F474104

General Info

Members Datasets Scaffolds Average Seq Length
670 390 669 324

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0091814|Ga0395901_0091814_1092_2183
Length 363
Sequence VLFFFAIARVPTTTSGQKIADYPRFLQRWMYMKFRKIGVLLGGLSSERDVSLRTGEAVLEALRARGHEAVPIYVDHDVDIALRQEQIDVAFIALHGRWGEDGCIQGLLELQGIPYTGSDVMSSALAMHKGKAKELFRLHNLPTPAYYTLAPEDCADLPGVHGDFGFPCVVKPIREGSSVGVTICHTLDDLGPAVERAFAFDDEVLVERFISGKEISVAVLGDRALGAVEIAPREGFYDYQNKYTRGATDYFVPPRLSPERYRGVLAQALRAHIALGCHGATRVDMMVSESGNEYILEVNTVPGLTPTSLLPKIADAAGISFGELCELMLAGASLSSRRGRGERRVVQRTFVGEDRREPAPPAH

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2684623219 Planctomyces sp. SH-PL14 Isolate Unclassified
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
178 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
179 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
202 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
203 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
205 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
206 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
207 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
215 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
228 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
231 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
232 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
247 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
248 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
253 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
260 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
269 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
270 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
271 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
272 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
273 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
274 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
275 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
276 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
277 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
278 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
279 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
305 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
306 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
307 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
308 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
309 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
310 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
311 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
312 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
313 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
314 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
315 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
316 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
317 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
318 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
319 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
320 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
321 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
322 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
323 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
324 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
325 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
326 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
327 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
328 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
329 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
330 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
331 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
332 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
333 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
338 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
339 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
340 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
341 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
342 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
343 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
344 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
345 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
346 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
347 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
348 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
349 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
350 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
353 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
368 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
369 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
370 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
371 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
372 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
373 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
374 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
375 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
376 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
379 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
380 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
381 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
382 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
383 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
384 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
385 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
386 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
390 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.88
Nodule 0
Rhizoplane 0.6
Rhizosphere 91.94
Stem 0
Stem Tuber 0
Unclassified 3.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13535307 2162886012 Unclassified 1268
2 JGI24746J21847_1003444 3300001977 Unclassified 2490
3 JGI24737J22298_10032482 3300001990 Unclassified 1625
4 JGI24743J22301_10000044 3300001991 Bacteria 11132
5 JGI24738J21930_10015755 3300002075 Unclassified 1603
6 JGI24035J26624_1001644 3300002126 Unclassified 2102
7 JGI24033J26618_1000066 3300002155 Bacteria 15346
8 rootH2_10011145 3300003320 Bacteria 22144
9 rootL2_10039822 3300003322 Bacteria 2025
10 rootL2_10074460 3300003322 Bacteria 2868
11 rootL2_10156277 3300003322 Bacteria 2243
12 rootL2_10186783 3300003322 Bacteria 5939
13 rootH1_10001752 3300003323 Bacteria 14969
14 Ga0055530_10014664 3300003791 Bacteria 2598
15 Ga0065707_10027286 3300005295 Bacteria 1901
16 Ga0065707_10099442 3300005295 Bacteria 3006
17 Ga0065707_10100377 3300005295 Unclassified 2933
18 Ga0070658_10032927 3300005327 Bacteria 4168
19 Ga0070676_10001419 3300005328 Bacteria 12100
20 Ga0070676_10064494 3300005328 Unclassified 2184
21 Ga0070690_100000348 3300005330 Bacteria 23853
22 Ga0070690_100015663 3300005330 Bacteria 4529
23 Ga0070690_100027931 3300005330 Bacteria 3492
24 Ga0070690_100030630 3300005330 Bacteria 3345
25 Ga0070670_100015844 3300005331 Bacteria 6469
26 Ga0070670_100206980 3300005331 Bacteria 1705
27 Ga0070677_10030097 3300005333 Bacteria 2064
28 Ga0068869_100086837 3300005334 Unclassified 2346
29 Ga0068869_100091429 3300005334 Bacteria 2289
30 Ga0070666_10012329 3300005335 Bacteria 5389
31 Ga0070680_100004415 3300005336 Bacteria 10586
32 Ga0070680_100031682 3300005336 Bacteria 4252
33 Ga0070680_100033394 3300005336 Bacteria 4147
34 Ga0070682_100016500 3300005337 Bacteria 4294
35 Ga0070682_100063363 3300005337 Bacteria 2344
36 Ga0070682_100082376 3300005337 Bacteria 2085
37 Ga0068868_100019130 3300005338 Bacteria 5129
38 Ga0068868_100038099 3300005338 Bacteria 3731
39 Ga0070660_100029788 3300005339 Bacteria 4092
40 Ga0070689_100000090 3300005340 Bacteria 52338
41 Ga0070689_100001519 3300005340 Bacteria 14805
42 Ga0070689_100004336 3300005340 Bacteria 9572
43 Ga0070689_100009358 3300005340 Bacteria 6943
44 Ga0070689_100129152 3300005340 Bacteria 2025
45 Ga0070687_100001354 3300005343 Bacteria 8602
46 Ga0070687_100023969 3300005343 Bacteria 2906
47 Ga0070687_100027515 3300005343 Bacteria 2748
48 Ga0070661_100000479 3300005344 Bacteria 30510
49 Ga0070661_100018849 3300005344 Bacteria 4912
50 Ga0070692_10054249 3300005345 Bacteria 2092
51 Ga0070668_100013058 3300005347 Bacteria 6187
52 Ga0070668_100071182 3300005347 Unclassified 2709
53 Ga0070668_100147751 3300005347 Bacteria 1898
54 Ga0070669_100007357 3300005353 Bacteria 7896
55 Ga0070669_100014808 3300005353 Bacteria 5553
56 Ga0070675_100013175 3300005354 Bacteria 6497
57 Ga0070675_100041338 3300005354 Bacteria 3766
58 Ga0070675_100157950 3300005354 Bacteria 1948
59 Ga0070671_100514142 3300005355 Bacteria 1031
60 Ga0070674_100000394 3300005356 Bacteria 21894
61 Ga0070673_100139017 3300005364 Unclassified 2047
62 Ga0070688_100000135 3300005365 Bacteria 39766
63 Ga0070688_100002702 3300005365 Bacteria 8996
64 Ga0070688_100045669 3300005365 Bacteria 2708
65 Ga0070688_100269889 3300005365 Bacteria 1218
66 Ga0070659_100000985 3300005366 Bacteria 20906
67 Ga0070659_100019927 3300005366 Bacteria 5091
68 Ga0070667_100056590 3300005367 Bacteria 3313
69 Ga0070710_10068984 3300005437 Bacteria 2033
70 Ga0070701_10045184 3300005438 Unclassified 2259
71 Ga0070701_10080414 3300005438 Bacteria 1763
72 Ga0070705_100006180 3300005440 Bacteria 5865
73 Ga0070705_100038236 3300005440 Bacteria 2713
74 Ga0070705_100060010 3300005440 Bacteria 2254
75 Ga0070700_100000257 3300005441 Bacteria 28570
76 Ga0070700_100173444 3300005441 Bacteria 1495
77 Ga0070694_100006125 3300005444 Bacteria 7296
78 Ga0070694_100012346 3300005444 Bacteria 5307
79 Ga0070694_100112811 3300005444 Bacteria 1939
80 Ga0070694_100171004 3300005444 Bacteria 1601
81 Ga0070708_100104158 3300005445 Bacteria 2602
82 Ga0070663_100247157 3300005455 Unclassified 1411
83 Ga0070678_100002606 3300005456 Bacteria 9915
