 2845 |
| 532 | Ga0501047_0143491 | 3300049581 | Bacteria | 2265 |
| 533 | Ga0501048_0002213 | 3300049582 | Bacteria | 14809 |
| 534 | Ga0501067_0026740 | 3300049583 | Bacteria | 3195 |
| 535 | Ga0501067_0065861 | 3300049583 | Bacteria | 2006 |
| 536 | Ga0501068_0087011 | 3300049584 | Bacteria | 1924 |
| 537 | Ga0501069_0018643 | 3300049585 | Bacteria | 3747 |
| 538 | Ga0501070_0005200 | 3300049586 | Bacteria | 11088 |
| 539 | Ga0501070_0023242 | 3300049586 | Bacteria | 5193 |
| 540 | Ga0501070_0041974 | 3300049586 | Bacteria | 3809 |
| 541 | Ga0501070_0078064 | 3300049586 | Bacteria | 2740 |
| 542 | Ga0501070_0122961 | 3300049586 | Bacteria | 2145 |
| 543 | Ga0501070_0139358 | 3300049586 | Bacteria | 2003 |
| 544 | Ga0501071_0004046 | 3300049587 | Bacteria | 9263 |
| 545 | Ga0501071_0165052 | 3300049587 | Bacteria | 1657 |
| 546 | Ga0501073_0038848 | 3300049589 | Bacteria | 3375 |
| 547 | Ga0501073_0108362 | 3300049589 | Bacteria | 1928 |
| 548 | Ga0501074_0155538 | 3300049590 | Bacteria | 1633 |
| 549 | Ga0501075_0017241 | 3300049591 | Bacteria | 5215 |
| 550 | Ga0501076_0147192 | 3300049592 | Unclassified | 1915 |
| 551 | Ga0501076_0163347 | 3300049592 | Bacteria | 1815 |
| 552 | Ga0501077_0079742 | 3300049593 | Unclassified | 2074 |
| 553 | Ga0501198_002606 | 3300049649 | Bacteria | 2435 |
| 554 | Ga0501199_000121 | 3300049650 | Bacteria | 5901 |
| 555 | Ga0501207_000226 | 3300049654 | Bacteria | 5715 |
| 556 | Ga0501208_000359 | 3300049655 | Bacteria | 3486 |
| 557 | Ga0501209_069411 | 3300049656 | Bacteria | 1000 |
| 558 | Ga0501216_000387 | 3300049660 | Bacteria | 5121 |
| 559 | Ga0501217_001318 | 3300049661 | Bacteria | 4614 |
| 560 | Ga0501227_004929 | 3300049665 | Unclassified | 2863 |
| 561 | Ga0501228_000244 | 3300049666 | Bacteria | 3261 |
| 562 | Ga0501230_007885 | 3300049667 | Bacteria | 1593 |
| 563 | Ga0501233_000301 | 3300049668 | Bacteria | 7611 |
| 564 | Ga0501235_000299 | 3300049669 | Bacteria | 9332 |
| 565 | Ga0501236_002905 | 3300049670 | Unclassified | 1985 |
| 566 | Ga0501243_000533 | 3300049675 | Bacteria | 5076 |
| 567 | Ga0501246_000183 | 3300049676 | Bacteria | 4029 |
| 568 | Ga0501248_001084 | 3300049678 | Unclassified | 1660 |
| 569 | Ga0501249_000187 | 3300049679 | Bacteria | 18921 |
| 570 | Ga0501251_000388 | 3300049681 | Bacteria | 3906 |
| 571 | Ga0501252_001159 | 3300049682 | Bacteria | 2353 |
| 572 | Ga0501256_000097 | 3300049685 | Bacteria | 4481 |
| 573 | Ga0501257_014580 | 3300049686 | Unclassified | 1811 |
| 574 | Ga0501259_004175 | 3300049688 | Unclassified | 2296 |
| 575 | Ga0501260_000130 | 3300049689 | Bacteria | 5424 |
| 576 | Ga0501261_000368 | 3300049690 | Bacteria | 6040 |
| 577 | Ga0501219_000921 | 3300049703 | Bacteria | 3582 |
| 578 | Ga0501221_000411 | 3300049704 | Bacteria | 6609 |
| 579 | Ga0501225_0001272 | 3300049705 | Bacteria | 7818 |
| 580 | Ga0501229_000409 | 3300049706 | Bacteria | 4819 |
| 581 | Ga0501234_000067 | 3300049707 | Bacteria | 12699 |
| 582 | Ga0501245_007222 | 3300049708 | Unclassified | 1568 |
| 583 | Ga0501079_0021590 | 3300049741 | Bacteria | 4925 |
| 584 | Ga0501079_0070270 | 3300049741 | Bacteria | 2703 |
| 585 | Ga0501080_0168503 | 3300049742 | Bacteria | 2021 |
| 586 | Ga0501083_0060881 | 3300049744 | Unclassified | 2522 |
| 587 | Ga0501232_000390 | 3300049757 | Bacteria | 2866 |
| 588 | Ga0501264_000556 | 3300049761 | Bacteria | 5422 |
| 589 | Ga0501265_002952 | 3300049762 | Bacteria | 1933 |
| 590 | Ga0501266_000463 | 3300049763 | Bacteria | 5357 |
| 591 | Ga0501269_010427 | 3300049766 | Bacteria | 1131 |
| 592 | Ga0501270_001992 | 3300049767 | Unclassified | 2040 |
| 593 | Ga0501272_000065 | 3300049769 | Bacteria | 7699 |
| 594 | Ga0501273_000307 | 3300049770 | Bacteria | 3803 |
| 595 | Ga0501275_004489 | 3300049772 | Bacteria | 1311 |
| 596 | Ga0501279_000197 | 3300049775 | Bacteria | 8384 |
| 597 | Ga0501281_00384 | 3300049777 | Bacteria | 4429 |
| 598 | Ga0501283_000015 | 3300049779 | Bacteria | 21880 |
| 599 | Ga0501035_0000001 | 3300049822 | Bacteria | 1037138 |
| 600 | Ga0501035_0002674 | 3300049822 | Bacteria | 17341 |
| 601 | Ga0501035_0004915 | 3300049822 | Bacteria | 12681 |
| 602 | Ga0501035_0119329 | 3300049822 | Bacteria | 2307 |
| 603 | Ga0501035_0321354 | 3300049822 | Bacteria | 1300 |
| 604 | Ga0501044_0000159 | 3300049823 | Bacteria | 83639 |
| 605 | Ga0501044_0030731 | 3300049823 | Bacteria | 5658 |
| 606 | Ga0501044_0256973 | 3300049823 | Unclassified | 1686 |
| 607 | Ga0501045_0099600 | 3300049824 | Bacteria | 2151 |
| 608 | Ga0501045_0180862 | 3300049824 | Bacteria | 1571 |
| 609 | Ga0501212_007373 | 3300049851 | Unclassified | 1506 |
| 610 | Ga0501226_004624 | 3300049853 | Bacteria | 1589 |
| 611 | nmdc:mga05p37_533777_c1 | 3300050507 | Bacteria | 1339 |
| 612 | nmdc:mga05p37_7050_c3 | 3300050507 | Bacteria | 7677 |
| 613 | nmdc:mga05p37_85784_c1 | 3300050507 | Bacteria | 3880 |
| 614 | nmdc:mga09592_126987_c1 | 3300050508 | Unclassified | 2193 |
| 615 | nmdc:mga09592_56990_c1 | 3300050508 | Bacteria | 3302 |
| 616 | nmdc:mga09592_628_c1 | 3300050508 | Bacteria | 26997 |
| 617 | nmdc:mga09592_88265_c1 | 3300050508 | Unclassified | 2648 |
| 618 | nmdc:mga0qj67_7424_c1 | 3300050509 | Bacteria | 8104 |
| 619 | nmdc:mga0qj67_8914_c1 | 3300050509 | Bacteria | 7443 |
| 620 | nmdc:mga06r32_20429_c1 | 3300050510 | Bacteria | 6099 |
| 621 | nmdc:mga08y16_130851_c1 | 3300050511 | Bacteria | 2609 |
| 622 | nmdc:mga08y16_19593_c1 | 3300050511 | Bacteria | 7133 |
| 623 | nmdc:mga08y16_40174_c1 | 3300050511 | Unclassified | 4905 |
| 624 | nmdc:mga08y16_579738_c1 | 3300050511 | Bacteria | 1133 |
| 625 | nmdc:mga0n895_183973_c1 | 3300050512 | Bacteria | 2121 |
| 626 | nmdc:mga0n895_25119_c1 | 3300050512 | Bacteria | 5626 |
| 627 | nmdc:mga0n895_446378_c1 | 3300050512 | Bacteria | 1306 |
| 628 | nmdc:mga0n895_45444_c1 | 3300050512 | Bacteria | 4286 |
| 629 | nmdc:mga0rr50_9841_c1 | 3300050513 | Bacteria | 6039 |
| 630 | nmdc:mga08x19_148882_c1 | 3300050514 | Unclassified | 1584 |
| 631 | nmdc:mga0a205_33356_c1 | 3300050515 | Bacteria | 4937 |
| 632 | nmdc:mga0a205_379728_c1 | 3300050515 | Bacteria | 1278 |
| 633 | nmdc:mga0a205_5607_c1 | 3300050515 | Bacteria | 11307 |
| 634 | Ga0495601_0029104 | 3300053077 | Bacteria | 3424 |
| 635 | Ga0495601_0059194 | 3300053077 | Bacteria | 2429 |
| 636 | Ga0500635_0016485 | 3300053080 | Bacteria | 2199 |
| 637 | Ga0495595_0002156 | 3300053084 | Bacteria | 7647 |
| 638 | Ga0495619_0070253 | 3300053085 | Bacteria | 2341 |
| 639 | Ga0500578_0051718 | 3300053086 | Bacteria | 2632 |
| 640 | Ga0500646_0005402 | 3300053090 | Bacteria | 3234 |
| 641 | Ga0500583_0007096 | 3300053092 | Bacteria | 3913 |
| 642 | Ga0500566_0035668 | 3300053094 | Bacteria | 2889 |
| 643 | Ga0500566_0101427 | 3300053094 | Bacteria | 1577 |
| 644 | Ga0500640_006413 | 3300053095 | Bacteria | 4489 |
| 645 | Ga0500554_001427 | 3300053102 | Bacteria | 4621 |
| 646 | Ga0500556_0003471 | 3300053104 | Bacteria | 4631 |
| 647 | Ga0500572_003251 | 3300053111 | Bacteria | 3744 |
| 648 | Ga0500595_000080 | 3300053119 | Bacteria | 67711 |
| 649 | Ga0500607_150014 | 3300053121 | Bacteria | 1082 |
| 650 | Ga0500608_000243 | 3300053122 | Bacteria | 21503 |
| 651 | Ga0500614_000998 | 3300053123 | Bacteria | 7023 |
| 652 | Ga0500614_010113 | 3300053123 | Bacteria | 2021 |
| 653 | Ga0500559_0042880 | 3300053136 | Bacteria | 1975 |
| 654 | Ga0500568_0020885 | 3300053139 | Bacteria | 2826 |