84 Ga0070678_100151009 3300005456 Bacteria 1871
85 Ga0070662_100003227 3300005457 Bacteria 10137
86 Ga0070681_10001753 3300005458 Bacteria 19441
87 Ga0070681_10003614 3300005458 Bacteria 14505
88 Ga0070681_10049211 3300005458 Bacteria 4210
89 Ga0070681_10218431 3300005458 Bacteria 1822
90 Ga0070681_10253915 3300005458 Bacteria 1670
91 Ga0068867_100001546 3300005459 Bacteria 15988
92 Ga0068867_100002470 3300005459 Bacteria 13001
93 Ga0068867_100170770 3300005459 Bacteria 1722
94 Ga0070685_10000073 3300005466 Bacteria 59457
95 Ga0070685_10001193 3300005466 Bacteria 13886
96 Ga0070685_10075920 3300005466 Unclassified 2003
97 Ga0070706_100000878 3300005467 Bacteria 33009
98 Ga0070706_100002645 3300005467 Bacteria 17929
99 Ga0070706_100021603 3300005467 Bacteria 5926
100 Ga0070706_100031624 3300005467 Bacteria 4880
101 Ga0070707_100000018 3300005468 Bacteria 137542
102 Ga0070707_100024642 3300005468 Bacteria 5700
103 Ga0070707_100037631 3300005468 Bacteria 4618
104 Ga0070707_100162323 3300005468 Unclassified 2177
105 Ga0070707_100489467 3300005468 Unclassified 1191
106 Ga0070698_100000114 3300005471 Bacteria 68309
107 Ga0070698_100011560 3300005471 Bacteria 9365
108 Ga0070698_100082096 3300005471 Bacteria 3216
109 Ga0070698_100142901 3300005471 Bacteria 2344
110 Ga0070698_100164837 3300005471 Bacteria 2159
111 Ga0070698_100335125 3300005471 Bacteria 1444
112 Ga0070699_100005710 3300005518 Bacteria 10898
113 Ga0070699_100070201 3300005518 Bacteria 3045
114 Ga0070699_100082524 3300005518 Bacteria 2802
115 Ga0070679_100001459 3300005530 Bacteria 20941
116 Ga0070679_100047591 3300005530 Bacteria 4273
117 Ga0070684_100078633 3300005535 Bacteria 2914
118 Ga0070684_100503871 3300005535 Bacteria 1121
119 Ga0070697_100089572 3300005536 Bacteria 2542
120 Ga0070697_100090641 3300005536 Bacteria 2527
121 Ga0070672_100006069 3300005543 Bacteria 8075
122 Ga0070686_100000089 3300005544 Bacteria 64287
123 Ga0070686_100004655 3300005544 Bacteria 7568
124 Ga0070686_100010699 3300005544 Bacteria 5185
125 Ga0070695_100007325 3300005545 Bacteria 6540
126 Ga0070695_100015463 3300005545 Unclassified 4609
127 Ga0070695_100150832 3300005545 Bacteria 1622
128 Ga0070695_100248110 3300005545 Unclassified 1294
129 Ga0070696_100047305 3300005546 Bacteria 2985
130 Ga0070693_100041818 3300005547 Unclassified 2580
131 Ga0070665_100002307 3300005548 Bacteria 21174
132 Ga0070704_100027484 3300005549 Bacteria 3775
133 Ga0070704_100054340 3300005549 Unclassified 2834
134 Ga0070704_100070773 3300005549 Bacteria 2532
135 Ga0070704_100080429 3300005549 Bacteria 2397
136 Ga0068855_100174913 3300005563 Bacteria 2430
137 Ga0068855_100392142 3300005563 Bacteria 1523
138 Ga0070664_100006608 3300005564 Bacteria 9349
139 Ga0070664_100021093 3300005564 Bacteria 5367
140 Ga0068857_100059905 3300005577 Unclassified 3383
141 Ga0068856_100000537 3300005614 Bacteria 41817
142 Ga0068856_100058687 3300005614 Bacteria 3801
143 Ga0068856_100186254 3300005614 Bacteria 2090
144 Ga0068859_100002892 3300005617 Bacteria 17446
145 Ga0068859_100119805 3300005617 Bacteria 2698
146 Ga0068859_100400751 3300005617 Bacteria 1468
147 Ga0068864_100175150 3300005618 Bacteria 1958
148 Ga0068866_10054688 3300005718 Bacteria 2046
149 Ga0068861_100163883 3300005719 Bacteria 1836
150 Ga0068861_100218688 3300005719 Bacteria 1609
151 Ga0068861_100369053 3300005719 Bacteria 1264
152 Ga0068858_100135974 3300005842 Bacteria 2306
153 Ga0068860_100017638 3300005843 Bacteria 6955
154 Ga0068860_100245921 3300005843 Unclassified 1741
155 Ga0068862_100007910 3300005844 Bacteria 8794
156 Ga0068862_100021260 3300005844 Bacteria 5423
157 Ga0068862_100164946 3300005844 Bacteria 1980
158 Ga0068862_100347006 3300005844 Bacteria 1376
159 Ga0081455_10000594 3300005937 Bacteria 46883
160 Ga0070717_10024090 3300006028 Bacteria 4830
161 Ga0075432_10001979 3300006058 Bacteria 6811
162 Ga0070715_10035796 3300006163 Bacteria 2044
163 Ga0097621_100009427 3300006237 Bacteria 7083
164 Ga0097621_100037112 3300006237 Bacteria 3902
165 Ga0068871_100005816 3300006358 Bacteria 8666
166 Ga0068871_100110325 3300006358 Unclassified 2313
167 Ga0075428_100256170 3300006844 Bacteria 1885
168 Ga0075428_100295348 3300006844 Unclassified 1742
169 Ga0075430_100001325 3300006846 Bacteria 19981
170 Ga0075430_100001910 3300006846 Bacteria 17094
171 Ga0075431_100003065 3300006847 Bacteria 16180
172 Ga0075433_10002999 3300006852 Bacteria 12967
173 Ga0075433_10076304 3300006852 Bacteria 2951
174 Ga0075433_10111981 3300006852 Unclassified 2421
175 Ga0075433_10214902 3300006852 Bacteria 1709
176 Ga0075434_100050376 3300006871 Unclassified 4137
177 Ga0075434_100119547 3300006871 Bacteria 2649
178 Ga0075434_100141571 3300006871 Unclassified 2425
179 Ga0075434_100473178 3300006871 Bacteria 1274
180 Ga0075429_100001252 3300006880 Bacteria 20630
181 Ga0075429_100005851 3300006880 Bacteria 10609
182 Ga0075429_100082207 3300006880 Bacteria 2807
183 Ga0075429_100098362 3300006880 Unclassified 2553
184 Ga0075429_100144221 3300006880 Unclassified 2084
185 Ga0068865_100004478 3300006881 Bacteria 8429
186 Ga0068865_100010331 3300006881 Bacteria 5807
187 Ga0075436_100149379 3300006914 Bacteria 1644
188 Ga0097620_100002892 3300006931 Bacteria 17446
189 Ga0097620_100119801 3300006931 Bacteria 2698
190 Ga0097620_100400764 3300006931 Bacteria 1468
191 Ga0075435_100045650 3300007076 Bacteria 3513
192 Ga0075435_100097970 3300007076 Bacteria 2427
193 Ga0111539_10007846 3300009094 Bacteria 13632
194 Ga0111539_10012258 3300009094 Bacteria 10751
195 Ga0111539_10260481 3300009094 Bacteria 2019
196 Ga0111539_10497852 3300009094 Bacteria 1419
197 Ga0105245_10000099 3300009098 Bacteria 83865
198 Ga0105245_10029838 3300009098 Bacteria 4821
199 Ga0105245_10118545 3300009098 Unclassified 2470
200 Ga0105245_10252055 3300009098 Bacteria 1715
201 Ga0114129_10023328 3300009147 Bacteria 8777
202 Ga0114129_10067741 3300009147 Bacteria 4977
203 Ga0114129_10106309 3300009147 Bacteria 3877
204 Ga0114129_10126336 3300009147 Bacteria 3516
205 Ga0114129_10279486 3300009147 Bacteria 2231
206 Ga0105243_10004891 3300009148 Bacteria 10511
207 Ga0105241_10040792 3300009174 Bacteria 3505
208 Ga0105242_10013265 3300009176 Bacteria 6363
209 Ga0105242_10045229 3300009176 Bacteria 3567
210 Ga0105242_10087944 3300009176 Unclassified 2609
211 Ga0105248_10000908 3300009177 Bacteria 33049
212 Ga0105249_10007377 3300009553 Bacteria 9591
213 Ga0105249_10048253 3300009553 Bacteria 3882
214 Ga0105249_10148930 3300009553 Bacteria 2251
215 Ga0105239_10001416 3300010375 Bacteria 31991
216 Ga0105239_10005383 3300010375 Bacteria 15034
217 Ga0105239_10022606 3300010375 Bacteria 6933
218 Ga0105239_10231783 3300010375 Bacteria 2072
219 Ga0105246_10000200 3300011119 Bacteria 30052
220 Ga0105246_10110679 3300011119 Unclassified 2017
221 Ga0157369_10036432 3300013105 Bacteria 5389
222 Ga0157374_10011253 3300013296 Bacteria 7740
223 Ga0157374_10036693 3300013296 Bacteria 4492
224 Ga0157374_10128846 3300013296 Unclassified 2447
225 Ga0157374_10189801 3300013296 Bacteria 2010
226 Ga0157378_10000857 3300013297 Bacteria 28196
227 Ga0157378_10011945 3300013297 Bacteria 7603
228 Ga0157378_10013383 3300013297 Bacteria 7170
229 Ga0163162_10005848 3300013306 Bacteria 11898
230 Ga0163162_10192709 3300013306 Bacteria 2166
231 Ga0157375_10002941 3300013308 Bacteria 14773
232 Ga0157375_10103480 3300013308 Bacteria 2934
233 Ga0157375_10189802 3300013308 Bacteria 2209
234 Ga0163163_10199296 3300014325 Bacteria 2050
235 Ga0157380_10014684 3300014326 Bacteria 5735
236 Ga0157380_10240263 3300014326 Bacteria 1632
237 Ga0157377_10019343 3300014745 Bacteria 3557
238 Ga0157376_10003733 3300014969 Bacteria 10522
239 Ga0157376_10055439 3300014969 Bacteria 3307
240 Ga0157376_10192628 3300014969 Bacteria 1870
241 Ga0213876_10028194 3300021384 Bacteria 2959
242 Ga0209050_1000908 3300025298 Bacteria 39172
243 Ga0207697_10000198 3300025315 Bacteria 32108
244 Ga0207642_10037612 3300025899 Bacteria 2087
245 Ga0207688_10003742 3300025901 Bacteria 8302
246 Ga0207688_10004420 3300025901 Bacteria 7651
247 Ga0207699_10151304 3300025906 Bacteria 1536
248 Ga0207645_10000634 3300025907 Bacteria 29170
249 Ga0207645_10001133 3300025907 Bacteria 22060
250 Ga0207705_10110184 3300025909 Bacteria 2034
251 Ga0207684_10000198 3300025910 Bacteria 95038
252 Ga0207654_10034950 3300025911 Bacteria 2796
253 Ga0207707_10010179 3300025912 Bacteria 8161
254 Ga0207707_10269655 3300025912 Bacteria 1475
255 Ga0207660_10012261 3300025917 Bacteria 5603
256 Ga0207660_10014792 3300025917 Bacteria 5142
257 Ga0207660_10125724 3300025917 Bacteria 1947
258 Ga0207662_10007367 3300025918 Bacteria 5987
259 Ga0207662_10025917 3300025918 Bacteria 3379
260 Ga0207662_10280271 3300025918 Bacteria 1103
261 Ga0207657_10005985 3300025919 Bacteria 12658
262 Ga0207649_10000427 3300025920 Bacteria 30819
263 Ga0207649_10116466 3300025920 Unclassified 1794
264 Ga0207652_10017078 3300025921 Bacteria 5936
265 Ga0207652_10126027 3300025921 Bacteria 2281
266 Ga0207652_10219239 3300025921 Bacteria 1714
267 Ga0207646_10000072 3300025922 Bacteria 141756
268 Ga0207646_10043660 3300025922 Bacteria 4025
269 Ga0207681_10001480 3300025923 Bacteria 15139
270 Ga0207650_10118955 3300025925 Unclassified 2054
271 Ga0207650_10277150 3300025925 Bacteria 1365
272 Ga0207659_10027546 3300025926 Bacteria 3849
273 Ga0207659_10084688 3300025926 Unclassified 2353
274 Ga0207659_10168936 3300025926 Bacteria 1724
275 Ga0207687_10000774 3300025927 Bacteria 21584
276 Ga0207687_10136843 3300025927 Bacteria 1853
277 Ga0207690_10054181 3300025932 Bacteria 2695
278 Ga0207706_10000702 3300025933 Bacteria 35016
279 Ga0207706_10003909 3300025933 Bacteria 14140
280 Ga0207686_10005846 3300025934 Bacteria 6601
281 Ga0207670_10000032 3300025936 Bacteria 112426
282 Ga0207670_10000177 3300025936 Bacteria 42462
283 Ga0207670_10104866 3300025936 Bacteria 2026
284 Ga0207669_10035894 3300025937 Bacteria 2826
285 Ga0207669_10287622 3300025937 Bacteria 1243
286 Ga0207704_10011387 3300025938 Bacteria 4377
287 Ga0207704_10111776 3300025938 Bacteria 1848
288 Ga0207665_10060502 3300025939 Bacteria 2565
289 Ga0207665_10064074 3300025939 Bacteria 2497
290 Ga0207691_10000182 3300025940 Bacteria 59433
291 Ga0207711_10001788 3300025941 Bacteria 19690
292 Ga0207689_10072905 3300025942 Bacteria 2821
293 Ga0207689_10283640 3300025942 Bacteria 1371
294 Ga0207689_10325226 3300025942 Bacteria 1276
295 Ga0207661_10025410 3300025944 Bacteria 4502
296 Ga0207661_10032917 3300025944 Bacteria 4021
297 Ga0207679_10004180 3300025945 Bacteria 8971
298 Ga0207651_10116819 3300025960 Unclassified 2014
299 Ga0207651_10225689 3300025960 Bacteria 1517
300 Ga0207712_10052076 3300025961 Bacteria 2866
301 Ga0207712_10053359 3300025961 Bacteria 2835
302 Ga0207668_10006913 3300025972 Bacteria 6731
303 Ga0207668_10122064 3300025972 Unclassified 1974
304 Ga0207658_10008718 3300025986 Bacteria 6889
305 Ga0207703_10151607 3300026035 Unclassified 2022
306 Ga0207708_10000291 3300026075 Bacteria 39366
307 Ga0207708_10000413 3300026075 Bacteria 33516
308 Ga0207708_10151599 3300026075 Bacteria 1825
309 Ga0207702_10003806 3300026078 Bacteria 13620
310 Ga0207702_10150471 3300026078 Bacteria 2117
311 Ga0207702_10208654 3300026078 Bacteria 1815
312 Ga0207641_10127302 3300026088 Bacteria 2282
313 Ga0207648_10000101 3300026089 Bacteria 82654
314 Ga0207648_10085747 3300026089 Bacteria 2747
315 Ga0207676_10061252 3300026095 Bacteria 2979
316 Ga0207676_10340249 3300026095 Bacteria 1384
317 Ga0207674_10004318 3300026116 Bacteria 17135
318 Ga0207674_10313947 3300026116 Bacteria 1517
319 Ga0207675_100074130 3300026118 Bacteria 3185
320 Ga0207675_100134666 3300026118 Bacteria 2343
321 Ga0207675_100200856 3300026118 Bacteria 1915
322 Ga0207683_10000229 3300026121 Bacteria 49529
323 Ga0207683_10028708 3300026121 Bacteria 4812
324 Ga0209973_1000239 3300027252 Unclassified 3754
325 Ga0209969_1002389 3300027360 Bacteria 2596
326 Ga0209967_1000547 3300027364 Bacteria 4941
327 Ga0209981_1002105 3300027378 Unclassified 2535
328 Ga0209984_1000006 3300027424 Bacteria 23947
329 Ga0210000_1000032 3300027462 Bacteria 21476
330 Ga0209982_1000705 3300027552 Unclassified 4261
331 Ga0209970_1006254 3300027614 Bacteria 1950
332 Ga0209970_1007538 3300027614 Unclassified 1784
333 Ga0210002_1000061 3300027617 Bacteria 16870
334 Ga0209983_1000874 3300027665 Bacteria 6639
335 Ga0209971_1000642 3300027682 Bacteria 9100
336 Ga0209966_1000016 3300027695 Bacteria 73256
337 Ga0209998_10000021 3300027717 Bacteria 70520
338 Ga0209998_10019074 3300027717 Bacteria 1460
339 Ga0209974_10000003 3300027876 Bacteria 65938
340 Ga0209974_10000265 3300027876 Bacteria 16988
341 Ga0207428_10001120 3300027907 Bacteria 29155
342 Ga0207428_10006333 3300027907 Bacteria 10944
343 Ga0268266_10044738 3300028379 Bacteria 3785
344 Ga0268265_10013370 3300028380 Bacteria 5577
345 Ga0268265_10028020 3300028380 Bacteria 4029
346 Ga0268265_10311647 3300028380 Bacteria 1421
347 Ga0268264_10398558 3300028381 Bacteria 1322
348 Ga0265326_10005513 3300028558 Bacteria 3990
349 Ga0307517_10031500 3300028786 Bacteria 6169
350 Ga0307515_10015000 3300028794 Bacteria 14315
351 Ga0265338_10030516 3300028800 Bacteria 5309
352 Ga0265338_10087690 3300028800 Bacteria 2584
353 Ga0265338_10203924 3300028800 Bacteria 1489
354 Ga0265332_10020875 3300031238 Bacteria 2893
355 Ga0265320_10083479 3300031240 Bacteria 1489
356 Ga0265339_10020303 3300031249 Unclassified 3883
357 Ga0265316_10000230 3300031344 Bacteria 64801
358 Ga0265316_10001169 3300031344 Bacteria 28394
359 Ga0307513_10010635 3300031456 Bacteria 11512
360 Ga0307513_10186517 3300031456 Bacteria 1931
361 Ga0307509_10000007 3300031507 Bacteria 409278
362 Ga0307509_10010793 3300031507 Bacteria 11136
363 Ga0307509_10100579 3300031507 Bacteria 2929
364 Ga0307509_10128720 3300031507 Bacteria 2492
365 Ga0307509_10136421 3300031507 Bacteria 2398
366 Ga0307408_100038453 3300031548 Bacteria 3376
367 Ga0316579_10003565 3300031691 Bacteria 6099
368 Ga0265342_10000265 3300031712 Bacteria 58679
369 Ga0265342_10031378 3300031712 Bacteria 3285
370 Ga0316576_10000591 3300031727 Bacteria 17316
371 Ga0316576_10011115 3300031727 Bacteria 5881
372 Ga0307516_10013815 3300031730 Bacteria 8574
373 Ga0307516_10114082 3300031730 Bacteria 2499
374 Ga0307405_10010594 3300031731 Bacteria 4790
375 Ga0307413_10017077 3300031824 Bacteria 3771
376 Ga0307410_10050917 3300031852 Bacteria 2788
377 Ga0307406_10003927 3300031901 Bacteria 8080
378 Ga0307406_10052376 3300031901 Bacteria 2595
379 Ga0307407_10005289 3300031903 Bacteria 5582
380 Ga0307412_10000625 3300031911 Bacteria 20667
381 Ga0307409_100124325 3300031995 Bacteria 2191
382 Ga0307416_100294136 3300032002 Bacteria 1609
383 Ga0307414_10009229 3300032004 Bacteria 5654
384 Ga0307411_10008204 3300032005 Bacteria 5391
385 Ga0307415_100060451 3300032126 Unclassified 2618
386 Ga0307415_100115272 3300032126 Bacteria 2002
387 Ga0307415_100131256 3300032126 Bacteria 1897
388 Ga0373934_0000962 3300035086 Bacteria 10441
389 Ga0373934_0059328 3300035086 Unclassified 1523
390 Ga0373940_0035055 3300035088 Unclassified 1357
391 Ga0373949_0001386 3300035090 Bacteria 6967
392 Ga0373923_0020394 3300035111 Bacteria 2575
393 Ga0373936_0000035 3300035113 Bacteria 108166
394 Ga0373936_0085388 3300035113 Unclassified 1318
395 Ga0373941_0015901 3300035115 Bacteria 2037
396 Ga0373956_0059763 3300035119 Bacteria 1725
397 Ga0373957_0009657 3300035120 Bacteria 3162
398 Ga0373955_0008648 3300035172 Bacteria 4737
399 Ga0373961_0000020 3300035241 Bacteria 100658
400 Ga0316574_0072511 3300035398 Bacteria 2176
401 Ga0373924_0027753 3300035410 Bacteria 2252
402 Ga0373931_0040788 3300035691 Bacteria 2437
403 Ga0373935_0012043 3300035692 Bacteria 5199
404 Ga0373933_0004953 3300035724 Bacteria 7261
405 Ga0373933_0007058 3300035724 Bacteria 6121
406 Ga0373933_0069486 3300035724 Bacteria 2141
407 Ga0373947_0016709 3300035725 Bacteria 4216
408 Ga0373937_0031486 3300036401 Bacteria 4807
409 Ga0373937_0040042 3300036401 Bacteria 4271
410 Ga0373937_0079996 3300036401 Bacteria 3021
411 Ga0316582_0075916 3300036647 Bacteria 2184
412 Ga0316582_0218205 3300036647 Bacteria 1304
413 Ga0316584_0000325 3300036712 Bacteria 24471
414 Ga0316584_0091412 3300036712 Bacteria 2279
415 Ga0373925_0070936 3300037068 Bacteria 2634
416 Ga0373925_0154412 3300037068 Bacteria 1805
417 Ga0395899_0000015 3300037312 Bacteria 470061
418 Ga0395899_0004859 3300037312 Bacteria 10469
419 Ga0395900_0044586 3300037418 Bacteria 4568
420 Ga0395898_0000051 3300037466 Bacteria 281872
421 Ga0395898_0139593 3300037466 Bacteria 2320
422 Ga0316581_0073691 3300037588 Bacteria 1049
423 Ga0395901_0091814 3300038443 Bacteria 3178
424 Ga0400483_005312 3300039062 Bacteria 2420
425 Ga0400483_224315 3300039062 Bacteria 8658
426 Ga0436365_0014080 3300039437 Bacteria 1413
427 Ga0439439_0015824 3300041406 Bacteria 1844
428 Ga0439461_0037611 3300041410 Bacteria 1034
429 Ga0439466_0017981 3300041411 Bacteria 2540
430 Ga0439450_042759 3300042008 Bacteria 1057
431 Ga0439452_004979 3300042010 Bacteria 4350
432 Ga0451577_0053435 3300042876 Bacteria 3606
433 Ga0451577_0180898 3300042876 Unclassified 1901
434 Ga0451577_0223564 3300042876 Bacteria 1702
435 Ga0451577_0521500 3300042876 Unclassified 1079
436 Ga0466965_0007338 3300044683 Bacteria 5056
437 Ga0453684_0331514 3300044712 Bacteria 1721
438 Ga0466971_0000025 3300044719 Bacteria 62833
439 Ga0451576_0001765 3300045051 Bacteria 35474
440 Ga0451576_0019910 3300045051 Bacteria 7315
441 Ga0451576_0093757 3300045051 Bacteria 3121
442 Ga0451576_0713558 3300045051 Bacteria 1053
443 Ga0466967_0220246 3300045976 Bacteria 1803
444 Ga0495592_0005931 3300046454 Bacteria 9069
445 Ga0495603_0079418 3300046455 Bacteria 1923
446 Ga0495629_0013291 3300046459 Bacteria 5941
447 Ga0495653_0062353 3300046463 Bacteria 2817
448 Ga0495580_0115243 3300046472 Bacteria 1867
449 Ga0495594_0002228 3300046499 Bacteria 10084
450 Ga0495594_0025000 3300046499 Bacteria 3209
451 Ga0495608_0012150 3300046511 Bacteria 5984
452 Ga0495628_0007531 3300046516 Bacteria 9414
453 Ga0495628_0216051 3300046516 Bacteria 1441
454 Ga0495630_0444302 3300046517 Bacteria 994
455 Ga0495632_0066854 3300046519 Bacteria 1734
456 Ga0495637_0036110 3300046520 Unclassified 2155
457 Ga0495652_0158488 3300046529 Bacteria 1760
458 Ga0495587_0006735 3300046536 Bacteria 7481
459 Ga0495587_0084415 3300046536 Unclassified 1839
460 Ga0495667_0014196 3300046559 Bacteria 5378
461 Ga0495635_0098788 3300046663 Bacteria 1995
462 Ga0495635_0152579 3300046663 Unclassified 1573
463 Ga0495659_0013982 3300046664 Unclassified 2620
464 Ga0495657_0016534 3300046675 Bacteria 5375
465 Ga0495657_0029598 3300046675 Bacteria 3839
466 Ga0495658_0105600 3300046683 Bacteria 1687
467 Ga0495670_0091914 3300046691 Bacteria 1554
468 Ga0495581_0062198 3300047315 Bacteria 2157
469 Ga0495604_0066471 3300047317 Bacteria 2742
470 Ga0495604_0138540 3300047317 Bacteria 1741
471 Ga0495676_0305523 3300047321 Unclassified 1072
472 Ga0495680_0233916 3300047322 Unclassified 1307
473 Ga0495675_0005566 3300047444 Bacteria 7686
474 Ga0495686_0025513 3300047472 Bacteria 3873
475 Ga0495602_0059350 3300048088 Bacteria 3340
476 Ga0496102_0527918 3300048905 Bacteria 1103
477 Ga0496108_0246796 3300048911 Bacteria 1553
478 Ga0496115_0018467 3300048918 Bacteria 5354
479 Ga0496115_0098672 3300048918 Bacteria 2393
480 Ga0496125_0001254 3300048928 Bacteria 37859
481 Ga0496125_0047635 3300048928 Bacteria 3581
482 Ga0501290_000039 3300049513 Bacteria 16974
483 Ga0501291_000019 3300049514 Bacteria 22541
484 Ga0501292_000403 3300049515 Bacteria 5740
485 Ga0501294_001525 3300049517 Unclassified 2317
486 Ga0501295_000011 3300049518 Bacteria 23617
487 Ga0501296_000029 3300049519 Bacteria 16252
488 Ga0501296_006766 3300049519 Unclassified 1306
489 Ga0501297_000006 3300049520 Bacteria 21954
490 Ga0501298_000012 3300049521 Bacteria 19378