| 655 | Ga0500603_010891 | 3300053150 | Bacteria | 2060 |
| 656 | Ga0500619_037329 | 3300053154 | Bacteria | 1517 |
| 657 | Ga0500638_049814 | 3300053162 | Bacteria | 2026 |
| 658 | Ga0500639_017834 | 3300053163 | Bacteria | 3746 |
| 659 | Ga0500636_0084495 | 3300053177 | Bacteria | 1825 |
| 660 | Ga0500636_0175579 | 3300053177 | Bacteria | 1155 |
| 661 | Ga0500645_007906 | 3300053730 | Bacteria | 3670 |
| 662 | Ga0501084_0317574 | 3300054114 | Bacteria | 1316 |
| 663 | Ga0590075_032038 | 3300059424 | Unclassified | 1333 |
| 664 | Ga0590077_009132 | 3300059426 | Unclassified | 2031 |
| 665 | Ga0590077_012961 | 3300059426 | Bacteria | 1731 |
| 666 | Ga0501082_0019412 | 3300060353 | Bacteria | 5859 |
| 667 | Ga0501082_0168841 | 3300060353 | Bacteria | 1902 |
| 668 | Ga0501082_0395773 | 3300060353 | Bacteria | 1205 |
| 669 | Ga0501082_0534850 | 3300060353 | Unclassified | 1025 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041410 | Ga0439461_0037611 | Ga0439461_0037611_15_836 | 244 |
| 2 | 3300042876 | Ga0451577_0223564 | Ga0451577_0223564_837_1661 | 245 |
| 3 | 3300049575 | Ga0501039_0501618 | Ga0501039_0501618_14_853 | 248 |
| 4 | 3300005440 | Ga0070705_100038236 | Ga0070705_1000382362 | 250 |
| 5 | 3300049519 | Ga0501296_000029 | Ga0501296_000029_15395_16240 | 251 |
| 6 | 3300049526 | Ga0501303_000138 | Ga0501303_000138_5422_6267 | 251 |
| 7 | 3300049656 | Ga0501209_069411 | Ga0501209_069411_10_855 | 251 |
| 8 | 3300049666 | Ga0501228_000244 | Ga0501228_000244_2380_3225 | 251 |
| 9 | 3300049685 | Ga0501256_000097 | Ga0501256_000097_73_918 | 251 |
| 10 | 3300049708 | Ga0501245_007222 | Ga0501245_007222_383_1228 | 251 |
| 11 | 3300049766 | Ga0501269_010427 | Ga0501269_010427_62_907 | 251 |
| 12 | 3300047321 | Ga0495676_0305523 | Ga0495676_0305523_17_880 | 252 |
| 13 | 3300042008 | Ga0439450_042759 | Ga0439450_042759_56_916 | 256 |
| 14 | 3300027614 | Ga0209970_1006254 | Ga0209970_10062542 | 263 |
| 15 | 3300049586 | Ga0501070_0122961 | Ga0501070_0122961_10_930 | 263 |
| 16 | 3300035115 | Ga0373941_0015901 | Ga0373941_0015901_1077_2024 | 264 |
| 17 | 3300046499 | Ga0495594_0002228 | Ga0495594_0002228_27_926 | 264 |
| 18 | 3300046517 | Ga0495630_0444302 | Ga0495630_0444302_29_976 | 264 |
| 19 | 3300028558 | Ga0265326_10005513 | Ga0265326_100055132 | 267 |
| 20 | 3300049572 | Ga0501036_0101804 | Ga0501036_0101804_1305_2222 | 274 |
| 21 | 3300005336 | Ga0070680_100033394 | Ga0070680_1000333943 | 275 |
| 22 | 3300031240 | Ga0265320_10083479 | Ga0265320_100834792 | 278 |
| 23 | 3300001990 | JGI24737J22298_10032482 | JGI24737J22298_100324821 | 280 |
| 24 | 3300005331 | Ga0070670_100206980 | Ga0070670_1002069802 | 280 |
| 25 | 3300005345 | Ga0070692_10054249 | Ga0070692_100542492 | 280 |
| 26 | 3300005564 | Ga0070664_100006608 | Ga0070664_1000066087 | 280 |
| 27 | 3300006846 | Ga0075430_100001325 | Ga0075430_1000013255 | 280 |
| 28 | 3300006880 | Ga0075429_100005851 | Ga0075429_1000058515 | 280 |
| 29 | 3300009147 | Ga0114129_10023328 | Ga0114129_100233285 | 280 |
| 30 | 3300009147 | Ga0114129_10067741 | Ga0114129_100677412 | 280 |
| 31 | 3300025925 | Ga0207650_10277150 | Ga0207650_102771502 | 280 |
| 32 | 3300027876 | Ga0209974_10000265 | Ga0209974_1000026518 | 280 |
| 33 | 3300031548 | Ga0307408_100038453 | Ga0307408_1000384532 | 280 |
| 34 | 3300031731 | Ga0307405_10010594 | Ga0307405_100105943 | 280 |
| 35 | 3300031901 | Ga0307406_10003927 | Ga0307406_100039276 | 280 |
| 36 | 3300031903 | Ga0307407_10005289 | Ga0307407_100052892 | 280 |
| 37 | 3300031911 | Ga0307412_10000625 | Ga0307412_100006254 | 280 |
| 38 | 3300032004 | Ga0307414_10009229 | Ga0307414_100092293 | 280 |
| 39 | 3300037588 | Ga0316581_0073691 | Ga0316581_0073691_79_969 | 280 |
| 40 | 3300045051 | Ga0451576_0001765 | Ga0451576_0001765_29783_30715 | 280 |
| 41 | 3300045051 | Ga0451576_0713558 | Ga0451576_0713558_28_960 | 280 |
| 42 | 3300049573 | Ga0501037_0097604 | Ga0501037_0097604_556_1488 | 280 |
| 43 | 3300049583 | Ga0501067_0026740 | Ga0501067_0026740_2132_3064 | 280 |
| 44 | 3300049744 | Ga0501083_0060881 | Ga0501083_0060881_906_1838 | 280 |
| 45 | 3300049822 | Ga0501035_0321354 | Ga0501035_0321354_302_1234 | 280 |
| 46 | 3300050507 | nmdc:mga05p37_7050_c3 | nmdc:mga05p37_7050_c3_5015_5947 | 280 |
| 47 | 3300050512 | nmdc:mga0n895_446378_c1 | nmdc:mga0n895_446378_c1_329_1261 | 280 |
| 48 | 3300005336 | Ga0070680_100031682 | Ga0070680_1000316825 | 281 |
| 49 | 3300005458 | Ga0070681_10049211 | Ga0070681_100492112 | 281 |
| 50 | 3300005458 | Ga0070681_10253915 | Ga0070681_102539152 | 281 |
| 51 | 3300005530 | Ga0070679_100001459 | Ga0070679_10000145918 | 281 |
| 52 | 3300005563 | Ga0068855_100392142 | Ga0068855_1003921422 | 281 |
| 53 | 3300005614 | Ga0068856_100058687 | Ga0068856_1000586872 | 281 |
| 54 | 3300009176 | Ga0105242_10087944 | Ga0105242_100879442 | 281 |
| 55 | 3300009177 | Ga0105248_10000908 | Ga0105248_1000090825 | 281 |
| 56 | 3300014326 | Ga0157380_10014684 | Ga0157380_100146843 | 281 |
| 57 | 3300025917 | Ga0207660_10014792 | Ga0207660_100147926 | 281 |
| 58 | 3300025921 | Ga0207652_10219239 | Ga0207652_102192392 | 281 |
| 59 | 3300026078 | Ga0207702_10150471 | Ga0207702_101504712 | 281 |
| 60 | 3300026089 | Ga0207648_10085747 | Ga0207648_100857473 | 281 |
| 61 | 3300035111 | Ga0373923_0020394 | Ga0373923_0020394_344_1294 | 281 |
| 62 | 3300035724 | Ga0373933_0004953 | Ga0373933_0004953_1740_2690 | 281 |
| 63 | 3300036401 | Ga0373937_0079996 | Ga0373937_0079996_558_1508 | 281 |
| 64 | 3300036647 | Ga0316582_0075916 | Ga0316582_0075916_460_1353 | 281 |
| 65 | 3300037068 | Ga0373925_0070936 | Ga0373925_0070936_159_1109 | 281 |
| 66 | 3300046516 | Ga0495628_0216051 | Ga0495628_0216051_196_1170 | 281 |
| 67 | 3300046663 | Ga0495635_0152579 | Ga0495635_0152579_446_1396 | 281 |
| 68 | 3300046675 | Ga0495657_0016534 | Ga0495657_0016534_4004_4954 | 281 |
| 69 | 3300047315 | Ga0495581_0062198 | Ga0495581_0062198_689_1639 | 281 |
| 70 | 3300047317 | Ga0495604_0138540 | Ga0495604_0138540_442_1416 | 281 |
| 71 | 3300047322 | Ga0495680_0233916 | Ga0495680_0233916_38_988 | 281 |
| 72 | 3300048088 | Ga0495602_0059350 | Ga0495602_0059350_1378_2352 | 281 |
| 73 | 3300048905 | Ga0496102_0527918 | Ga0496102_0527918_43_954 | 281 |
| 74 | 3300049568 | Ga0501031_0002149 | Ga0501031_0002149_6665_7603 | 281 |
| 75 | 3300049572 | Ga0501036_0053721 | Ga0501036_0053721_822_1760 | 281 |
| 76 | 3300049573 | Ga0501037_0042163 | Ga0501037_0042163_2015_2953 | 281 |
| 77 | 3300049574 | Ga0501038_0006687 | Ga0501038_0006687_6604_7542 | 281 |
| 78 | 3300049574 | Ga0501038_0110342 | Ga0501038_0110342_399_1337 | 281 |
| 79 | 3300049575 | Ga0501039_0002225 | Ga0501039_0002225_7672_8610 | 281 |
| 80 | 3300049575 | Ga0501039_0013028 | Ga0501039_0013028_4403_5341 | 281 |
| 81 | 3300049576 | Ga0501040_0076133 | Ga0501040_0076133_797_1735 | 281 |
| 82 | 3300049577 | Ga0501041_0003147 | Ga0501041_0003147_3598_4536 | 281 |
| 83 | 3300049577 | Ga0501041_0005224 | Ga0501041_0005224_6151_7089 | 281 |
| 84 | 3300049578 | Ga0501042_0001893 | Ga0501042_0001893_3331_4269 | 281 |
| 85 | 3300049579 | Ga0501043_0073429 | Ga0501043_0073429_1386_2324 | 281 |
| 86 | 3300049580 | Ga0501046_0007844 | Ga0501046_0007844_4267_5205 | 281 |
| 87 | 3300049580 | Ga0501046_0014946 | Ga0501046_0014946_751_1689 | 281 |
| 88 | 3300049582 | Ga0501048_0002213 | Ga0501048_0002213_10989_11927 | 281 |
| 89 | 3300049585 | Ga0501069_0018643 | Ga0501069_0018643_788_1762 | 281 |
| 90 | 3300049587 | Ga0501071_0165052 | Ga0501071_0165052_95_1069 | 281 |
| 91 | 3300049592 | Ga0501076_0147192 | Ga0501076_0147192_863_1801 | 281 |
| 92 | 3300049741 | Ga0501079_0021590 | Ga0501079_0021590_798_1736 | 281 |
| 93 | 3300049742 | Ga0501080_0168503 | Ga0501080_0168503_809_1783 | 281 |
| 94 | 3300049822 | Ga0501035_0002674 | Ga0501035_0002674_9595_10533 | 281 |
| 95 | 3300049822 | Ga0501035_0004915 | Ga0501035_0004915_5486_6424 | 281 |
| 96 | 3300049823 | Ga0501044_0256973 | Ga0501044_0256973_465_1403 | 281 |
| 97 | 3300049824 | Ga0501045_0099600 | Ga0501045_0099600_221_1159 | 281 |
| 98 | 3300050515 | nmdc:mga0a205_5607_c1 | nmdc:mga0a205_5607_c1_144_1094 | 281 |
| 99 | 3300060353 | Ga0501082_0019412 | Ga0501082_0019412_3039_4013 | 281 |
| 100 | 3300009553 | Ga0105249_10148930 | Ga0105249_101489302 | 282 |
| 101 | 3300005545 | Ga0070695_100248110 | Ga0070695_1002481102 | 283 |
| 102 | 3300025937 | Ga0207669_10287622 | Ga0207669_102876222 | 283 |
| 103 | 3300031249 | Ga0265339_10020303 | Ga0265339_100203032 | 283 |
| 104 | 3300031344 | Ga0265316_10001169 | Ga0265316_1000116910 | 283 |
| 105 | 3300031712 | Ga0265342_10000265 | Ga0265342_1000026532 | 283 |
| 106 | 3300031712 | Ga0265342_10031378 | Ga0265342_100313782 | 283 |
| 107 | 3300035119 | Ga0373956_0059763 | Ga0373956_0059763_663_1619 | 283 |
| 108 | 3300005364 | Ga0070673_100139017 | Ga0070673_1001390172 | 285 |
| 109 | 3300005467 | Ga0070706_100000878 | Ga0070706_10000087835 | 285 |
| 110 | 3300005468 | Ga0070707_100162323 | Ga0070707_1001623232 | 285 |
| 111 | 3300005937 | Ga0081455_10000594 | Ga0081455_1000059424 | 285 |
| 112 | 3300025910 | Ga0207684_10000198 | Ga0207684_1000019879 | 285 |
| 113 | iso_pu_bacteria | 2684623219 | 2687237057 | 285 |
| 114 | 3300005330 | Ga0070690_100030630 | Ga0070690_1000306303 | 286 |
| 115 | 3300005340 | Ga0070689_100004336 | Ga0070689_1000043362 | 286 |
| 116 | 3300005340 | Ga0070689_100129152 | Ga0070689_1001291522 | 286 |
| 117 | 3300005343 | Ga0070687_100023969 | Ga0070687_1000239693 | 286 |
| 118 | 3300005365 | Ga0070688_100002702 | Ga0070688_1000027025 | 286 |
| 119 | 3300005459 | Ga0068867_100170770 | Ga0068867_1001707702 | 286 |
| 120 | 3300005466 | Ga0070685_10001193 | Ga0070685_1000119312 | 286 |
| 121 | 3300005549 | Ga0070704_100027484 | Ga0070704_1000274844 | 286 |
| 122 | 3300005617 | Ga0068859_100119805 | Ga0068859_1001198052 | 286 |
| 123 | 3300005844 | Ga0068862_100164946 | Ga0068862_1001649462 | 286 |
| 124 | 3300006163 | Ga0070715_10035796 | Ga0070715_100357962 | 286 |
| 125 | 3300006844 | Ga0075428_100256170 | Ga0075428_1002561702 | 286 |
| 126 | 3300006852 | Ga0075433_10214902 | Ga0075433_102149021 | 286 |
| 127 | 3300006871 | Ga0075434_100119547 | Ga0075434_1001195472 | 286 |
| 128 | 3300006880 | Ga0075429_100001252 | Ga0075429_10000125217 | 286 |
| 129 | 3300006880 | Ga0075429_100082207 | Ga0075429_1000822072 | 286 |
| 130 | 3300006931 | Ga0097620_100119801 | Ga0097620_1001198012 | 286 |
| 131 | 3300007076 | Ga0075435_100045650 | Ga0075435_1000456503 | 286 |
| 132 | 3300009094 | Ga0111539_10007846 | Ga0111539_100078469 | 286 |
| 133 | 3300009147 | Ga0114129_10279486 | Ga0114129_102794861 | 286 |
| 134 | 3300014326 | Ga0157380_10240263 | Ga0157380_102402632 | 286 |
| 135 | 3300025918 | Ga0207662_10025917 | Ga0207662_100259172 | 286 |
| 136 | 3300025936 | Ga0207670_10000177 | Ga0207670_1000017712 | 286 |
| 137 | 3300025936 | Ga0207670_10104866 | Ga0207670_101048662 | 286 |
| 138 | 3300025942 | Ga0207689_10325226 | Ga0207689_103252261 | 286 |
| 139 | 3300026075 | Ga0207708_10151599 | Ga0207708_101515992 | 286 |
| 140 | 3300026088 | Ga0207641_10127302 | Ga0207641_101273022 | 286 |
| 141 | 3300026095 | Ga0207676_10340249 | Ga0207676_103402492 | 286 |
| 142 | 3300028380 | Ga0268265_10311647 | Ga0268265_103116471 | 286 |
| 143 | 3300035086 | Ga0373934_0000962 | Ga0373934_0000962_1042_2058 | 286 |
| 144 | 3300035120 | Ga0373957_0009657 | Ga0373957_0009657_794_1810 | 286 |
| 145 | 3300035172 | Ga0373955_0008648 | Ga0373955_0008648_1773_2789 | 286 |
| 146 | 3300035724 | Ga0373933_0007058 | Ga0373933_0007058_4717_5733 | 286 |
| 147 | 3300036401 | Ga0373937_0040042 | Ga0373937_0040042_1737_2753 | 286 |
| 148 | 3300042876 | Ga0451577_0053435 | Ga0451577_0053435_230_1246 | 286 |
| 149 | 3300046454 | Ga0495592_0005931 | Ga0495592_0005931_1139_2155 | 286 |
| 150 | 3300046455 | Ga0495603_0079418 | Ga0495603_0079418_533_1549 | 286 |
| 151 | 3300046463 | Ga0495653_0062353 | Ga0495653_0062353_422_1438 | 286 |
| 152 | 3300046511 | Ga0495608_0012150 | Ga0495608_0012150_783_1799 | 286 |
| 153 | 3300046516 | Ga0495628_0007531 | Ga0495628_0007531_2322_3338 | 286 |
| 154 | 3300046529 | Ga0495652_0158488 | Ga0495652_0158488_375_1391 | 286 |
| 155 | 3300046536 | Ga0495587_0006735 | Ga0495587_0006735_2242_3258 | 286 |
| 156 | 3300046559 | Ga0495667_0014196 | Ga0495667_0014196_3109_4125 | 286 |
| 157 | 3300046663 | Ga0495635_0098788 | Ga0495635_0098788_782_1798 | 286 |
| 158 | 3300046675 | Ga0495657_0029598 | Ga0495657_0029598_1254_2270 | 286 |
| 159 | 3300047317 | Ga0495604_0066471 | Ga0495604_0066471_76_1092 | 286 |
| 160 | 3300047444 | Ga0495675_0005566 | Ga0495675_0005566_4163_5179 | 286 |
| 161 | 3300050507 | nmdc:mga05p37_533777_c1 | nmdc:mga05p37_533777_c1_250_1266 | 286 |
| 162 | 3300050508 | nmdc:mga09592_628_c1 | nmdc:mga09592_628_c1_3281_4297 | 286 |
| 163 | 3300050511 | nmdc:mga08y16_130851_c1 | nmdc:mga08y16_130851_c1_1342_2358 | 286 |
| 164 | 3300050511 | nmdc:mga08y16_19593_c1 | nmdc:mga08y16_19593_c1_2507_3523 | 286 |
| 165 | 3300050512 | nmdc:mga0n895_183973_c1 | nmdc:mga0n895_183973_c1_650_1681 | 286 |
| 166 | 3300050515 | nmdc:mga0a205_379728_c1 | nmdc:mga0a205_379728_c1_205_1236 | 286 |
| 167 | 3300053084 | Ga0495595_0002156 | Ga0495595_0002156_6613_7629 | 286 |
| 168 | 3300005438 | Ga0070701_10080414 | Ga0070701_100804142 | 287 |
| 169 | 3300028800 | Ga0265338_10087690 | Ga0265338_100876902 | 287 |
| 170 | 3300048928 | Ga0496125_0001254 | Ga0496125_0001254_14209_15141 | 287 |
| 171 | 3300048928 | Ga0496125_0047635 | Ga0496125_0047635_746_1681 | 287 |
| 172 | 3300049575 | Ga0501039_0030652 | Ga0501039_0030652_2939_3922 | 287 |
| 173 | 3300049822 | Ga0501035_0119329 | Ga0501035_0119329_886_1869 | 287 |
| 174 | 3300053123 | Ga0500614_010113 | Ga0500614_010113_298_1323 | 287 |
| 175 | 3300053162 | Ga0500638_049814 | Ga0500638_049814_897_1922 | 287 |
| 176 | 3300053177 | Ga0500636_0084495 | Ga0500636_0084495_696_1721 | 287 |
| 177 | 3300060353 | Ga0501082_0168841 | Ga0501082_0168841_208_1191 | 287 |
| 178 | 3300005347 | Ga0070668_100147751 | Ga0070668_1001477512 | 288 |
| 179 | 3300005354 | Ga0070675_100041338 | Ga0070675_1000413382 | 288 |
| 180 | 3300005467 | Ga0070706_100031624 | Ga0070706_1000316243 | 288 |
| 181 | 3300005471 | Ga0070698_100335125 | Ga0070698_1003351251 | 288 |
| 182 | 3300013306 | Ga0163162_10192709 | Ga0163162_101927092 | 288 |
| 183 | 3300025926 | Ga0207659_10027546 | Ga0207659_100275463 | 288 |
| 184 | 3300028381 | Ga0268264_10398558 | Ga0268264_103985582 | 288 |
| 185 | 3300032126 | Ga0307415_100131256 | Ga0307415_1001312561 | 288 |
| 186 | 3300053139 | Ga0500568_0020885 | Ga0500568_0020885_1414_2409 | 288 |
| 187 | 3300005295 | Ga0065707_10099442 | Ga0065707_100994422 | 289 |
| 188 | 3300005327 | Ga0070658_10032927 | Ga0070658_100329272 | 289 |
| 189 | 3300005328 | Ga0070676_10064494 | Ga0070676_100644942 | 289 |