491 Ga0501299_000715 3300049522 Bacteria 3988
492 Ga0501300_000483 3300049523 Bacteria 5989
493 Ga0501301_000228 3300049524 Bacteria 3249
494 Ga0501303_000138 3300049526 Bacteria 6311
495 Ga0501031_0002149 3300049568 Bacteria 12433
496 Ga0501031_0013859 3300049568 Bacteria 5253
497 Ga0501032_0000504 3300049569 Bacteria 31645
498 Ga0501033_0000003 3300049570 Bacteria 586973
499 Ga0501033_0000083 3300049570 Bacteria 89452
500 Ga0501036_0036576 3300049572 Bacteria 4155
501 Ga0501036_0053721 3300049572 Bacteria 3411
502 Ga0501036_0101804 3300049572 Bacteria 2430
503 Ga0501037_0000083 3300049573 Bacteria 86322
504 Ga0501037_0013052 3300049573 Bacteria 6125
505 Ga0501037_0042163 3300049573 Bacteria 3354
506 Ga0501037_0097604 3300049573 Unclassified 2123
507 Ga0501038_0000329 3300049574 Bacteria 40955
508 Ga0501038_0006687 3300049574 Bacteria 10655
509 Ga0501038_0022409 3300049574 Bacteria 5661
510 Ga0501038_0032868 3300049574 Bacteria 4572
511 Ga0501038_0039168 3300049574 Bacteria 4147
512 Ga0501038_0110342 3300049574 Bacteria 2279
513 Ga0501039_0002225 3300049575 Bacteria 14350
514 Ga0501039_0002998 3300049575 Bacteria 12619
515 Ga0501039_0013028 3300049575 Bacteria 6356
516 Ga0501039_0030652 3300049575 Bacteria 4148
517 Ga0501039_0431830 3300049575 Bacteria 1034
518 Ga0501039_0501618 3300049575 Bacteria 953
519 Ga0501040_0076133 3300049576 Unclassified 2320
520 Ga0501041_0003147 3300049577 Bacteria 9494
521 Ga0501041_0005224 3300049577 Bacteria 7582
522 Ga0501041_0073022 3300049577 Bacteria 2108
523 Ga0501042_0001893 3300049578 Bacteria 12585
524 Ga0501042_0055737 3300049578 Bacteria 2821
525 Ga0501043_0002418 3300049579 Bacteria 15801
526 Ga0501043_0017594 3300049579 Bacteria 5604
527 Ga0501043_0073429 3300049579 Bacteria 2687
528 Ga0501046_0007844 3300049580 Bacteria 9366
529 Ga0501046_0014946 3300049580 Bacteria 6531
530 Ga0501047_0002692 3300049581 Bacteria 16920
531 Ga0501047_0095852 3300049581 Bacteria 2845
532 Ga0501047_0143491 3300049581 Bacteria 2265
533 Ga0501048_0002213 3300049582 Bacteria 14809
534 Ga0501067_0026740 3300049583 Bacteria 3195
535 Ga0501067_0065861 3300049583 Bacteria 2006
536 Ga0501068_0087011 3300049584 Bacteria 1924
537 Ga0501069_0018643 3300049585 Bacteria 3747
538 Ga0501070_0005200 3300049586 Bacteria 11088
539 Ga0501070_0023242 3300049586 Bacteria 5193
540 Ga0501070_0041974 3300049586 Bacteria 3809
541 Ga0501070_0078064 3300049586 Bacteria 2740
542 Ga0501070_0122961 3300049586 Bacteria 2145
543 Ga0501070_0139358 3300049586 Bacteria 2003
544 Ga0501071_0004046 3300049587 Bacteria 9263
545 Ga0501071_0165052 3300049587 Bacteria 1657
546 Ga0501073_0038848 3300049589 Bacteria 3375
547 Ga0501073_0108362 3300049589 Bacteria 1928
548 Ga0501074_0155538 3300049590 Bacteria 1633
549 Ga0501075_0017241 3300049591 Bacteria 5215
550 Ga0501076_0147192 3300049592 Unclassified 1915
551 Ga0501076_0163347 3300049592 Bacteria 1815
552 Ga0501077_0079742 3300049593 Unclassified 2074
553 Ga0501198_002606 3300049649 Bacteria 2435
554 Ga0501199_000121 3300049650 Bacteria 5901
555 Ga0501207_000226 3300049654 Bacteria 5715
556 Ga0501208_000359 3300049655 Bacteria 3486
557 Ga0501209_069411 3300049656 Bacteria 1000
558 Ga0501216_000387 3300049660 Bacteria 5121
559 Ga0501217_001318 3300049661 Bacteria 4614
560 Ga0501227_004929 3300049665 Unclassified 2863
561 Ga0501228_000244 3300049666 Bacteria 3261
562 Ga0501230_007885 3300049667 Bacteria 1593
563 Ga0501233_000301 3300049668 Bacteria 7611
564 Ga0501235_000299 3300049669 Bacteria 9332
565 Ga0501236_002905 3300049670 Unclassified 1985
566 Ga0501243_000533 3300049675 Bacteria 5076
567 Ga0501246_000183 3300049676 Bacteria 4029
568 Ga0501248_001084 3300049678 Unclassified 1660
569 Ga0501249_000187 3300049679 Bacteria 18921
570 Ga0501251_000388 3300049681 Bacteria 3906
571 Ga0501252_001159 3300049682 Bacteria 2353
572 Ga0501256_000097 3300049685 Bacteria 4481
573 Ga0501257_014580 3300049686 Unclassified 1811
574 Ga0501259_004175 3300049688 Unclassified 2296
575 Ga0501260_000130 3300049689 Bacteria 5424
576 Ga0501261_000368 3300049690 Bacteria 6040
577 Ga0501219_000921 3300049703 Bacteria 3582
578 Ga0501221_000411 3300049704 Bacteria 6609
579 Ga0501225_0001272 3300049705 Bacteria 7818
580 Ga0501229_000409 3300049706 Bacteria 4819
581 Ga0501234_000067 3300049707 Bacteria 12699
582 Ga0501245_007222 3300049708 Unclassified 1568
583 Ga0501079_0021590 3300049741 Bacteria 4925
584 Ga0501079_0070270 3300049741 Bacteria 2703
585 Ga0501080_0168503 3300049742 Bacteria 2021
586 Ga0501083_0060881 3300049744 Unclassified 2522
587 Ga0501232_000390 3300049757 Bacteria 2866
588 Ga0501264_000556 3300049761 Bacteria 5422
589 Ga0501265_002952 3300049762 Bacteria 1933
590 Ga0501266_000463 3300049763 Bacteria 5357
591 Ga0501269_010427 3300049766 Bacteria 1131
592 Ga0501270_001992 3300049767 Unclassified 2040
593 Ga0501272_000065 3300049769 Bacteria 7699
594 Ga0501273_000307 3300049770 Bacteria 3803
595 Ga0501275_004489 3300049772 Bacteria 1311
596 Ga0501279_000197 3300049775 Bacteria 8384
597 Ga0501281_00384 3300049777 Bacteria 4429
598 Ga0501283_000015 3300049779 Bacteria 21880
599 Ga0501035_0000001 3300049822 Bacteria 1037138
600 Ga0501035_0002674 3300049822 Bacteria 17341
601 Ga0501035_0004915 3300049822 Bacteria 12681
602 Ga0501035_0119329 3300049822 Bacteria 2307
603 Ga0501035_0321354 3300049822 Bacteria 1300
604 Ga0501044_0000159 3300049823 Bacteria 83639
605 Ga0501044_0030731 3300049823 Bacteria 5658
606 Ga0501044_0256973 3300049823 Unclassified 1686
607 Ga0501045_0099600 3300049824 Bacteria 2151
608 Ga0501045_0180862 3300049824 Bacteria 1571
609 Ga0501212_007373 3300049851 Unclassified 1506
610 Ga0501226_004624 3300049853 Bacteria 1589
611 nmdc:mga05p37_533777_c1 3300050507 Bacteria 1339
612 nmdc:mga05p37_7050_c3 3300050507 Bacteria 7677
613 nmdc:mga05p37_85784_c1 3300050507 Bacteria 3880
614 nmdc:mga09592_126987_c1 3300050508 Unclassified 2193
615 nmdc:mga09592_56990_c1 3300050508 Bacteria 3302
616 nmdc:mga09592_628_c1 3300050508 Bacteria 26997
617 nmdc:mga09592_88265_c1 3300050508 Unclassified 2648
618 nmdc:mga0qj67_7424_c1 3300050509 Bacteria 8104
619 nmdc:mga0qj67_8914_c1 3300050509 Bacteria 7443
620 nmdc:mga06r32_20429_c1 3300050510 Bacteria 6099
621 nmdc:mga08y16_130851_c1 3300050511 Bacteria 2609
622 nmdc:mga08y16_19593_c1 3300050511 Bacteria 7133
623 nmdc:mga08y16_40174_c1 3300050511 Unclassified 4905
624 nmdc:mga08y16_579738_c1 3300050511 Bacteria 1133
625 nmdc:mga0n895_183973_c1 3300050512 Bacteria 2121
626 nmdc:mga0n895_25119_c1 3300050512 Bacteria 5626
627 nmdc:mga0n895_446378_c1 3300050512 Bacteria 1306
628 nmdc:mga0n895_45444_c1 3300050512 Bacteria 4286
629 nmdc:mga0rr50_9841_c1 3300050513 Bacteria 6039
630 nmdc:mga08x19_148882_c1 3300050514 Unclassified 1584
631 nmdc:mga0a205_33356_c1 3300050515 Bacteria 4937
632 nmdc:mga0a205_379728_c1 3300050515 Bacteria 1278
633 nmdc:mga0a205_5607_c1 3300050515 Bacteria 11307
634 Ga0495601_0029104 3300053077 Bacteria 3424
635 Ga0495601_0059194 3300053077 Bacteria 2429
636 Ga0500635_0016485 3300053080 Bacteria 2199
637 Ga0495595_0002156 3300053084 Bacteria 7647
638 Ga0495619_0070253 3300053085 Bacteria 2341
639 Ga0500578_0051718 3300053086 Bacteria 2632
640 Ga0500646_0005402 3300053090 Bacteria 3234
641 Ga0500583_0007096 3300053092 Bacteria 3913
642 Ga0500566_0035668 3300053094 Bacteria 2889
643 Ga0500566_0101427 3300053094 Bacteria 1577
644 Ga0500640_006413 3300053095 Bacteria 4489
645 Ga0500554_001427 3300053102 Bacteria 4621
646 Ga0500556_0003471 3300053104 Bacteria 4631
647 Ga0500572_003251 3300053111 Bacteria 3744
648 Ga0500595_000080 3300053119 Bacteria 67711
649 Ga0500607_150014 3300053121 Bacteria 1082
650 Ga0500608_000243 3300053122 Bacteria 21503
651 Ga0500614_000998 3300053123 Bacteria 7023
652 Ga0500614_010113 3300053123 Bacteria 2021
653 Ga0500559_0042880 3300053136 Bacteria 1975
654 Ga0500568_0020885 3300053139 Bacteria 2826
655 Ga0500603_010891 3300053150 Bacteria 2060
656 Ga0500619_037329 3300053154 Bacteria 1517
657 Ga0500638_049814 3300053162 Bacteria 2026
658 Ga0500639_017834 3300053163 Bacteria 3746
659 Ga0500636_0084495 3300053177 Bacteria 1825
660 Ga0500636_0175579 3300053177 Bacteria 1155
661 Ga0500645_007906 3300053730 Bacteria 3670
662 Ga0501084_0317574 3300054114 Bacteria 1316
663 Ga0590075_032038 3300059424 Unclassified 1333
664 Ga0590077_009132 3300059426 Unclassified 2031
665 Ga0590077_012961 3300059426 Bacteria 1731
666 Ga0501082_0019412 3300060353 Bacteria 5859
667 Ga0501082_0168841 3300060353 Bacteria 1902
668 Ga0501082_0395773 3300060353 Bacteria 1205
669 Ga0501082_0534850 3300060353 Unclassified 1025

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041410 Ga0439461_0037611 Ga0439461_0037611_15_836 244
2 3300042876 Ga0451577_0223564 Ga0451577_0223564_837_1661 245
3 3300049575 Ga0501039_0501618 Ga0501039_0501618_14_853 248
4 3300005440 Ga0070705_100038236 Ga0070705_1000382362 250
5 3300049519 Ga0501296_000029 Ga0501296_000029_15395_16240 251
6 3300049526 Ga0501303_000138 Ga0501303_000138_5422_6267 251
7 3300049656 Ga0501209_069411 Ga0501209_069411_10_855 251
8 3300049666 Ga0501228_000244 Ga0501228_000244_2380_3225 251
9 3300049685 Ga0501256_000097 Ga0501256_000097_73_918 251
10 3300049708 Ga0501245_007222 Ga0501245_007222_383_1228 251
11 3300049766 Ga0501269_010427 Ga0501269_010427_62_907 251
12 3300047321 Ga0495676_0305523 Ga0495676_0305523_17_880 252
13 3300042008 Ga0439450_042759 Ga0439450_042759_56_916 256
14 3300027614 Ga0209970_1006254 Ga0209970_10062542 263
15 3300049586 Ga0501070_0122961 Ga0501070_0122961_10_930 263
16 3300035115 Ga0373941_0015901 Ga0373941_0015901_1077_2024 264
17 3300046499 Ga0495594_0002228 Ga0495594_0002228_27_926 264
18 3300046517 Ga0495630_0444302 Ga0495630_0444302_29_976 264
19 3300028558 Ga0265326_10005513 Ga0265326_100055132 267
20 3300049572 Ga0501036_0101804 Ga0501036_0101804_1305_2222 274
21 3300005336 Ga0070680_100033394 Ga0070680_1000333943 275