| 190 | 3300005330 | Ga0070690_100015663 | Ga0070690_1000156634 | 289 |
| 191 | 3300005330 | Ga0070690_100027931 | Ga0070690_1000279313 | 289 |
| 192 | 3300005331 | Ga0070670_100015844 | Ga0070670_1000158446 | 289 |
| 193 | 3300005333 | Ga0070677_10030097 | Ga0070677_100300973 | 289 |
| 194 | 3300005334 | Ga0068869_100086837 | Ga0068869_1000868373 | 289 |
| 195 | 3300005335 | Ga0070666_10012329 | Ga0070666_100123294 | 289 |
| 196 | 3300005336 | Ga0070680_100004415 | Ga0070680_1000044156 | 289 |
| 197 | 3300005337 | Ga0070682_100016500 | Ga0070682_1000165002 | 289 |
| 198 | 3300005337 | Ga0070682_100063363 | Ga0070682_1000633631 | 289 |
| 199 | 3300005337 | Ga0070682_100082376 | Ga0070682_1000823762 | 289 |
| 200 | 3300005338 | Ga0068868_100038099 | Ga0068868_1000380992 | 289 |
| 201 | 3300005339 | Ga0070660_100029788 | Ga0070660_1000297882 | 289 |
| 202 | 3300005340 | Ga0070689_100001519 | Ga0070689_1000015192 | 289 |
| 203 | 3300005343 | Ga0070687_100001354 | Ga0070687_1000013546 | 289 |
| 204 | 3300005344 | Ga0070661_100018849 | Ga0070661_1000188495 | 289 |
| 205 | 3300005347 | Ga0070668_100071182 | Ga0070668_1000711821 | 289 |
| 206 | 3300005353 | Ga0070669_100007357 | Ga0070669_1000073573 | 289 |
| 207 | 3300005355 | Ga0070671_100514142 | Ga0070671_1005141421 | 289 |
| 208 | 3300005356 | Ga0070674_100000394 | Ga0070674_10000039423 | 289 |
| 209 | 3300005365 | Ga0070688_100045669 | Ga0070688_1000456693 | 289 |
| 210 | 3300005366 | Ga0070659_100000985 | Ga0070659_10000098524 | 289 |
| 211 | 3300005437 | Ga0070710_10068984 | Ga0070710_100689842 | 289 |
| 212 | 3300005440 | Ga0070705_100006180 | Ga0070705_1000061805 | 289 |
| 213 | 3300005440 | Ga0070705_100060010 | Ga0070705_1000600102 | 289 |
| 214 | 3300005444 | Ga0070694_100006125 | Ga0070694_1000061253 | 289 |
| 215 | 3300005455 | Ga0070663_100247157 | Ga0070663_1002471572 | 289 |
| 216 | 3300005456 | Ga0070678_100002606 | Ga0070678_1000026063 | 289 |
| 217 | 3300005458 | Ga0070681_10003614 | Ga0070681_1000361414 | 289 |
| 218 | 3300005458 | Ga0070681_10218431 | Ga0070681_102184311 | 289 |
| 219 | 3300005459 | Ga0068867_100001546 | Ga0068867_10000154616 | 289 |
| 220 | 3300005466 | Ga0070685_10075920 | Ga0070685_100759202 | 289 |
| 221 | 3300005467 | Ga0070706_100002645 | Ga0070706_1000026457 | 289 |
| 222 | 3300005471 | Ga0070698_100000114 | Ga0070698_10000011435 | 289 |
| 223 | 3300005530 | Ga0070679_100047591 | Ga0070679_1000475914 | 289 |
| 224 | 3300005535 | Ga0070684_100503871 | Ga0070684_1005038711 | 289 |
| 225 | 3300005543 | Ga0070672_100006069 | Ga0070672_1000060694 | 289 |
| 226 | 3300005544 | Ga0070686_100004655 | Ga0070686_1000046554 | 289 |
| 227 | 3300005545 | Ga0070695_100007325 | Ga0070695_1000073256 | 289 |
| 228 | 3300005546 | Ga0070696_100047305 | Ga0070696_1000473053 | 289 |
| 229 | 3300005548 | Ga0070665_100002307 | Ga0070665_1000023074 | 289 |
| 230 | 3300005563 | Ga0068855_100174913 | Ga0068855_1001749131 | 289 |
| 231 | 3300005564 | Ga0070664_100021093 | Ga0070664_1000210933 | 289 |
| 232 | 3300005577 | Ga0068857_100059905 | Ga0068857_1000599052 | 289 |
| 233 | 3300005614 | Ga0068856_100186254 | Ga0068856_1001862542 | 289 |
| 234 | 3300005618 | Ga0068864_100175150 | Ga0068864_1001751502 | 289 |
| 235 | 3300005718 | Ga0068866_10054688 | Ga0068866_100546882 | 289 |
| 236 | 3300005719 | Ga0068861_100218688 | Ga0068861_1002186882 | 289 |
| 237 | 3300005842 | Ga0068858_100135974 | Ga0068858_1001359742 | 289 |
| 238 | 3300005843 | Ga0068860_100017638 | Ga0068860_1000176382 | 289 |
| 239 | 3300005843 | Ga0068860_100245921 | Ga0068860_1002459211 | 289 |
| 240 | 3300005844 | Ga0068862_100021260 | Ga0068862_1000212604 | 289 |
| 241 | 3300006028 | Ga0070717_10024090 | Ga0070717_100240905 | 289 |
| 242 | 3300006058 | Ga0075432_10001979 | Ga0075432_100019795 | 289 |
| 243 | 3300006237 | Ga0097621_100037112 | Ga0097621_1000371122 | 289 |
| 244 | 3300006358 | Ga0068871_100005816 | Ga0068871_10000581610 | 289 |
| 245 | 3300006844 | Ga0075428_100295348 | Ga0075428_1002953482 | 289 |
| 246 | 3300006846 | Ga0075430_100001910 | Ga0075430_1000019104 | 289 |
| 247 | 3300006847 | Ga0075431_100003065 | Ga0075431_1000030656 | 289 |
| 248 | 3300006852 | Ga0075433_10076304 | Ga0075433_100763041 | 289 |
| 249 | 3300006852 | Ga0075433_10111981 | Ga0075433_101119812 | 289 |
| 250 | 3300006871 | Ga0075434_100141571 | Ga0075434_1001415712 | 289 |
| 251 | 3300006871 | Ga0075434_100473178 | Ga0075434_1004731781 | 289 |
| 252 | 3300006880 | Ga0075429_100098362 | Ga0075429_1000983622 | 289 |
| 253 | 3300006880 | Ga0075429_100144221 | Ga0075429_1001442212 | 289 |
| 254 | 3300006881 | Ga0068865_100004478 | Ga0068865_1000044782 | 289 |
| 255 | 3300006881 | Ga0068865_100010331 | Ga0068865_1000103315 | 289 |
| 256 | 3300006914 | Ga0075436_100149379 | Ga0075436_1001493792 | 289 |
| 257 | 3300007076 | Ga0075435_100097970 | Ga0075435_1000979703 | 289 |
| 258 | 3300009094 | Ga0111539_10260481 | Ga0111539_102604812 | 289 |
| 259 | 3300009098 | Ga0105245_10000099 | Ga0105245_1000009944 | 289 |
| 260 | 3300009098 | Ga0105245_10118545 | Ga0105245_101185452 | 289 |
| 261 | 3300009147 | Ga0114129_10126336 | Ga0114129_101263362 | 289 |
| 262 | 3300009148 | Ga0105243_10004891 | Ga0105243_100048913 | 289 |
| 263 | 3300009174 | Ga0105241_10040792 | Ga0105241_100407922 | 289 |
| 264 | 3300009176 | Ga0105242_10045229 | Ga0105242_100452293 | 289 |
| 265 | 3300009553 | Ga0105249_10048253 | Ga0105249_100482533 | 289 |
| 266 | 3300010375 | Ga0105239_10022606 | Ga0105239_100226062 | 289 |
| 267 | 3300010375 | Ga0105239_10231783 | Ga0105239_102317832 | 289 |
| 268 | 3300011119 | Ga0105246_10000200 | Ga0105246_100002003 | 289 |
| 269 | 3300013105 | Ga0157369_10036432 | Ga0157369_100364322 | 289 |
| 270 | 3300013296 | Ga0157374_10128846 | Ga0157374_101288463 | 289 |
| 271 | 3300013296 | Ga0157374_10189801 | Ga0157374_101898012 | 289 |
| 272 | 3300013297 | Ga0157378_10011945 | Ga0157378_100119457 | 289 |
| 273 | 3300013308 | Ga0157375_10002941 | Ga0157375_100029413 | 289 |
| 274 | 3300014745 | Ga0157377_10019343 | Ga0157377_100193433 | 289 |
| 275 | 3300014969 | Ga0157376_10055439 | Ga0157376_100554393 | 289 |
| 276 | 3300014969 | Ga0157376_10192628 | Ga0157376_101926281 | 289 |
| 277 | 3300025899 | Ga0207642_10037612 | Ga0207642_100376122 | 289 |
| 278 | 3300025901 | Ga0207688_10004420 | Ga0207688_100044203 | 289 |
| 279 | 3300025906 | Ga0207699_10151304 | Ga0207699_101513042 | 289 |
| 280 | 3300025907 | Ga0207645_10001133 | Ga0207645_1000113323 | 289 |
| 281 | 3300025909 | Ga0207705_10110184 | Ga0207705_101101842 | 289 |
| 282 | 3300025911 | Ga0207654_10034950 | Ga0207654_100349502 | 289 |
| 283 | 3300025912 | Ga0207707_10269655 | Ga0207707_102696552 | 289 |
| 284 | 3300025917 | Ga0207660_10012261 | Ga0207660_100122615 | 289 |
| 285 | 3300025919 | Ga0207657_10005985 | Ga0207657_100059854 | 289 |
| 286 | 3300025920 | Ga0207649_10116466 | Ga0207649_101164662 | 289 |
| 287 | 3300025921 | Ga0207652_10017078 | Ga0207652_100170783 | 289 |
| 288 | 3300025921 | Ga0207652_10126027 | Ga0207652_101260272 | 289 |
| 289 | 3300025923 | Ga0207681_10001480 | Ga0207681_1000148015 | 289 |
| 290 | 3300025925 | Ga0207650_10118955 | Ga0207650_101189552 | 289 |
| 291 | 3300025926 | Ga0207659_10084688 | Ga0207659_100846882 | 289 |
| 292 | 3300025927 | Ga0207687_10000774 | Ga0207687_100007749 | 289 |
| 293 | 3300025932 | Ga0207690_10054181 | Ga0207690_100541813 | 289 |
| 294 | 3300025933 | Ga0207706_10003909 | Ga0207706_1000390915 | 289 |
| 295 | 3300025934 | Ga0207686_10005846 | Ga0207686_100058463 | 289 |
| 296 | 3300025937 | Ga0207669_10035894 | Ga0207669_100358943 | 289 |
| 297 | 3300025938 | Ga0207704_10011387 | Ga0207704_100113874 | 289 |
| 298 | 3300025938 | Ga0207704_10111776 | Ga0207704_101117762 | 289 |
| 299 | 3300025940 | Ga0207691_10000182 | Ga0207691_1000018265 | 289 |
| 300 | 3300025942 | Ga0207689_10072905 | Ga0207689_100729053 | 289 |
| 301 | 3300025944 | Ga0207661_10025410 | Ga0207661_100254102 | 289 |
| 302 | 3300025945 | Ga0207679_10004180 | Ga0207679_1000418010 | 289 |
| 303 | 3300025960 | Ga0207651_10116819 | Ga0207651_101168192 | 289 |
| 304 | 3300025960 | Ga0207651_10225689 | Ga0207651_102256892 | 289 |
| 305 | 3300025961 | Ga0207712_10053359 | Ga0207712_100533592 | 289 |
| 306 | 3300025972 | Ga0207668_10122064 | Ga0207668_101220642 | 289 |
| 307 | 3300026035 | Ga0207703_10151607 | Ga0207703_101516072 | 289 |
| 308 | 3300026075 | Ga0207708_10000291 | Ga0207708_100002915 | 289 |
| 309 | 3300026078 | Ga0207702_10208654 | Ga0207702_102086542 | 289 |
| 310 | 3300026089 | Ga0207648_10000101 | Ga0207648_1000010159 | 289 |
| 311 | 3300026095 | Ga0207676_10061252 | Ga0207676_100612522 | 289 |
| 312 | 3300026116 | Ga0207674_10004318 | Ga0207674_100043184 | 289 |
| 313 | 3300026116 | Ga0207674_10313947 | Ga0207674_103139471 | 289 |
| 314 | 3300026118 | Ga0207675_100074130 | Ga0207675_1000741302 | 289 |
| 315 | 3300026121 | Ga0207683_10000229 | Ga0207683_1000022923 | 289 |
| 316 | 3300026121 | Ga0207683_10028708 | Ga0207683_100287082 | 289 |
| 317 | 3300027252 | Ga0209973_1000239 | Ga0209973_10002392 | 289 |
| 318 | 3300027360 | Ga0209969_1002389 | Ga0209969_10023893 | 289 |
| 319 | 3300027364 | Ga0209967_1000547 | Ga0209967_10005473 | 289 |
| 320 | 3300027378 | Ga0209981_1002105 | Ga0209981_10021052 | 289 |
| 321 | 3300027424 | Ga0209984_1000006 | Ga0209984_100000616 | 289 |
| 322 | 3300027462 | Ga0210000_1000032 | Ga0210000_100003223 | 289 |
| 323 | 3300027552 | Ga0209982_1000705 | Ga0209982_10007053 | 289 |
| 324 | 3300027614 | Ga0209970_1007538 | Ga0209970_10075382 | 289 |
| 325 | 3300027617 | Ga0210002_1000061 | Ga0210002_10000612 | 289 |
| 326 | 3300027665 | Ga0209983_1000874 | Ga0209983_10008746 | 289 |
| 327 | 3300027682 | Ga0209971_1000642 | Ga0209971_10006421 | 289 |
| 328 | 3300027695 | Ga0209966_1000016 | Ga0209966_100001650 | 289 |
| 329 | 3300027717 | Ga0209998_10000021 | Ga0209998_1000002134 | 289 |
| 330 | 3300027876 | Ga0209974_10000003 | Ga0209974_1000000315 | 289 |
| 331 | 3300027907 | Ga0207428_10001120 | Ga0207428_1000112032 | 289 |
| 332 | 3300028379 | Ga0268266_10044738 | Ga0268266_100447383 | 289 |
| 333 | 3300028380 | Ga0268265_10013370 | Ga0268265_100133703 | 289 |
| 334 | 3300028794 | Ga0307515_10015000 | Ga0307515_100150006 | 289 |
| 335 | 3300028800 | Ga0265338_10203924 | Ga0265338_102039242 | 289 |
| 336 | 3300031238 | Ga0265332_10020875 | Ga0265332_100208752 | 289 |
| 337 | 3300031456 | Ga0307513_10010635 | Ga0307513_100106357 | 289 |
| 338 | 3300031456 | Ga0307513_10186517 | Ga0307513_101865172 | 289 |
| 339 | 3300031507 | Ga0307509_10010793 | Ga0307509_100107934 | 289 |
| 340 | 3300031507 | Ga0307509_10100579 | Ga0307509_101005792 | 289 |
| 341 | 3300031507 | Ga0307509_10128720 | Ga0307509_101287202 | 289 |
| 342 | 3300031507 | Ga0307509_10136421 | Ga0307509_101364211 | 289 |
| 343 | 3300031901 | Ga0307406_10052376 | Ga0307406_100523762 | 289 |
| 344 | 3300032126 | Ga0307415_100115272 | Ga0307415_1001152722 | 289 |
| 345 | 3300035088 | Ga0373940_0035055 | Ga0373940_0035055_132_1109 | 289 |
| 346 | 3300035090 | Ga0373949_0001386 | Ga0373949_0001386_3731_4777 | 289 |
| 347 | 3300035241 | Ga0373961_0000020 | Ga0373961_0000020_71139_72146 | 289 |
| 348 | 3300035398 | Ga0316574_0072511 | Ga0316574_0072511_1090_2022 | 289 |
| 349 | 3300035691 | Ga0373931_0040788 | Ga0373931_0040788_1040_2017 | 289 |
| 350 | 3300036712 | Ga0316584_0091412 | Ga0316584_0091412_361_1293 | 289 |
| 351 | 3300045051 | Ga0451576_0093757 | Ga0451576_0093757_459_1436 | 289 |
| 352 | 3300045976 | Ga0466967_0220246 | Ga0466967_0220246_765_1763 | 289 |
| 353 | 3300046520 | Ga0495637_0036110 | Ga0495637_0036110_516_1493 | 289 |
| 354 | 3300046664 | Ga0495659_0013982 | Ga0495659_0013982_468_1445 | 289 |
| 355 | 3300046691 | Ga0495670_0091914 | Ga0495670_0091914_182_1159 | 289 |
| 356 | 3300047472 | Ga0495686_0025513 | Ga0495686_0025513_354_1349 | 289 |
| 357 | 3300049519 | Ga0501296_006766 | Ga0501296_006766_59_1036 | 289 |
| 358 | 3300049574 | Ga0501038_0039168 | Ga0501038_0039168_1267_2244 | 289 |
| 359 | 3300049581 | Ga0501047_0095852 | Ga0501047_0095852_1577_2575 | 289 |
| 360 | 3300049581 | Ga0501047_0143491 | Ga0501047_0143491_424_1422 | 289 |
| 361 | 3300049584 | Ga0501068_0087011 | Ga0501068_0087011_723_1700 | 289 |
| 362 | 3300049586 | Ga0501070_0023242 | Ga0501070_0023242_4023_5021 | 289 |
| 363 | 3300049586 | Ga0501070_0078064 | Ga0501070_0078064_808_1806 | 289 |
| 364 | 3300049587 | Ga0501071_0004046 | Ga0501071_0004046_5503_6480 | 289 |
| 365 | 3300049589 | Ga0501073_0108362 | Ga0501073_0108362_527_1525 | 289 |
| 366 | 3300049590 | Ga0501074_0155538 | Ga0501074_0155538_555_1532 | 289 |
| 367 | 3300049591 | Ga0501075_0017241 | Ga0501075_0017241_454_1431 | 289 |
| 368 | 3300049593 | Ga0501077_0079742 | Ga0501077_0079742_558_1535 | 289 |
| 369 | 3300049667 | Ga0501230_007885 | Ga0501230_007885_256_1251 | 289 |
| 370 | 3300049741 | Ga0501079_0070270 | Ga0501079_0070270_1594_2571 | 289 |
| 371 | 3300049823 | Ga0501044_0030731 | Ga0501044_0030731_1215_2213 | 289 |
| 372 | 3300050508 | nmdc:mga09592_126987_c1 | nmdc:mga09592_126987_c1_1056_2033 | 289 |
| 373 | 3300050508 | nmdc:mga09592_56990_c1 | nmdc:mga09592_56990_c1_1716_2693 | 289 |
| 374 | 3300050509 | nmdc:mga0qj67_7424_c1 | nmdc:mga0qj67_7424_c1_6284_7261 | 289 |
| 375 | 3300050509 | nmdc:mga0qj67_8914_c1 | nmdc:mga0qj67_8914_c1_4393_5370 | 289 |
| 376 | 3300050510 | nmdc:mga06r32_20429_c1 | nmdc:mga06r32_20429_c1_857_1834 | 289 |
| 377 | 3300050511 | nmdc:mga08y16_40174_c1 | nmdc:mga08y16_40174_c1_2873_3850 | 289 |
| 378 | 3300050512 | nmdc:mga0n895_25119_c1 | nmdc:mga0n895_25119_c1_1466_2443 | 289 |
| 379 | 3300050512 | nmdc:mga0n895_45444_c1 | nmdc:mga0n895_45444_c1_954_1931 | 289 |
| 380 | 3300050513 | nmdc:mga0rr50_9841_c1 | nmdc:mga0rr50_9841_c1_103_1080 | 289 |
| 381 | 3300050514 | nmdc:mga08x19_148882_c1 | nmdc:mga08x19_148882_c1_398_1375 | 289 |
| 382 | 3300050515 | nmdc:mga0a205_33356_c1 | nmdc:mga0a205_33356_c1_2758_3735 | 289 |
| 383 | 3300053092 | Ga0500583_0007096 | Ga0500583_0007096_2500_3555 | 289 |
| 384 | 3300053163 | Ga0500639_017834 | Ga0500639_017834_2505_3560 | 289 |
| 385 | 3300054114 | Ga0501084_0317574 | Ga0501084_0317574_115_1113 | 289 |
| 386 | 3300059424 | Ga0590075_032038 | Ga0590075_032038_94_1071 | 289 |
| 387 | 3300059426 | Ga0590077_009132 | Ga0590077_009132_191_1168 | 289 |
| 388 | 3300059426 | Ga0590077_012961 | Ga0590077_012961_690_1667 | 289 |
| 389 | 3300060353 | Ga0501082_0395773 | Ga0501082_0395773_107_1084 | 289 |
| 390 | 3300031344 | Ga0265316_10000230 | Ga0265316_1000023061 | 290 |
| 391 | 3300031727 | Ga0316576_10000591 | Ga0316576_100005918 | 290 |
| 392 | 3300031730 | Ga0307516_10013815 | Ga0307516_100138152 | 290 |
| 393 | 3300031824 | Ga0307413_10017077 | Ga0307413_100170773 | 290 |