22 3300031240 Ga0265320_10083479 Ga0265320_100834792 278
23 3300001990 JGI24737J22298_10032482 JGI24737J22298_100324821 280
24 3300005331 Ga0070670_100206980 Ga0070670_1002069802 280
25 3300005345 Ga0070692_10054249 Ga0070692_100542492 280
26 3300005564 Ga0070664_100006608 Ga0070664_1000066087 280
27 3300006846 Ga0075430_100001325 Ga0075430_1000013255 280
28 3300006880 Ga0075429_100005851 Ga0075429_1000058515 280
29 3300009147 Ga0114129_10023328 Ga0114129_100233285 280
30 3300009147 Ga0114129_10067741 Ga0114129_100677412 280
31 3300025925 Ga0207650_10277150 Ga0207650_102771502 280
32 3300027876 Ga0209974_10000265 Ga0209974_1000026518 280
33 3300031548 Ga0307408_100038453 Ga0307408_1000384532 280
34 3300031731 Ga0307405_10010594 Ga0307405_100105943 280
35 3300031901 Ga0307406_10003927 Ga0307406_100039276 280
36 3300031903 Ga0307407_10005289 Ga0307407_100052892 280
37 3300031911 Ga0307412_10000625 Ga0307412_100006254 280
38 3300032004 Ga0307414_10009229 Ga0307414_100092293 280
39 3300037588 Ga0316581_0073691 Ga0316581_0073691_79_969 280
40 3300045051 Ga0451576_0001765 Ga0451576_0001765_29783_30715 280
41 3300045051 Ga0451576_0713558 Ga0451576_0713558_28_960 280
42 3300049573 Ga0501037_0097604 Ga0501037_0097604_556_1488 280
43 3300049583 Ga0501067_0026740 Ga0501067_0026740_2132_3064 280
44 3300049744 Ga0501083_0060881 Ga0501083_0060881_906_1838 280
45 3300049822 Ga0501035_0321354 Ga0501035_0321354_302_1234 280
46 3300050507 nmdc:mga05p37_7050_c3 nmdc:mga05p37_7050_c3_5015_5947 280
47 3300050512 nmdc:mga0n895_446378_c1 nmdc:mga0n895_446378_c1_329_1261 280
48 3300005336 Ga0070680_100031682 Ga0070680_1000316825 281
49 3300005458 Ga0070681_10049211 Ga0070681_100492112 281
50 3300005458 Ga0070681_10253915 Ga0070681_102539152 281
51 3300005530 Ga0070679_100001459 Ga0070679_10000145918 281
52 3300005563 Ga0068855_100392142 Ga0068855_1003921422 281
53 3300005614 Ga0068856_100058687 Ga0068856_1000586872 281
54 3300009176 Ga0105242_10087944 Ga0105242_100879442 281
55 3300009177 Ga0105248_10000908 Ga0105248_1000090825 281
56 3300014326 Ga0157380_10014684 Ga0157380_100146843 281
57 3300025917 Ga0207660_10014792 Ga0207660_100147926 281
58 3300025921 Ga0207652_10219239 Ga0207652_102192392 281
59 3300026078 Ga0207702_10150471 Ga0207702_101504712 281
60 3300026089 Ga0207648_10085747 Ga0207648_100857473 281
61 3300035111 Ga0373923_0020394 Ga0373923_0020394_344_1294 281
62 3300035724 Ga0373933_0004953 Ga0373933_0004953_1740_2690 281
63 3300036401 Ga0373937_0079996 Ga0373937_0079996_558_1508 281
64 3300036647 Ga0316582_0075916 Ga0316582_0075916_460_1353 281
65 3300037068 Ga0373925_0070936 Ga0373925_0070936_159_1109 281
66 3300046516 Ga0495628_0216051 Ga0495628_0216051_196_1170 281
67 3300046663 Ga0495635_0152579 Ga0495635_0152579_446_1396 281
68 3300046675 Ga0495657_0016534 Ga0495657_0016534_4004_4954 281
69 3300047315 Ga0495581_0062198 Ga0495581_0062198_689_1639 281
70 3300047317 Ga0495604_0138540 Ga0495604_0138540_442_1416 281
71 3300047322 Ga0495680_0233916 Ga0495680_0233916_38_988 281
72 3300048088 Ga0495602_0059350 Ga0495602_0059350_1378_2352 281
73 3300048905 Ga0496102_0527918 Ga0496102_0527918_43_954 281
74 3300049568 Ga0501031_0002149 Ga0501031_0002149_6665_7603 281
75 3300049572 Ga0501036_0053721 Ga0501036_0053721_822_1760 281
76 3300049573 Ga0501037_0042163 Ga0501037_0042163_2015_2953 281
77 3300049574 Ga0501038_0006687 Ga0501038_0006687_6604_7542 281
78 3300049574 Ga0501038_0110342 Ga0501038_0110342_399_1337 281
79 3300049575 Ga0501039_0002225 Ga0501039_0002225_7672_8610 281
80 3300049575 Ga0501039_0013028 Ga0501039_0013028_4403_5341 281
81 3300049576 Ga0501040_0076133 Ga0501040_0076133_797_1735 281
82 3300049577 Ga0501041_0003147 Ga0501041_0003147_3598_4536 281
83 3300049577 Ga0501041_0005224 Ga0501041_0005224_6151_7089 281
84 3300049578 Ga0501042_0001893 Ga0501042_0001893_3331_4269 281
85 3300049579 Ga0501043_0073429 Ga0501043_0073429_1386_2324 281
86 3300049580 Ga0501046_0007844 Ga0501046_0007844_4267_5205 281
87 3300049580 Ga0501046_0014946 Ga0501046_0014946_751_1689 281
88 3300049582 Ga0501048_0002213 Ga0501048_0002213_10989_11927 281
89 3300049585 Ga0501069_0018643 Ga0501069_0018643_788_1762 281
90 3300049587 Ga0501071_0165052 Ga0501071_0165052_95_1069 281
91 3300049592 Ga0501076_0147192 Ga0501076_0147192_863_1801 281
92 3300049741 Ga0501079_0021590 Ga0501079_0021590_798_1736 281
93 3300049742 Ga0501080_0168503 Ga0501080_0168503_809_1783 281
94 3300049822 Ga0501035_0002674 Ga0501035_0002674_9595_10533 281
95 3300049822 Ga0501035_0004915 Ga0501035_0004915_5486_6424 281
96 3300049823 Ga0501044_0256973 Ga0501044_0256973_465_1403 281
97 3300049824 Ga0501045_0099600 Ga0501045_0099600_221_1159 281
98 3300050515 nmdc:mga0a205_5607_c1 nmdc:mga0a205_5607_c1_144_1094 281
99 3300060353 Ga0501082_0019412 Ga0501082_0019412_3039_4013 281
100 3300009553 Ga0105249_10148930 Ga0105249_101489302 282
101 3300005545 Ga0070695_100248110 Ga0070695_1002481102 283
102 3300025937 Ga0207669_10287622 Ga0207669_102876222 283
103 3300031249 Ga0265339_10020303 Ga0265339_100203032 283
104 3300031344 Ga0265316_10001169 Ga0265316_1000116910 283
105 3300031712 Ga0265342_10000265 Ga0265342_1000026532 283
106 3300031712 Ga0265342_10031378 Ga0265342_100313782 283
107 3300035119 Ga0373956_0059763 Ga0373956_0059763_663_1619 283
108 3300005364 Ga0070673_100139017 Ga0070673_1001390172 285
109 3300005467 Ga0070706_100000878 Ga0070706_10000087835 285
110 3300005468 Ga0070707_100162323 Ga0070707_1001623232 285
111 3300005937 Ga0081455_10000594 Ga0081455_1000059424 285
112 3300025910 Ga0207684_10000198 Ga0207684_1000019879 285
113 iso_pu_bacteria 2684623219 2687237057 285
114 3300005330 Ga0070690_100030630 Ga0070690_1000306303 286
115 3300005340 Ga0070689_100004336 Ga0070689_1000043362 286
116 3300005340 Ga0070689_100129152 Ga0070689_1001291522 286
117 3300005343 Ga0070687_100023969 Ga0070687_1000239693 286
118 3300005365 Ga0070688_100002702 Ga0070688_1000027025 286
119 3300005459 Ga0068867_100170770 Ga0068867_1001707702 286
120 3300005466 Ga0070685_10001193 Ga0070685_1000119312 286
121 3300005549 Ga0070704_100027484 Ga0070704_1000274844 286
122 3300005617 Ga0068859_100119805 Ga0068859_1001198052 286
123 3300005844 Ga0068862_100164946 Ga0068862_1001649462 286
124 3300006163 Ga0070715_10035796 Ga0070715_100357962 286
125 3300006844 Ga0075428_100256170 Ga0075428_1002561702 286
126 3300006852 Ga0075433_10214902 Ga0075433_102149021 286
127 3300006871 Ga0075434_100119547 Ga0075434_1001195472 286
128 3300006880 Ga0075429_100001252 Ga0075429_10000125217 286
129 3300006880 Ga0075429_100082207 Ga0075429_1000822072 286
130 3300006931 Ga0097620_100119801 Ga0097620_1001198012 286
131 3300007076 Ga0075435_100045650 Ga0075435_1000456503 286
132 3300009094 Ga0111539_10007846 Ga0111539_100078469 286
133 3300009147 Ga0114129_10279486 Ga0114129_102794861 286
134 3300014326 Ga0157380_10240263 Ga0157380_102402632 286
135 3300025918 Ga0207662_10025917 Ga0207662_100259172 286
136 3300025936 Ga0207670_10000177 Ga0207670_1000017712 286
137 3300025936 Ga0207670_10104866 Ga0207670_101048662 286
138 3300025942 Ga0207689_10325226 Ga0207689_103252261 286
139 3300026075 Ga0207708_10151599 Ga0207708_101515992 286
140 3300026088 Ga0207641_10127302 Ga0207641_101273022 286
141 3300026095 Ga0207676_10340249 Ga0207676_103402492 286
142 3300028380 Ga0268265_10311647 Ga0268265_103116471 286
143 3300035086 Ga0373934_0000962 Ga0373934_0000962_1042_2058 286
144 3300035120 Ga0373957_0009657 Ga0373957_0009657_794_1810 286
145 3300035172 Ga0373955_0008648 Ga0373955_0008648_1773_2789 286
146 3300035724 Ga0373933_0007058 Ga0373933_0007058_4717_5733 286
147 3300036401 Ga0373937_0040042 Ga0373937_0040042_1737_2753 286
148 3300042876 Ga0451577_0053435 Ga0451577_0053435_230_1246 286
149 3300046454 Ga0495592_0005931 Ga0495592_0005931_1139_2155 286
150 3300046455 Ga0495603_0079418 Ga0495603_0079418_533_1549 286
151 3300046463 Ga0495653_0062353 Ga0495653_0062353_422_1438 286
152 3300046511 Ga0495608_0012150 Ga0495608_0012150_783_1799 286
153 3300046516 Ga0495628_0007531 Ga0495628_0007531_2322_3338 286
154 3300046529 Ga0495652_0158488 Ga0495652_0158488_375_1391 286
155 3300046536 Ga0495587_0006735 Ga0495587_0006735_2242_3258 286
156 3300046559 Ga0495667_0014196 Ga0495667_0014196_3109_4125 286
157 3300046663 Ga0495635_0098788 Ga0495635_0098788_782_1798 286
158 3300046675 Ga0495657_0029598 Ga0495657_0029598_1254_2270 286
159 3300047317 Ga0495604_0066471 Ga0495604_0066471_76_1092 286
160 3300047444 Ga0495675_0005566 Ga0495675_0005566_4163_5179 286
161 3300050507 nmdc:mga05p37_533777_c1 nmdc:mga05p37_533777_c1_250_1266 286
162 3300050508 nmdc:mga09592_628_c1 nmdc:mga09592_628_c1_3281_4297 286
163 3300050511 nmdc:mga08y16_130851_c1 nmdc:mga08y16_130851_c1_1342_2358 286
164 3300050511 nmdc:mga08y16_19593_c1 nmdc:mga08y16_19593_c1_2507_3523 286
165 3300050512 nmdc:mga0n895_183973_c1 nmdc:mga0n895_183973_c1_650_1681 286
166 3300050515 nmdc:mga0a205_379728_c1 nmdc:mga0a205_379728_c1_205_1236 286
167 3300053084 Ga0495595_0002156 Ga0495595_0002156_6613_7629 286
168 3300005438 Ga0070701_10080414 Ga0070701_100804142 287
169 3300028800 Ga0265338_10087690 Ga0265338_100876902 287
170 3300048928 Ga0496125_0001254 Ga0496125_0001254_14209_15141 287
171 3300048928 Ga0496125_0047635 Ga0496125_0047635_746_1681 287
172 3300049575 Ga0501039_0030652 Ga0501039_0030652_2939_3922 287
173 3300049822 Ga0501035_0119329 Ga0501035_0119329_886_1869 287
174 3300053123 Ga0500614_010113 Ga0500614_010113_298_1323 287
175 3300053162 Ga0500638_049814 Ga0500638_049814_897_1922 287
176 3300053177 Ga0500636_0084495 Ga0500636_0084495_696_1721 287
177 3300060353 Ga0501082_0168841 Ga0501082_0168841_208_1191 287
178 3300005347 Ga0070668_100147751 Ga0070668_1001477512 288
179 3300005354 Ga0070675_100041338 Ga0070675_1000413382 288
180 3300005467 Ga0070706_100031624 Ga0070706_1000316243 288
181 3300005471 Ga0070698_100335125 Ga0070698_1003351251 288