| 394 | 3300031852 | Ga0307410_10050917 | Ga0307410_100509173 | 290 |
| 395 | 3300031995 | Ga0307409_100124325 | Ga0307409_1001243252 | 290 |
| 396 | 3300032002 | Ga0307416_100294136 | Ga0307416_1002941361 | 290 |
| 397 | 3300032005 | Ga0307411_10008204 | Ga0307411_100082044 | 290 |
| 398 | 3300032126 | Ga0307415_100060451 | Ga0307415_1000604512 | 290 |
| 399 | 3300041406 | Ga0439439_0015824 | Ga0439439_0015824_212_1192 | 290 |
| 400 | 3300041411 | Ga0439466_0017981 | Ga0439466_0017981_374_1354 | 290 |
| 401 | 3300042010 | Ga0439452_004979 | Ga0439452_004979_899_1879 | 290 |
| 402 | 3300044712 | Ga0453684_0331514 | Ga0453684_0331514_708_1700 | 290 |
| 403 | 3300049513 | Ga0501290_000039 | Ga0501290_000039_13943_14923 | 290 |
| 404 | 3300049514 | Ga0501291_000019 | Ga0501291_000019_9406_10386 | 290 |
| 405 | 3300049515 | Ga0501292_000403 | Ga0501292_000403_4128_5108 | 290 |
| 406 | 3300049517 | Ga0501294_001525 | Ga0501294_001525_743_1723 | 290 |
| 407 | 3300049518 | Ga0501295_000011 | Ga0501295_000011_17329_18309 | 290 |
| 408 | 3300049520 | Ga0501297_000006 | Ga0501297_000006_6129_7109 | 290 |
| 409 | 3300049521 | Ga0501298_000012 | Ga0501298_000012_14730_15710 | 290 |
| 410 | 3300049522 | Ga0501299_000715 | Ga0501299_000715_560_1540 | 290 |
| 411 | 3300049523 | Ga0501300_000483 | Ga0501300_000483_750_1730 | 290 |
| 412 | 3300049524 | Ga0501301_000228 | Ga0501301_000228_1614_2594 | 290 |
| 413 | 3300049586 | Ga0501070_0139358 | Ga0501070_0139358_1111_1986 | 290 |
| 414 | 3300049649 | Ga0501198_002606 | Ga0501198_002606_1300_2280 | 290 |
| 415 | 3300049650 | Ga0501199_000121 | Ga0501199_000121_1973_2953 | 290 |
| 416 | 3300049654 | Ga0501207_000226 | Ga0501207_000226_2090_3070 | 290 |
| 417 | 3300049655 | Ga0501208_000359 | Ga0501208_000359_164_1144 | 290 |
| 418 | 3300049660 | Ga0501216_000387 | Ga0501216_000387_3668_4648 | 290 |
| 419 | 3300049661 | Ga0501217_001318 | Ga0501217_001318_983_1963 | 290 |
| 420 | 3300049665 | Ga0501227_004929 | Ga0501227_004929_1296_2276 | 290 |
| 421 | 3300049668 | Ga0501233_000301 | Ga0501233_000301_1437_2417 | 290 |
| 422 | 3300049669 | Ga0501235_000299 | Ga0501235_000299_2250_3230 | 290 |
| 423 | 3300049670 | Ga0501236_002905 | Ga0501236_002905_505_1485 | 290 |
| 424 | 3300049675 | Ga0501243_000533 | Ga0501243_000533_1940_2920 | 290 |
| 425 | 3300049676 | Ga0501246_000183 | Ga0501246_000183_1973_2953 | 290 |
| 426 | 3300049678 | Ga0501248_001084 | Ga0501248_001084_490_1470 | 290 |
| 427 | 3300049679 | Ga0501249_000187 | Ga0501249_000187_715_1695 | 290 |
| 428 | 3300049681 | Ga0501251_000388 | Ga0501251_000388_551_1531 | 290 |
| 429 | 3300049682 | Ga0501252_001159 | Ga0501252_001159_1183_2163 | 290 |
| 430 | 3300049686 | Ga0501257_014580 | Ga0501257_014580_359_1339 | 290 |
| 431 | 3300049688 | Ga0501259_004175 | Ga0501259_004175_732_1712 | 290 |
| 432 | 3300049689 | Ga0501260_000130 | Ga0501260_000130_2059_3039 | 290 |
| 433 | 3300049690 | Ga0501261_000368 | Ga0501261_000368_1291_2271 | 290 |
| 434 | 3300049703 | Ga0501219_000921 | Ga0501219_000921_1282_2262 | 290 |
| 435 | 3300049704 | Ga0501221_000411 | Ga0501221_000411_365_1345 | 290 |
| 436 | 3300049705 | Ga0501225_0001272 | Ga0501225_0001272_4559_5539 | 290 |
| 437 | 3300049706 | Ga0501229_000409 | Ga0501229_000409_687_1667 | 290 |
| 438 | 3300049707 | Ga0501234_000067 | Ga0501234_000067_5564_6544 | 290 |
| 439 | 3300049757 | Ga0501232_000390 | Ga0501232_000390_1495_2475 | 290 |
| 440 | 3300049761 | Ga0501264_000556 | Ga0501264_000556_4115_5095 | 290 |
| 441 | 3300049762 | Ga0501265_002952 | Ga0501265_002952_309_1289 | 290 |
| 442 | 3300049763 | Ga0501266_000463 | Ga0501266_000463_4290_5270 | 290 |
| 443 | 3300049767 | Ga0501270_001992 | Ga0501270_001992_384_1364 | 290 |
| 444 | 3300049769 | Ga0501272_000065 | Ga0501272_000065_1438_2418 | 290 |
| 445 | 3300049770 | Ga0501273_000307 | Ga0501273_000307_1299_2279 | 290 |
| 446 | 3300049772 | Ga0501275_004489 | Ga0501275_004489_175_1155 | 290 |
| 447 | 3300049775 | Ga0501279_000197 | Ga0501279_000197_6662_7642 | 290 |
| 448 | 3300049777 | Ga0501281_00384 | Ga0501281_00384_2809_3789 | 290 |
| 449 | 3300049779 | Ga0501283_000015 | Ga0501283_000015_6306_7286 | 290 |
| 450 | 3300049851 | Ga0501212_007373 | Ga0501212_007373_450_1430 | 290 |
| 451 | 3300049853 | Ga0501226_004624 | Ga0501226_004624_253_1233 | 290 |
| 452 | 3300050508 | nmdc:mga09592_88265_c1 | nmdc:mga09592_88265_c1_794_1795 | 290 |
| 453 | 3300003791 | Ga0055530_10014664 | Ga0055530_100146642 | 291 |
| 454 | 3300005471 | Ga0070698_100164837 | Ga0070698_1001648372 | 291 |
| 455 | 3300025298 | Ga0209050_1000908 | Ga0209050_100090817 | 291 |
| 456 | 3300027907 | Ga0207428_10006333 | Ga0207428_100063332 | 291 |
| 457 | 3300028786 | Ga0307517_10031500 | Ga0307517_100315002 | 291 |
| 458 | 3300031507 | Ga0307509_10000007 | Ga0307509_1000000728 | 291 |
| 459 | 3300031730 | Ga0307516_10114082 | Ga0307516_101140822 | 291 |
| 460 | 3300035113 | Ga0373936_0000035 | Ga0373936_0000035_69573_70598 | 291 |
| 461 | 3300036712 | Ga0316584_0000325 | Ga0316584_0000325_2275_3291 | 291 |
| 462 | 3300037312 | Ga0395899_0004859 | Ga0395899_0004859_5264_6268 | 291 |
| 463 | 3300037418 | Ga0395900_0044586 | Ga0395900_0044586_85_1089 | 291 |
| 464 | 3300037466 | Ga0395898_0139593 | Ga0395898_0139593_55_1059 | 291 |
| 465 | 3300048918 | Ga0496115_0098672 | Ga0496115_0098672_726_1730 | 291 |
| 466 | 3300053090 | Ga0500646_0005402 | Ga0500646_0005402_870_1922 | 291 |
| 467 | 3300053095 | Ga0500640_006413 | Ga0500640_006413_554_1582 | 291 |
| 468 | 3300053102 | Ga0500554_001427 | Ga0500554_001427_558_1586 | 291 |
| 469 | 3300053111 | Ga0500572_003251 | Ga0500572_003251_2101_3129 | 291 |
| 470 | 3300053119 | Ga0500595_000080 | Ga0500595_000080_63560_64588 | 291 |
| 471 | 3300053121 | Ga0500607_150014 | Ga0500607_150014_29_1057 | 291 |
| 472 | 3300053123 | Ga0500614_000998 | Ga0500614_000998_686_1714 | 291 |
| 473 | 3300053136 | Ga0500559_0042880 | Ga0500559_0042880_68_1096 | 291 |
| 474 | 3300053154 | Ga0500619_037329 | Ga0500619_037329_69_1097 | 291 |
| 475 | 3300053080 | Ga0500635_0016485 | Ga0500635_0016485_808_1887 | 292 |
| 476 | 3300053086 | Ga0500578_0051718 | Ga0500578_0051718_672_1760 | 292 |
| 477 | 3300053094 | Ga0500566_0035668 | Ga0500566_0035668_900_1979 | 292 |
| 478 | 3300053094 | Ga0500566_0101427 | Ga0500566_0101427_415_1452 | 292 |
| 479 | 3300053150 | Ga0500603_010891 | Ga0500603_010891_133_1212 | 292 |
| 480 | 3300053177 | Ga0500636_0175579 | Ga0500636_0175579_51_1088 | 292 |
| 481 | 3300031691 | Ga0316579_10003565 | Ga0316579_100035654 | 293 |
| 482 | 3300039062 | Ga0400483_005312 | Ga0400483_005312_712_1701 | 293 |
| 483 | 3300039062 | Ga0400483_224315 | Ga0400483_224315_4853_5842 | 293 |
| 484 | 3300049568 | Ga0501031_0013859 | Ga0501031_0013859_4177_5169 | 293 |
| 485 | 3300049573 | Ga0501037_0013052 | Ga0501037_0013052_3004_3996 | 293 |
| 486 | 3300049575 | Ga0501039_0431830 | Ga0501039_0431830_27_1019 | 293 |
| 487 | 3300049577 | Ga0501041_0073022 | Ga0501041_0073022_997_1989 | 293 |
| 488 | 3300049578 | Ga0501042_0055737 | Ga0501042_0055737_438_1430 | 293 |
| 489 | 3300049592 | Ga0501076_0163347 | Ga0501076_0163347_175_1167 | 293 |
| 490 | 3300050511 | nmdc:mga08y16_579738_c1 | nmdc:mga08y16_579738_c1_48_1100 | 293 |
| 491 | 3300005535 | Ga0070684_100078633 | Ga0070684_1000786332 | 294 |
| 492 | 3300010375 | Ga0105239_10001416 | Ga0105239_1000141617 | 294 |
| 493 | 3300011119 | Ga0105246_10110679 | Ga0105246_101106792 | 294 |
| 494 | 3300025944 | Ga0207661_10032917 | Ga0207661_100329173 | 294 |
| 495 | 3300036647 | Ga0316582_0218205 | Ga0316582_0218205_18_977 | 294 |
| 496 | 3300053122 | Ga0500608_000243 | Ga0500608_000243_7176_8180 | 294 |
| 497 | 3300005295 | Ga0065707_10027286 | Ga0065707_100272862 | 295 |
| 498 | 3300005295 | Ga0065707_10100377 | Ga0065707_101003772 | 295 |
| 499 | 3300005330 | Ga0070690_100000348 | Ga0070690_10000034814 | 295 |
| 500 | 3300005340 | Ga0070689_100000090 | Ga0070689_10000009045 | 295 |
| 501 | 3300005343 | Ga0070687_100027515 | Ga0070687_1000275152 | 295 |
| 502 | 3300005365 | Ga0070688_100000135 | Ga0070688_10000013520 | 295 |
| 503 | 3300005365 | Ga0070688_100269889 | Ga0070688_1002698891 | 295 |
| 504 | 3300005438 | Ga0070701_10045184 | Ga0070701_100451842 | 295 |
| 505 | 3300005441 | Ga0070700_100000257 | Ga0070700_1000002579 | 295 |
| 506 | 3300005441 | Ga0070700_100173444 | Ga0070700_1001734442 | 295 |
| 507 | 3300005444 | Ga0070694_100012346 | Ga0070694_1000123464 | 295 |
| 508 | 3300005444 | Ga0070694_100112811 | Ga0070694_1001128112 | 295 |
| 509 | 3300005444 | Ga0070694_100171004 | Ga0070694_1001710042 | 295 |
| 510 | 3300005458 | Ga0070681_10001753 | Ga0070681_1000175312 | 295 |
| 511 | 3300005459 | Ga0068867_100002470 | Ga0068867_1000024708 | 295 |
| 512 | 3300005466 | Ga0070685_10000073 | Ga0070685_1000007330 | 295 |
| 513 | 3300005467 | Ga0070706_100021603 | Ga0070706_1000216033 | 295 |
| 514 | 3300005468 | Ga0070707_100000018 | Ga0070707_10000001899 | 295 |
| 515 | 3300005468 | Ga0070707_100024642 | Ga0070707_1000246424 | 295 |
| 516 | 3300005468 | Ga0070707_100489467 | Ga0070707_1004894672 | 295 |
| 517 | 3300005471 | Ga0070698_100011560 | Ga0070698_1000115602 | 295 |
| 518 | 3300005471 | Ga0070698_100082096 | Ga0070698_1000820962 | 295 |
| 519 | 3300005471 | Ga0070698_100142901 | Ga0070698_1001429013 | 295 |
| 520 | 3300005518 | Ga0070699_100005710 | Ga0070699_1000057102 | 295 |
| 521 | 3300005518 | Ga0070699_100082524 | Ga0070699_1000825243 | 295 |
| 522 | 3300005536 | Ga0070697_100090641 | Ga0070697_1000906412 | 295 |
| 523 | 3300005544 | Ga0070686_100000089 | Ga0070686_10000008960 | 295 |
| 524 | 3300005544 | Ga0070686_100010699 | Ga0070686_1000106993 | 295 |
| 525 | 3300005545 | Ga0070695_100015463 | Ga0070695_1000154632 | 295 |
| 526 | 3300005547 | Ga0070693_100041818 | Ga0070693_1000418183 | 295 |
| 527 | 3300005549 | Ga0070704_100054340 | Ga0070704_1000543403 | 295 |
| 528 | 3300005549 | Ga0070704_100070773 | Ga0070704_1000707733 | 295 |
| 529 | 3300005617 | Ga0068859_100002892 | Ga0068859_10000289218 | 295 |
| 530 | 3300005617 | Ga0068859_100400751 | Ga0068859_1004007511 | 295 |
| 531 | 3300005719 | Ga0068861_100163883 | Ga0068861_1001638832 | 295 |
| 532 | 3300005844 | Ga0068862_100347006 | Ga0068862_1003470062 | 295 |
| 533 | 3300006237 | Ga0097621_100009427 | Ga0097621_1000094274 | 295 |
| 534 | 3300006358 | Ga0068871_100110325 | Ga0068871_1001103252 | 295 |
| 535 | 3300006852 | Ga0075433_10002999 | Ga0075433_100029995 | 295 |
| 536 | 3300006871 | Ga0075434_100050376 | Ga0075434_1000503763 | 295 |
| 537 | 3300006931 | Ga0097620_100002892 | Ga0097620_10000289218 | 295 |
| 538 | 3300006931 | Ga0097620_100400764 | Ga0097620_1004007641 | 295 |
| 539 | 3300009098 | Ga0105245_10252055 | Ga0105245_102520552 | 295 |
| 540 | 3300009176 | Ga0105242_10013265 | Ga0105242_100132653 | 295 |
| 541 | 3300014325 | Ga0163163_10199296 | Ga0163163_101992962 | 295 |
| 542 | 3300014969 | Ga0157376_10003733 | Ga0157376_100037332 | 295 |
| 543 | 3300025912 | Ga0207707_10010179 | Ga0207707_100101793 | 295 |
| 544 | 3300025917 | Ga0207660_10125724 | Ga0207660_101257242 | 295 |
| 545 | 3300025918 | Ga0207662_10007367 | Ga0207662_100073675 | 295 |
| 546 | 3300025922 | Ga0207646_10000072 | Ga0207646_10000072101 | 295 |
| 547 | 3300025927 | Ga0207687_10136843 | Ga0207687_101368432 | 295 |
| 548 | 3300025936 | Ga0207670_10000032 | Ga0207670_1000003264 | 295 |
| 549 | 3300025939 | Ga0207665_10060502 | Ga0207665_100605024 | 295 |
| 550 | 3300025941 | Ga0207711_10001788 | Ga0207711_1000178811 | 295 |
| 551 | 3300026075 | Ga0207708_10000413 | Ga0207708_1000041333 | 295 |
| 552 | 3300026118 | Ga0207675_100200856 | Ga0207675_1002008562 | 295 |
| 553 | 3300027717 | Ga0209998_10019074 | Ga0209998_100190742 | 295 |
| 554 | 3300031727 | Ga0316576_10011115 | Ga0316576_100111151 | 295 |
| 555 | 3300035086 | Ga0373934_0059328 | Ga0373934_0059328_456_1466 | 295 |
| 556 | 3300035113 | Ga0373936_0085388 | Ga0373936_0085388_242_1252 | 295 |
| 557 | 3300035410 | Ga0373924_0027753 | Ga0373924_0027753_475_1485 | 295 |
| 558 | 3300035692 | Ga0373935_0012043 | Ga0373935_0012043_3012_4022 | 295 |
| 559 | 3300035724 | Ga0373933_0069486 | Ga0373933_0069486_672_1682 | 295 |
| 560 | 3300035725 | Ga0373947_0016709 | Ga0373947_0016709_2289_3299 | 295 |
| 561 | 3300036401 | Ga0373937_0031486 | Ga0373937_0031486_2229_3239 | 295 |
| 562 | 3300037068 | Ga0373925_0154412 | Ga0373925_0154412_318_1328 | 295 |
| 563 | 3300038443 | Ga0395901_0091814 | Ga0395901_0091814_1092_2183 | 295 |
| 564 | 3300042876 | Ga0451577_0180898 | Ga0451577_0180898_325_1335 | 295 |
| 565 | 3300046459 | Ga0495629_0013291 | Ga0495629_0013291_3392_4402 | 295 |
| 566 | 3300046472 | Ga0495580_0115243 | Ga0495580_0115243_461_1471 | 295 |
| 567 | 3300046499 | Ga0495594_0025000 | Ga0495594_0025000_1771_2781 | 295 |
| 568 | 3300046519 | Ga0495632_0066854 | Ga0495632_0066854_340_1401 | 295 |
| 569 | 3300046536 | Ga0495587_0084415 | Ga0495587_0084415_366_1376 | 295 |
| 570 | 3300046683 | Ga0495658_0105600 | Ga0495658_0105600_207_1217 | 295 |
| 571 | 3300053077 | Ga0495601_0029104 | Ga0495601_0029104_1465_2475 | 295 |
| 572 | 3300053077 | Ga0495601_0059194 | Ga0495601_0059194_714_1724 | 295 |
| 573 | 3300053085 | Ga0495619_0070253 | Ga0495619_0070253_1154_2164 | 295 |
| 574 | 3300002075 | JGI24738J21930_10015755 | JGI24738J21930_100157551 | 296 |
| 575 | 3300002126 | JGI24035J26624_1001644 | JGI24035J26624_10016442 | 296 |
| 576 | 3300005328 | Ga0070676_10001419 | Ga0070676_100014196 | 296 |
| 577 | 3300005334 | Ga0068869_100091429 | Ga0068869_1000914292 | 296 |
| 578 | 3300005457 | Ga0070662_100003227 | Ga0070662_1000032276 | 296 |
| 579 | 3300009098 | Ga0105245_10029838 | Ga0105245_100298384 | 296 |
| 580 | 3300009147 | Ga0114129_10106309 | Ga0114129_101063093 | 296 |
| 581 | 3300009553 | Ga0105249_10007377 | Ga0105249_100073775 | 296 |
| 582 | 3300010375 | Ga0105239_10005383 | Ga0105239_100053837 | 296 |
| 583 | 3300013296 | Ga0157374_10036693 | Ga0157374_100366933 | 296 |
| 584 | 3300013297 | Ga0157378_10013383 | Ga0157378_100133832 | 296 |
| 585 | 3300013306 | Ga0163162_10005848 | Ga0163162_100058484 | 296 |
| 586 | 3300013308 | Ga0157375_10189802 | Ga0157375_101898022 | 296 |
| 587 | 3300025315 | Ga0207697_10000198 | Ga0207697_100001985 | 296 |
| 588 | 3300025907 | Ga0207645_10000634 | Ga0207645_1000063420 | 296 |
| 589 | 3300025933 | Ga0207706_10000702 | Ga0207706_1000070222 | 296 |
| 590 | 3300025972 | Ga0207668_10006913 | Ga0207668_100069136 | 296 |
| 591 | 3300045051 | Ga0451576_0019910 | Ga0451576_0019910_3691_4584 | 296 |
| 592 | 3300050507 | nmdc:mga05p37_85784_c1 | nmdc:mga05p37_85784_c1_1924_2940 | 296 |
| 593 | 3300003322 | rootL2_10186783 | rootL2_101867832 | 297 |
| 594 | 3300009094 | Ga0111539_10012258 | Ga0111539_100122588 | 297 |
| 595 | 3300009094 | Ga0111539_10497852 | Ga0111539_104978521 | 297 |