182 3300013306 Ga0163162_10192709 Ga0163162_101927092 288
183 3300025926 Ga0207659_10027546 Ga0207659_100275463 288
184 3300028381 Ga0268264_10398558 Ga0268264_103985582 288
185 3300032126 Ga0307415_100131256 Ga0307415_1001312561 288
186 3300053139 Ga0500568_0020885 Ga0500568_0020885_1414_2409 288
187 3300005295 Ga0065707_10099442 Ga0065707_100994422 289
188 3300005327 Ga0070658_10032927 Ga0070658_100329272 289
189 3300005328 Ga0070676_10064494 Ga0070676_100644942 289
190 3300005330 Ga0070690_100015663 Ga0070690_1000156634 289
191 3300005330 Ga0070690_100027931 Ga0070690_1000279313 289
192 3300005331 Ga0070670_100015844 Ga0070670_1000158446 289
193 3300005333 Ga0070677_10030097 Ga0070677_100300973 289
194 3300005334 Ga0068869_100086837 Ga0068869_1000868373 289
195 3300005335 Ga0070666_10012329 Ga0070666_100123294 289
196 3300005336 Ga0070680_100004415 Ga0070680_1000044156 289
197 3300005337 Ga0070682_100016500 Ga0070682_1000165002 289
198 3300005337 Ga0070682_100063363 Ga0070682_1000633631 289
199 3300005337 Ga0070682_100082376 Ga0070682_1000823762 289
200 3300005338 Ga0068868_100038099 Ga0068868_1000380992 289
201 3300005339 Ga0070660_100029788 Ga0070660_1000297882 289
202 3300005340 Ga0070689_100001519 Ga0070689_1000015192 289
203 3300005343 Ga0070687_100001354 Ga0070687_1000013546 289
204 3300005344 Ga0070661_100018849 Ga0070661_1000188495 289
205 3300005347 Ga0070668_100071182 Ga0070668_1000711821 289
206 3300005353 Ga0070669_100007357 Ga0070669_1000073573 289
207 3300005355 Ga0070671_100514142 Ga0070671_1005141421 289
208 3300005356 Ga0070674_100000394 Ga0070674_10000039423 289
209 3300005365 Ga0070688_100045669 Ga0070688_1000456693 289
210 3300005366 Ga0070659_100000985 Ga0070659_10000098524 289
211 3300005437 Ga0070710_10068984 Ga0070710_100689842 289
212 3300005440 Ga0070705_100006180 Ga0070705_1000061805 289
213 3300005440 Ga0070705_100060010 Ga0070705_1000600102 289
214 3300005444 Ga0070694_100006125 Ga0070694_1000061253 289
215 3300005455 Ga0070663_100247157 Ga0070663_1002471572 289
216 3300005456 Ga0070678_100002606 Ga0070678_1000026063 289
217 3300005458 Ga0070681_10003614 Ga0070681_1000361414 289
218 3300005458 Ga0070681_10218431 Ga0070681_102184311 289
219 3300005459 Ga0068867_100001546 Ga0068867_10000154616 289
220 3300005466 Ga0070685_10075920 Ga0070685_100759202 289
221 3300005467 Ga0070706_100002645 Ga0070706_1000026457 289
222 3300005471 Ga0070698_100000114 Ga0070698_10000011435 289
223 3300005530 Ga0070679_100047591 Ga0070679_1000475914 289
224 3300005535 Ga0070684_100503871 Ga0070684_1005038711 289
225 3300005543 Ga0070672_100006069 Ga0070672_1000060694 289
226 3300005544 Ga0070686_100004655 Ga0070686_1000046554 289
227 3300005545 Ga0070695_100007325 Ga0070695_1000073256 289
228 3300005546 Ga0070696_100047305 Ga0070696_1000473053 289
229 3300005548 Ga0070665_100002307 Ga0070665_1000023074 289
230 3300005563 Ga0068855_100174913 Ga0068855_1001749131 289
231 3300005564 Ga0070664_100021093 Ga0070664_1000210933 289
232 3300005577 Ga0068857_100059905 Ga0068857_1000599052 289
233 3300005614 Ga0068856_100186254 Ga0068856_1001862542 289
234 3300005618 Ga0068864_100175150 Ga0068864_1001751502 289
235 3300005718 Ga0068866_10054688 Ga0068866_100546882 289
236 3300005719 Ga0068861_100218688 Ga0068861_1002186882 289
237 3300005842 Ga0068858_100135974 Ga0068858_1001359742 289
238 3300005843 Ga0068860_100017638 Ga0068860_1000176382 289
239 3300005843 Ga0068860_100245921 Ga0068860_1002459211 289
240 3300005844 Ga0068862_100021260 Ga0068862_1000212604 289
241 3300006028 Ga0070717_10024090 Ga0070717_100240905 289
242 3300006058 Ga0075432_10001979 Ga0075432_100019795 289
243 3300006237 Ga0097621_100037112 Ga0097621_1000371122 289
244 3300006358 Ga0068871_100005816 Ga0068871_10000581610 289
245 3300006844 Ga0075428_100295348 Ga0075428_1002953482 289
246 3300006846 Ga0075430_100001910 Ga0075430_1000019104 289
247 3300006847 Ga0075431_100003065 Ga0075431_1000030656 289
248 3300006852 Ga0075433_10076304 Ga0075433_100763041 289
249 3300006852 Ga0075433_10111981 Ga0075433_101119812 289
250 3300006871 Ga0075434_100141571 Ga0075434_1001415712 289
251 3300006871 Ga0075434_100473178 Ga0075434_1004731781 289
252 3300006880 Ga0075429_100098362 Ga0075429_1000983622 289
253 3300006880 Ga0075429_100144221 Ga0075429_1001442212 289
254 3300006881 Ga0068865_100004478 Ga0068865_1000044782 289
255 3300006881 Ga0068865_100010331 Ga0068865_1000103315 289
256 3300006914 Ga0075436_100149379 Ga0075436_1001493792 289
257 3300007076 Ga0075435_100097970 Ga0075435_1000979703 289
258 3300009094 Ga0111539_10260481 Ga0111539_102604812 289
259 3300009098 Ga0105245_10000099 Ga0105245_1000009944 289
260 3300009098 Ga0105245_10118545 Ga0105245_101185452 289
261 3300009147 Ga0114129_10126336 Ga0114129_101263362 289
262 3300009148 Ga0105243_10004891 Ga0105243_100048913 289
263 3300009174 Ga0105241_10040792 Ga0105241_100407922 289
264 3300009176 Ga0105242_10045229 Ga0105242_100452293 289
265 3300009553 Ga0105249_10048253 Ga0105249_100482533 289
266 3300010375 Ga0105239_10022606 Ga0105239_100226062 289
267 3300010375 Ga0105239_10231783 Ga0105239_102317832 289
268 3300011119 Ga0105246_10000200 Ga0105246_100002003 289
269 3300013105 Ga0157369_10036432 Ga0157369_100364322 289
270 3300013296 Ga0157374_10128846 Ga0157374_101288463 289
271 3300013296 Ga0157374_10189801 Ga0157374_101898012 289
272 3300013297 Ga0157378_10011945 Ga0157378_100119457 289
273 3300013308 Ga0157375_10002941 Ga0157375_100029413 289
274 3300014745 Ga0157377_10019343 Ga0157377_100193433 289
275 3300014969 Ga0157376_10055439 Ga0157376_100554393 289
276 3300014969 Ga0157376_10192628 Ga0157376_101926281 289
277 3300025899 Ga0207642_10037612 Ga0207642_100376122 289
278 3300025901 Ga0207688_10004420 Ga0207688_100044203 289
279 3300025906 Ga0207699_10151304 Ga0207699_101513042 289
280 3300025907 Ga0207645_10001133 Ga0207645_1000113323 289
281 3300025909 Ga0207705_10110184 Ga0207705_101101842 289
282 3300025911 Ga0207654_10034950 Ga0207654_100349502 289
283 3300025912 Ga0207707_10269655 Ga0207707_102696552 289
284 3300025917 Ga0207660_10012261 Ga0207660_100122615 289
285 3300025919 Ga0207657_10005985 Ga0207657_100059854 289
286 3300025920 Ga0207649_10116466 Ga0207649_101164662 289
287 3300025921 Ga0207652_10017078 Ga0207652_100170783 289
288 3300025921 Ga0207652_10126027 Ga0207652_101260272 289
289 3300025923 Ga0207681_10001480 Ga0207681_1000148015 289
290 3300025925 Ga0207650_10118955 Ga0207650_101189552 289
291 3300025926 Ga0207659_10084688 Ga0207659_100846882 289
292 3300025927 Ga0207687_10000774 Ga0207687_100007749 289
293 3300025932 Ga0207690_10054181 Ga0207690_100541813 289
294 3300025933 Ga0207706_10003909 Ga0207706_1000390915 289
295 3300025934 Ga0207686_10005846 Ga0207686_100058463 289
296 3300025937 Ga0207669_10035894 Ga0207669_100358943 289
297 3300025938 Ga0207704_10011387 Ga0207704_100113874 289
298 3300025938 Ga0207704_10111776 Ga0207704_101117762 289
299 3300025940 Ga0207691_10000182 Ga0207691_1000018265 289
300 3300025942 Ga0207689_10072905 Ga0207689_100729053 289
301 3300025944 Ga0207661_10025410 Ga0207661_100254102 289
302 3300025945 Ga0207679_10004180 Ga0207679_1000418010 289
303 3300025960 Ga0207651_10116819 Ga0207651_101168192 289
304 3300025960 Ga0207651_10225689 Ga0207651_102256892 289
305 3300025961 Ga0207712_10053359 Ga0207712_100533592 289
306 3300025972 Ga0207668_10122064 Ga0207668_101220642 289
307 3300026035 Ga0207703_10151607 Ga0207703_101516072 289
308 3300026075 Ga0207708_10000291 Ga0207708_100002915 289
309 3300026078 Ga0207702_10208654 Ga0207702_102086542 289
310 3300026089 Ga0207648_10000101 Ga0207648_1000010159 289
311 3300026095 Ga0207676_10061252 Ga0207676_100612522 289
312 3300026116 Ga0207674_10004318 Ga0207674_100043184 289
313 3300026116 Ga0207674_10313947 Ga0207674_103139471 289
314 3300026118 Ga0207675_100074130 Ga0207675_1000741302 289
315 3300026121 Ga0207683_10000229 Ga0207683_1000022923 289
316 3300026121 Ga0207683_10028708 Ga0207683_100287082 289
317 3300027252 Ga0209973_1000239 Ga0209973_10002392 289
318 3300027360 Ga0209969_1002389 Ga0209969_10023893 289
319 3300027364 Ga0209967_1000547 Ga0209967_10005473 289
320 3300027378 Ga0209981_1002105 Ga0209981_10021052 289
321 3300027424 Ga0209984_1000006 Ga0209984_100000616 289
322 3300027462 Ga0210000_1000032 Ga0210000_100003223 289
323 3300027552 Ga0209982_1000705 Ga0209982_10007053 289
324 3300027614 Ga0209970_1007538 Ga0209970_10075382 289
325 3300027617 Ga0210002_1000061 Ga0210002_10000612 289
326 3300027665 Ga0209983_1000874 Ga0209983_10008746 289
327 3300027682 Ga0209971_1000642 Ga0209971_10006421 289
328 3300027695 Ga0209966_1000016 Ga0209966_100001650 289
329 3300027717 Ga0209998_10000021 Ga0209998_1000002134 289
330 3300027876 Ga0209974_10000003 Ga0209974_1000000315 289
331 3300027907 Ga0207428_10001120 Ga0207428_1000112032 289
332 3300028379 Ga0268266_10044738 Ga0268266_100447383 289
333 3300028380 Ga0268265_10013370 Ga0268265_100133703 289
334 3300028794 Ga0307515_10015000 Ga0307515_100150006 289
335 3300028800 Ga0265338_10203924 Ga0265338_102039242 289
336 3300031238 Ga0265332_10020875 Ga0265332_100208752 289
337 3300031456 Ga0307513_10010635 Ga0307513_100106357 289
338 3300031456 Ga0307513_10186517 Ga0307513_101865172 289
339 3300031507 Ga0307509_10010793 Ga0307509_100107934 289
340 3300031507 Ga0307509_10100579 Ga0307509_101005792 289
341 3300031507 Ga0307509_10128720 Ga0307509_101287202 289
342 3300031507 Ga0307509_10136421 Ga0307509_101364211 289
343 3300031901 Ga0307406_10052376 Ga0307406_100523762 289
344 3300032126 Ga0307415_100115272 Ga0307415_1001152722 289
345 3300035088 Ga0373940_0035055 Ga0373940_0035055_132_1109 289
346 3300035090 Ga0373949_0001386 Ga0373949_0001386_3731_4777 289
347 3300035241 Ga0373961_0000020 Ga0373961_0000020_71139_72146 289
348 3300035398 Ga0316574_0072511 Ga0316574_0072511_1090_2022 289
349 3300035691 Ga0373931_0040788 Ga0373931_0040788_1040_2017 289
350 3300036712 Ga0316584_0091412 Ga0316584_0091412_361_1293 289
351 3300045051 Ga0451576_0093757 Ga0451576_0093757_459_1436 289
352 3300045976 Ga0466967_0220246 Ga0466967_0220246_765_1763 289
353 3300046520 Ga0495637_0036110 Ga0495637_0036110_516_1493 289
354 3300046664 Ga0495659_0013982 Ga0495659_0013982_468_1445 289
355 3300046691 Ga0495670_0091914 Ga0495670_0091914_182_1159 289
356 3300047472 Ga0495686_0025513 Ga0495686_0025513_354_1349 289
357 3300049519 Ga0501296_006766 Ga0501296_006766_59_1036 289
358 3300049574 Ga0501038_0039168 Ga0501038_0039168_1267_2244 289
359 3300049581 Ga0501047_0095852 Ga0501047_0095852_1577_2575 289
360 3300049581 Ga0501047_0143491 Ga0501047_0143491_424_1422 289
361 3300049584 Ga0501068_0087011 Ga0501068_0087011_723_1700 289
362 3300049586 Ga0501070_0023242 Ga0501070_0023242_4023_5021 289
363 3300049586 Ga0501070_0078064 Ga0501070_0078064_808_1806 289
364 3300049587 Ga0501071_0004046 Ga0501071_0004046_5503_6480 289
365 3300049589 Ga0501073_0108362 Ga0501073_0108362_527_1525 289
366 3300049590 Ga0501074_0155538 Ga0501074_0155538_555_1532 289
367 3300049591 Ga0501075_0017241 Ga0501075_0017241_454_1431 289
368 3300049593 Ga0501077_0079742 Ga0501077_0079742_558_1535 289
369 3300049667 Ga0501230_007885 Ga0501230_007885_256_1251 289
370 3300049741 Ga0501079_0070270 Ga0501079_0070270_1594_2571 289
371 3300049823 Ga0501044_0030731 Ga0501044_0030731_1215_2213 289
372 3300050508 nmdc:mga09592_126987_c1 nmdc:mga09592_126987_c1_1056_2033 289
373 3300050508 nmdc:mga09592_56990_c1 nmdc:mga09592_56990_c1_1716_2693 289
374 3300050509 nmdc:mga0qj67_7424_c1 nmdc:mga0qj67_7424_c1_6284_7261 289
375 3300050509 nmdc:mga0qj67_8914_c1 nmdc:mga0qj67_8914_c1_4393_5370 289
376 3300050510 nmdc:mga06r32_20429_c1 nmdc:mga06r32_20429_c1_857_1834 289
377 3300050511 nmdc:mga08y16_40174_c1 nmdc:mga08y16_40174_c1_2873_3850 289
378 3300050512 nmdc:mga0n895_25119_c1 nmdc:mga0n895_25119_c1_1466_2443 289
379 3300050512 nmdc:mga0n895_45444_c1 nmdc:mga0n895_45444_c1_954_1931 289
380 3300050513 nmdc:mga0rr50_9841_c1 nmdc:mga0rr50_9841_c1_103_1080 289
381 3300050514 nmdc:mga08x19_148882_c1 nmdc:mga08x19_148882_c1_398_1375 289
382 3300050515 nmdc:mga0a205_33356_c1 nmdc:mga0a205_33356_c1_2758_3735 289
383 3300053092 Ga0500583_0007096 Ga0500583_0007096_2500_3555 289
384 3300053163 Ga0500639_017834 Ga0500639_017834_2505_3560 289
385 3300054114 Ga0501084_0317574 Ga0501084_0317574_115_1113 289
386 3300059424 Ga0590075_032038 Ga0590075_032038_94_1071 289
387 3300059426 Ga0590077_009132 Ga0590077_009132_191_1168 289
388 3300059426 Ga0590077_012961 Ga0590077_012961_690_1667 289
389 3300060353 Ga0501082_0395773 Ga0501082_0395773_107_1084 289
390 3300031344 Ga0265316_10000230 Ga0265316_1000023061 290
391 3300031727 Ga0316576_10000591 Ga0316576_100005918 290
392 3300031730 Ga0307516_10013815 Ga0307516_100138152 290
393 3300031824 Ga0307413_10017077 Ga0307413_100170773 290
394 3300031852 Ga0307410_10050917 Ga0307410_100509173 290
395 3300031995 Ga0307409_100124325 Ga0307409_1001243252 290
396 3300032002 Ga0307416_100294136 Ga0307416_1002941361 290
397 3300032005 Ga0307411_10008204 Ga0307411_100082044 290
398 3300032126 Ga0307415_100060451 Ga0307415_1000604512 290
399 3300041406 Ga0439439_0015824 Ga0439439_0015824_212_1192 290
400 3300041411 Ga0439466_0017981 Ga0439466_0017981_374_1354 290
401 3300042010 Ga0439452_004979 Ga0439452_004979_899_1879 290
402 3300044712 Ga0453684_0331514 Ga0453684_0331514_708_1700 290
403 3300049513 Ga0501290_000039 Ga0501290_000039_13943_14923 290
404 3300049514 Ga0501291_000019 Ga0501291_000019_9406_10386 290
405 3300049515 Ga0501292_000403 Ga0501292_000403_4128_5108 290
406 3300049517 Ga0501294_001525 Ga0501294_001525_743_1723 290
407 3300049518 Ga0501295_000011 Ga0501295_000011_17329_18309 290
408 3300049520 Ga0501297_000006 Ga0501297_000006_6129_7109 290
409 3300049521 Ga0501298_000012 Ga0501298_000012_14730_15710 290
410 3300049522 Ga0501299_000715 Ga0501299_000715_560_1540 290
411 3300049523 Ga0501300_000483 Ga0501300_000483_750_1730 290
412 3300049524 Ga0501301_000228 Ga0501301_000228_1614_2594 290
413 3300049586 Ga0501070_0139358 Ga0501070_0139358_1111_1986 290
414 3300049649 Ga0501198_002606 Ga0501198_002606_1300_2280 290
415 3300049650 Ga0501199_000121 Ga0501199_000121_1973_2953 290
416 3300049654 Ga0501207_000226 Ga0501207_000226_2090_3070 290
417 3300049655 Ga0501208_000359 Ga0501208_000359_164_1144 290
418 3300049660 Ga0501216_000387 Ga0501216_000387_3668_4648 290
419 3300049661 Ga0501217_001318 Ga0501217_001318_983_1963 290
420 3300049665 Ga0501227_004929 Ga0501227_004929_1296_2276 290
421 3300049668 Ga0501233_000301 Ga0501233_000301_1437_2417 290
422 3300049669 Ga0501235_000299 Ga0501235_000299_2250_3230 290
423 3300049670 Ga0501236_002905 Ga0501236_002905_505_1485 290
424 3300049675 Ga0501243_000533 Ga0501243_000533_1940_2920 290
425 3300049676 Ga0501246_000183 Ga0501246_000183_1973_2953 290
426 3300049678 Ga0501248_001084 Ga0501248_001084_490_1470 290
427 3300049679 Ga0501249_000187 Ga0501249_000187_715_1695 290
428 3300049681 Ga0501251_000388 Ga0501251_000388_551_1531 290
429 3300049682 Ga0501252_001159 Ga0501252_001159_1183_2163 290
430 3300049686 Ga0501257_014580 Ga0501257_014580_359_1339 290
431 3300049688 Ga0501259_004175 Ga0501259_004175_732_1712 290
432 3300049689 Ga0501260_000130 Ga0501260_000130_2059_3039 290
433 3300049690 Ga0501261_000368 Ga0501261_000368_1291_2271 290
434 3300049703 Ga0501219_000921 Ga0501219_000921_1282_2262 290
435 3300049704 Ga0501221_000411 Ga0501221_000411_365_1345 290
436 3300049705 Ga0501225_0001272 Ga0501225_0001272_4559_5539 290
437 3300049706 Ga0501229_000409 Ga0501229_000409_687_1667 290
438 3300049707 Ga0501234_000067 Ga0501234_000067_5564_6544 290
439 3300049757 Ga0501232_000390 Ga0501232_000390_1495_2475 290
440 3300049761 Ga0501264_000556 Ga0501264_000556_4115_5095 290
441 3300049762 Ga0501265_002952 Ga0501265_002952_309_1289 290
442 3300049763 Ga0501266_000463 Ga0501266_000463_4290_5270 290
443 3300049767 Ga0501270_001992 Ga0501270_001992_384_1364 290
444 3300049769 Ga0501272_000065 Ga0501272_000065_1438_2418 290
445 3300049770 Ga0501273_000307 Ga0501273_000307_1299_2279 290
446 3300049772 Ga0501275_004489 Ga0501275_004489_175_1155 290
447 3300049775 Ga0501279_000197 Ga0501279_000197_6662_7642 290
448 3300049777 Ga0501281_00384 Ga0501281_00384_2809_3789 290
449 3300049779 Ga0501283_000015 Ga0501283_000015_6306_7286 290
450 3300049851 Ga0501212_007373 Ga0501212_007373_450_1430 290
451 3300049853 Ga0501226_004624 Ga0501226_004624_253_1233 290
452 3300050508 nmdc:mga09592_88265_c1 nmdc:mga09592_88265_c1_794_1795 290
453 3300003791 Ga0055530_10014664 Ga0055530_100146642 291
454 3300005471 Ga0070698_100164837 Ga0070698_1001648372 291
455 3300025298 Ga0209050_1000908 Ga0209050_100090817 291
456 3300027907 Ga0207428_10006333 Ga0207428_100063332 291
457 3300028786 Ga0307517_10031500 Ga0307517_100315002 291
458 3300031507 Ga0307509_10000007 Ga0307509_1000000728 291
459 3300031730 Ga0307516_10114082 Ga0307516_101140822 291
460 3300035113 Ga0373936_0000035 Ga0373936_0000035_69573_70598 291
461 3300036712 Ga0316584_0000325 Ga0316584_0000325_2275_3291 291
462 3300037312 Ga0395899_0004859 Ga0395899_0004859_5264_6268 291
463 3300037418 Ga0395900_0044586 Ga0395900_0044586_85_1089 291
464 3300037466 Ga0395898_0139593 Ga0395898_0139593_55_1059 291
465 3300048918 Ga0496115_0098672 Ga0496115_0098672_726_1730 291
466 3300053090 Ga0500646_0005402 Ga0500646_0005402_870_1922 291
467 3300053095 Ga0500640_006413 Ga0500640_006413_554_1582 291
468 3300053102 Ga0500554_001427 Ga0500554_001427_558_1586 291
469 3300053111 Ga0500572_003251 Ga0500572_003251_2101_3129 291
470 3300053119 Ga0500595_000080 Ga0500595_000080_63560_64588 291
471 3300053121 Ga0500607_150014 Ga0500607_150014_29_1057 291
472 3300053123 Ga0500614_000998 Ga0500614_000998_686_1714 291
473 3300053136 Ga0500559_0042880 Ga0500559_0042880_68_1096 291
474 3300053154 Ga0500619_037329 Ga0500619_037329_69_1097 291
475 3300053080 Ga0500635_0016485 Ga0500635_0016485_808_1887 292
476 3300053086 Ga0500578_0051718 Ga0500578_0051718_672_1760 292
477 3300053094 Ga0500566_0035668 Ga0500566_0035668_900_1979 292
478 3300053094 Ga0500566_0101427 Ga0500566_0101427_415_1452 292
479 3300053150 Ga0500603_010891 Ga0500603_010891_133_1212 292
480 3300053177 Ga0500636_0175579 Ga0500636_0175579_51_1088 292
481 3300031691 Ga0316579_10003565 Ga0316579_100035654 293
482 3300039062 Ga0400483_005312 Ga0400483_005312_712_1701 293
483 3300039062 Ga0400483_224315 Ga0400483_224315_4853_5842 293
484 3300049568 Ga0501031_0013859 Ga0501031_0013859_4177_5169 293
485 3300049573 Ga0501037_0013052 Ga0501037_0013052_3004_3996 293
486 3300049575 Ga0501039_0431830 Ga0501039_0431830_27_1019 293
487 3300049577 Ga0501041_0073022 Ga0501041_0073022_997_1989 293
488 3300049578 Ga0501042_0055737 Ga0501042_0055737_438_1430 293
489 3300049592 Ga0501076_0163347 Ga0501076_0163347_175_1167 293
490 3300050511 nmdc:mga08y16_579738_c1 nmdc:mga08y16_579738_c1_48_1100 293
491 3300005535 Ga0070684_100078633 Ga0070684_1000786332 294
492 3300010375 Ga0105239_10001416 Ga0105239_1000141617 294
493 3300011119 Ga0105246_10110679 Ga0105246_101106792 294
494 3300025944 Ga0207661_10032917 Ga0207661_100329173 294
495 3300036647 Ga0316582_0218205 Ga0316582_0218205_18_977 294
496 3300053122 Ga0500608_000243 Ga0500608_000243_7176_8180 294
497 3300005295 Ga0065707_10027286 Ga0065707_100272862 295
498 3300005295 Ga0065707_10100377 Ga0065707_101003772 295
499 3300005330 Ga0070690_100000348 Ga0070690_10000034814 295
500 3300005340 Ga0070689_100000090 Ga0070689_10000009045 295
501 3300005343 Ga0070687_100027515 Ga0070687_1000275152 295
502 3300005365 Ga0070688_100000135 Ga0070688_10000013520 295
503 3300005365 Ga0070688_100269889 Ga0070688_1002698891 295
504 3300005438 Ga0070701_10045184 Ga0070701_100451842 295
505 3300005441 Ga0070700_100000257 Ga0070700_1000002579 295
506 3300005441 Ga0070700_100173444 Ga0070700_1001734442 295
507 3300005444 Ga0070694_100012346 Ga0070694_1000123464 295
508 3300005444 Ga0070694_100112811 Ga0070694_1001128112 295
509 3300005444 Ga0070694_100171004 Ga0070694_1001710042 295
510 3300005458 Ga0070681_10001753 Ga0070681_1000175312 295
511 3300005459 Ga0068867_100002470 Ga0068867_1000024708 295
512 3300005466 Ga0070685_10000073 Ga0070685_1000007330 295
513 3300005467 Ga0070706_100021603 Ga0070706_1000216033 295
514 3300005468 Ga0070707_100000018 Ga0070707_10000001899 295
515 3300005468 Ga0070707_100024642 Ga0070707_1000246424 295
516 3300005468 Ga0070707_100489467 Ga0070707_1004894672 295
517 3300005471 Ga0070698_100011560 Ga0070698_1000115602 295
518 3300005471 Ga0070698_100082096 Ga0070698_1000820962 295
519 3300005471 Ga0070698_100142901 Ga0070698_1001429013 295
520 3300005518 Ga0070699_100005710 Ga0070699_1000057102 295
521 3300005518 Ga0070699_100082524 Ga0070699_1000825243 295
522 3300005536 Ga0070697_100090641 Ga0070697_1000906412 295
523 3300005544 Ga0070686_100000089 Ga0070686_10000008960 295
524 3300005544 Ga0070686_100010699 Ga0070686_1000106993 295
525 3300005545 Ga0070695_100015463 Ga0070695_1000154632 295
526 3300005547 Ga0070693_100041818 Ga0070693_1000418183 295
527 3300005549 Ga0070704_100054340 Ga0070704_1000543403 295
528 3300005549 Ga0070704_100070773 Ga0070704_1000707733 295
529 3300005617 Ga0068859_100002892 Ga0068859_10000289218 295
530 3300005617 Ga0068859_100400751 Ga0068859_1004007511 295
531 3300005719 Ga0068861_100163883 Ga0068861_1001638832 295
532 3300005844 Ga0068862_100347006 Ga0068862_1003470062 295
533 3300006237 Ga0097621_100009427 Ga0097621_1000094274 295
534 3300006358 Ga0068871_100110325 Ga0068871_1001103252 295
535 3300006852 Ga0075433_10002999 Ga0075433_100029995 295
536 3300006871 Ga0075434_100050376 Ga0075434_1000503763 295
537 3300006931 Ga0097620_100002892 Ga0097620_10000289218 295
538 3300006931 Ga0097620_100400764 Ga0097620_1004007641 295
539 3300009098 Ga0105245_10252055 Ga0105245_102520552 295
540 3300009176 Ga0105242_10013265 Ga0105242_100132653 295
541 3300014325 Ga0163163_10199296 Ga0163163_101992962 295
542 3300014969 Ga0157376_10003733 Ga0157376_100037332 295
543 3300025912 Ga0207707_10010179 Ga0207707_100101793 295
544 3300025917 Ga0207660_10125724 Ga0207660_101257242 295
545 3300025918 Ga0207662_10007367 Ga0207662_100073675 295
546 3300025922 Ga0207646_10000072 Ga0207646_10000072101 295
547 3300025927 Ga0207687_10136843 Ga0207687_101368432 295
548 3300025936 Ga0207670_10000032 Ga0207670_1000003264 295
549 3300025939 Ga0207665_10060502 Ga0207665_100605024 295
550 3300025941 Ga0207711_10001788 Ga0207711_1000178811 295
551 3300026075 Ga0207708_10000413 Ga0207708_1000041333 295
552 3300026118 Ga0207675_100200856 Ga0207675_1002008562 295
553 3300027717 Ga0209998_10019074 Ga0209998_100190742 295
554 3300031727 Ga0316576_10011115 Ga0316576_100111151 295
555 3300035086 Ga0373934_0059328 Ga0373934_0059328_456_1466 295
556 3300035113 Ga0373936_0085388 Ga0373936_0085388_242_1252 295
557 3300035410 Ga0373924_0027753 Ga0373924_0027753_475_1485 295
558 3300035692 Ga0373935_0012043 Ga0373935_0012043_3012_4022 295
559 3300035724 Ga0373933_0069486 Ga0373933_0069486_672_1682 295
560 3300035725 Ga0373947_0016709 Ga0373947_0016709_2289_3299 295
561 3300036401 Ga0373937_0031486 Ga0373937_0031486_2229_3239 295
562 3300037068 Ga0373925_0154412 Ga0373925_0154412_318_1328 295
563 3300038443 Ga0395901_0091814 Ga0395901_0091814_1092_2183 295
564 3300042876 Ga0451577_0180898 Ga0451577_0180898_325_1335 295
565 3300046459 Ga0495629_0013291 Ga0495629_0013291_3392_4402 295
566 3300046472 Ga0495580_0115243 Ga0495580_0115243_461_1471 295
567 3300046499 Ga0495594_0025000 Ga0495594_0025000_1771_2781 295
568 3300046519 Ga0495632_0066854 Ga0495632_0066854_340_1401 295
569 3300046536 Ga0495587_0084415 Ga0495587_0084415_366_1376 295
570 3300046683 Ga0495658_0105600 Ga0495658_0105600_207_1217 295
571 3300053077 Ga0495601_0029104 Ga0495601_0029104_1465_2475 295
572 3300053077 Ga0495601_0059194 Ga0495601_0059194_714_1724 295
573 3300053085 Ga0495619_0070253 Ga0495619_0070253_1154_2164 295
574 3300002075 JGI24738J21930_10015755 JGI24738J21930_100157551 296
575 3300002126 JGI24035J26624_1001644 JGI24035J26624_10016442 296
576 3300005328 Ga0070676_10001419 Ga0070676_100014196 296
577 3300005334 Ga0068869_100091429 Ga0068869_1000914292 296
578 3300005457 Ga0070662_100003227 Ga0070662_1000032276 296
579 3300009098 Ga0105245_10029838 Ga0105245_100298384 296
580 3300009147 Ga0114129_10106309 Ga0114129_101063093 296
581 3300009553 Ga0105249_10007377 Ga0105249_100073775 296
582 3300010375 Ga0105239_10005383 Ga0105239_100053837 296
583 3300013296 Ga0157374_10036693 Ga0157374_100366933 296
584 3300013297 Ga0157378_10013383 Ga0157378_100133832 296
585 3300013306 Ga0163162_10005848 Ga0163162_100058484 296
586 3300013308 Ga0157375_10189802 Ga0157375_101898022 296
587 3300025315 Ga0207697_10000198 Ga0207697_100001985 296
588 3300025907 Ga0207645_10000634 Ga0207645_1000063420 296
589 3300025933 Ga0207706_10000702 Ga0207706_1000070222 296
590 3300025972 Ga0207668_10006913 Ga0207668_100069136 296
591 3300045051 Ga0451576_0019910 Ga0451576_0019910_3691_4584 296
592 3300050507 nmdc:mga05p37_85784_c1 nmdc:mga05p37_85784_c1_1924_2940 296
593 3300003322 rootL2_10186783 rootL2_101867832 297
594 3300009094 Ga0111539_10012258 Ga0111539_100122588 297
595 3300009094 Ga0111539_10497852 Ga0111539_104978521 297
596 3300028800 Ga0265338_10030516 Ga0265338_100305163 299
597 3300049586 Ga0501070_0041974 Ga0501070_0041974_1211_2113 300
598 3300001991 JGI24743J22301_10000044 JGI24743J22301_100000445 301
599 3300003320 rootH2_10011145 rootH2_100111457 301
600 3300003322 rootL2_10039822 rootL2_100398222 301
601 3300003322 rootL2_10074460 rootL2_100744602 301
602 3300025901 Ga0207688_10003742 Ga0207688_100037422 301
603 3300044683 Ga0466965_0007338 Ga0466965_0007338_37_945 301
604 3300044719 Ga0466971_0000025 Ga0466971_0000025_29516_30424 301
605 3300049570 Ga0501033_0000083 Ga0501033_0000083_29971_30879 301
606 3300049572 Ga0501036_0036576 Ga0501036_0036576_3208_4116 301
607 3300049573 Ga0501037_0000083 Ga0501037_0000083_50567_51475 301
608 3300049574 Ga0501038_0000329 Ga0501038_0000329_33090_33998 301
609 3300049574 Ga0501038_0022409 Ga0501038_0022409_3621_4529 301
610 3300049574 Ga0501038_0032868 Ga0501038_0032868_990_1898 301
611 3300049575 Ga0501039_0002998 Ga0501039_0002998_8409_9317 301
612 3300049579 Ga0501043_0002418 Ga0501043_0002418_1510_2418 301
613 3300049579 Ga0501043_0017594 Ga0501043_0017594_1510_2418 301
614 3300049581 Ga0501047_0002692 Ga0501047_0002692_12015_12923 301
615 3300049583 Ga0501067_0065861 Ga0501067_0065861_281_1189 301
616 3300049586 Ga0501070_0005200 Ga0501070_0005200_5987_6895 301
617 3300049822 Ga0501035_0000001 Ga0501035_0000001_495590_496498 301
618 3300049823 Ga0501044_0000159 Ga0501044_0000159_43506_44414 301
619 3300049824 Ga0501045_0180862 Ga0501045_0180862_104_1012 301
620 3300053730 Ga0500645_007906 Ga0500645_007906_731_1636 301
621 3300002155 JGI24033J26618_1000066 JGI24033J26618_100006611 302
622 3300003322 rootL2_10156277 rootL2_101562773 302
623 3300003323 rootH1_10001752 rootH1_100017524 302
624 3300005344 Ga0070661_100000479 Ga0070661_10000047924 302
625 3300005354 Ga0070675_100157950 Ga0070675_1001579502 302
626 3300005456 Ga0070678_100151009 Ga0070678_1001510092 302
627 3300005614 Ga0068856_100000537 Ga0068856_10000053728 302
628 3300013296 Ga0157374_10011253 Ga0157374_100112532 302
629 3300013297 Ga0157378_10000857 Ga0157378_100008574 302
630 3300013308 Ga0157375_10103480 Ga0157375_101034802 302
631 3300025920 Ga0207649_10000427 Ga0207649_1000042713 302
632 3300025926 Ga0207659_10168936 Ga0207659_101689362 302
633 3300026078 Ga0207702_10003806 Ga0207702_100038068 302
634 3300037312 Ga0395899_0000015 Ga0395899_0000015_373953_374864 302
635 3300037466 Ga0395898_0000051 Ga0395898_0000051_119650_120561 302
636 3300049569 Ga0501032_0000504 Ga0501032_0000504_25745_26656 302
637 3300049570 Ga0501033_0000003 Ga0501033_0000003_50521_51432 302
638 3300053104 Ga0500556_0003471 Ga0500556_0003471_3050_3958 302
639 3300042876 Ga0451577_0521500 Ga0451577_0521500_103_1026 304
640 3300049589 Ga0501073_0038848 Ga0501073_0038848_67_990 305
641 3300060353 Ga0501082_0534850 Ga0501082_0534850_57_980 305
642 3300021384 Ga0213876_10028194 Ga0213876_100281942 306
643 3300039437 Ga0436365_0014080 Ga0436365_0014080_25_1005 306
644 3300005518 Ga0070699_100070201 Ga0070699_1000702012 309
645 3300005536 Ga0070697_100089572 Ga0070697_1000895722 309
646 3300001977 JGI24746J21847_1003444 JGI24746J21847_10034442 310
647 3300005338 Ga0068868_100019130 Ga0068868_1000191303 310
648 3300005340 Ga0070689_100009358 Ga0070689_1000093584 310
649 3300005347 Ga0070668_100013058 Ga0070668_1000130582 310
650 3300005353 Ga0070669_100014808 Ga0070669_1000148082 310
651 3300005354 Ga0070675_100013175 Ga0070675_1000131753 310
652 3300005366 Ga0070659_100019927 Ga0070659_1000199272 310
653 3300005367 Ga0070667_100056590 Ga0070667_1000565902 310
654 3300005445 Ga0070708_100104158 Ga0070708_1001041582 310
655 3300005468 Ga0070707_100037631 Ga0070707_1000376313 310
656 3300005545 Ga0070695_100150832 Ga0070695_1001508322 310
657 3300005549 Ga0070704_100080429 Ga0070704_1000804292 310
658 3300005719 Ga0068861_100369053 Ga0068861_1003690531 310
659 3300005844 Ga0068862_100007910 Ga0068862_1000079106 310
660 3300025918 Ga0207662_10280271 Ga0207662_102802712 310
661 3300025922 Ga0207646_10043660 Ga0207646_100436602 310
662 3300025939 Ga0207665_10064074 Ga0207665_100640743 310
663 3300025942 Ga0207689_10283640 Ga0207689_102836402 310
664 3300025961 Ga0207712_10052076 Ga0207712_100520762 310
665 3300025986 Ga0207658_10008718 Ga0207658_100087184 310
666 3300026118 Ga0207675_100134666 Ga0207675_1001346662 310
667 3300028380 Ga0268265_10028020 Ga0268265_100280202 310
668 3300048911 