| 596 | 3300028800 | Ga0265338_10030516 | Ga0265338_100305163 | 299 |
| 597 | 3300049586 | Ga0501070_0041974 | Ga0501070_0041974_1211_2113 | 300 |
| 598 | 3300001991 | JGI24743J22301_10000044 | JGI24743J22301_100000445 | 301 |
| 599 | 3300003320 | rootH2_10011145 | rootH2_100111457 | 301 |
| 600 | 3300003322 | rootL2_10039822 | rootL2_100398222 | 301 |
| 601 | 3300003322 | rootL2_10074460 | rootL2_100744602 | 301 |
| 602 | 3300025901 | Ga0207688_10003742 | Ga0207688_100037422 | 301 |
| 603 | 3300044683 | Ga0466965_0007338 | Ga0466965_0007338_37_945 | 301 |
| 604 | 3300044719 | Ga0466971_0000025 | Ga0466971_0000025_29516_30424 | 301 |
| 605 | 3300049570 | Ga0501033_0000083 | Ga0501033_0000083_29971_30879 | 301 |
| 606 | 3300049572 | Ga0501036_0036576 | Ga0501036_0036576_3208_4116 | 301 |
| 607 | 3300049573 | Ga0501037_0000083 | Ga0501037_0000083_50567_51475 | 301 |
| 608 | 3300049574 | Ga0501038_0000329 | Ga0501038_0000329_33090_33998 | 301 |
| 609 | 3300049574 | Ga0501038_0022409 | Ga0501038_0022409_3621_4529 | 301 |
| 610 | 3300049574 | Ga0501038_0032868 | Ga0501038_0032868_990_1898 | 301 |
| 611 | 3300049575 | Ga0501039_0002998 | Ga0501039_0002998_8409_9317 | 301 |
| 612 | 3300049579 | Ga0501043_0002418 | Ga0501043_0002418_1510_2418 | 301 |
| 613 | 3300049579 | Ga0501043_0017594 | Ga0501043_0017594_1510_2418 | 301 |
| 614 | 3300049581 | Ga0501047_0002692 | Ga0501047_0002692_12015_12923 | 301 |
| 615 | 3300049583 | Ga0501067_0065861 | Ga0501067_0065861_281_1189 | 301 |
| 616 | 3300049586 | Ga0501070_0005200 | Ga0501070_0005200_5987_6895 | 301 |
| 617 | 3300049822 | Ga0501035_0000001 | Ga0501035_0000001_495590_496498 | 301 |
| 618 | 3300049823 | Ga0501044_0000159 | Ga0501044_0000159_43506_44414 | 301 |
| 619 | 3300049824 | Ga0501045_0180862 | Ga0501045_0180862_104_1012 | 301 |
| 620 | 3300053730 | Ga0500645_007906 | Ga0500645_007906_731_1636 | 301 |
| 621 | 3300002155 | JGI24033J26618_1000066 | JGI24033J26618_100006611 | 302 |
| 622 | 3300003322 | rootL2_10156277 | rootL2_101562773 | 302 |
| 623 | 3300003323 | rootH1_10001752 | rootH1_100017524 | 302 |
| 624 | 3300005344 | Ga0070661_100000479 | Ga0070661_10000047924 | 302 |
| 625 | 3300005354 | Ga0070675_100157950 | Ga0070675_1001579502 | 302 |
| 626 | 3300005456 | Ga0070678_100151009 | Ga0070678_1001510092 | 302 |
| 627 | 3300005614 | Ga0068856_100000537 | Ga0068856_10000053728 | 302 |
| 628 | 3300013296 | Ga0157374_10011253 | Ga0157374_100112532 | 302 |
| 629 | 3300013297 | Ga0157378_10000857 | Ga0157378_100008574 | 302 |
| 630 | 3300013308 | Ga0157375_10103480 | Ga0157375_101034802 | 302 |
| 631 | 3300025920 | Ga0207649_10000427 | Ga0207649_1000042713 | 302 |
| 632 | 3300025926 | Ga0207659_10168936 | Ga0207659_101689362 | 302 |
| 633 | 3300026078 | Ga0207702_10003806 | Ga0207702_100038068 | 302 |
| 634 | 3300037312 | Ga0395899_0000015 | Ga0395899_0000015_373953_374864 | 302 |
| 635 | 3300037466 | Ga0395898_0000051 | Ga0395898_0000051_119650_120561 | 302 |
| 636 | 3300049569 | Ga0501032_0000504 | Ga0501032_0000504_25745_26656 | 302 |
| 637 | 3300049570 | Ga0501033_0000003 | Ga0501033_0000003_50521_51432 | 302 |
| 638 | 3300053104 | Ga0500556_0003471 | Ga0500556_0003471_3050_3958 | 302 |
| 639 | 3300042876 | Ga0451577_0521500 | Ga0451577_0521500_103_1026 | 304 |
| 640 | 3300049589 | Ga0501073_0038848 | Ga0501073_0038848_67_990 | 305 |
| 641 | 3300060353 | Ga0501082_0534850 | Ga0501082_0534850_57_980 | 305 |
| 642 | 3300021384 | Ga0213876_10028194 | Ga0213876_100281942 | 306 |
| 643 | 3300039437 | Ga0436365_0014080 | Ga0436365_0014080_25_1005 | 306 |
| 644 | 3300005518 | Ga0070699_100070201 | Ga0070699_1000702012 | 309 |
| 645 | 3300005536 | Ga0070697_100089572 | Ga0070697_1000895722 | 309 |
| 646 | 3300001977 | JGI24746J21847_1003444 | JGI24746J21847_10034442 | 310 |
| 647 | 3300005338 | Ga0068868_100019130 | Ga0068868_1000191303 | 310 |
| 648 | 3300005340 | Ga0070689_100009358 | Ga0070689_1000093584 | 310 |
| 649 | 3300005347 | Ga0070668_100013058 | Ga0070668_1000130582 | 310 |
| 650 | 3300005353 | Ga0070669_100014808 | Ga0070669_1000148082 | 310 |
| 651 | 3300005354 | Ga0070675_100013175 | Ga0070675_1000131753 | 310 |
| 652 | 3300005366 | Ga0070659_100019927 | Ga0070659_1000199272 | 310 |
| 653 | 3300005367 | Ga0070667_100056590 | Ga0070667_1000565902 | 310 |
| 654 | 3300005445 | Ga0070708_100104158 | Ga0070708_1001041582 | 310 |
| 655 | 3300005468 | Ga0070707_100037631 | Ga0070707_1000376313 | 310 |
| 656 | 3300005545 | Ga0070695_100150832 | Ga0070695_1001508322 | 310 |
| 657 | 3300005549 | Ga0070704_100080429 | Ga0070704_1000804292 | 310 |
| 658 | 3300005719 | Ga0068861_100369053 | Ga0068861_1003690531 | 310 |
| 659 | 3300005844 | Ga0068862_100007910 | Ga0068862_1000079106 | 310 |
| 660 | 3300025918 | Ga0207662_10280271 | Ga0207662_102802712 | 310 |
| 661 | 3300025922 | Ga0207646_10043660 | Ga0207646_100436602 | 310 |
| 662 | 3300025939 | Ga0207665_10064074 | Ga0207665_100640743 | 310 |
| 663 | 3300025942 | Ga0207689_10283640 | Ga0207689_102836402 | 310 |
| 664 | 3300025961 | Ga0207712_10052076 | Ga0207712_100520762 | 310 |
| 665 | 3300025986 | Ga0207658_10008718 | Ga0207658_100087184 | 310 |
| 666 | 3300026118 | Ga0207675_100134666 | Ga0207675_1001346662 | 310 |
| 667 | 3300028380 | Ga0268265_10028020 | Ga0268265_100280202 | 310 |
| 668 | 3300048911 | Ga0496108_0246796 | Ga0496108_0246796_561_1499 | 310 |
| 669 | 3300048918 | Ga0496115_0018467 | Ga0496115_0018467_4119_5057 | 310 |
| 670 | 2162886012 | MBSR1b_contig_13535307 | MBSR1b_0502.00002360 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nri-assembly2.cif.gz_B | crystal structure of burkholderia pseudomallei d-alanine-d-alanine ligase in complex with amp and d-ala-d-ala | 0.9165 | 12 | 306 |
| 1iow-assembly1.cif.gz_A | complex of y216f d-ala:d-ala ligase with adp and a phosphoryl phosphinate | 0.9157 | 9 | 305 |
| 4c5b-assembly1.cif.gz_A | the x-ray crystal structure of d-alanyl-d-alanine ligase in complex with atp and d-ala-d-ala | 0.9149 | 9 | 305 |
| 8evx-assembly1.cif.gz_B | ddla from pseudomonas aeruginosa pao1 in complex with adp and phosphorylated d-cycloserine | 0.903 | 12 | 309 |
| 7u9k-assembly1.cif.gz_B | staphylococcus aureus d-alanine-d-alanine ligase in complex with atp, d-ala-d-ala, mg2+ and k+ | 0.9003 | 13 | 312 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5bpfD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9487 | 91 | 305 | 3.30.470.20 |
| 5bpfD02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9294 | 91 | 305 | 3.30.470.20 |
| 3q1kB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9071 | 176 | 312 | 3.30.470.20 |
| 2i8cA02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.905 | 91 | 312 | 3.30.470.20 |
| 2yzgC02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.9027 | 92 | 307 | 3.30.470.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352XNI3-F1-model_v4 | D-alanine--D-alanine ligase | 0.9972 | 11 | 87 |
GO:0016874
|
| AF-A0A059X3G1-F1-model_v4 | D-ala D-ala ligase N-terminus | 0.9902 | 9 | 127 |
GO:0008716
|
| AF-A0A7W0YC08-F1-model_v4 | D-alanine--D-alanine ligase (EC 6.3.2.4) | 0.9876 | 11 | 273 |
GO:0005524
GO:0008716 GO:0046872 GO:0071555 |
| AF-A0A2V6JM71-F1-model_v4 | D-alanine--D-alanine ligase | 0.9757 | 8 | 174 |
GO:0005524
GO:0008716 GO:0046872 GO:0071555 |
| AF-A0A7U6DW68-F1-model_v4 | deleted | 0.9693 | 61 | 311 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar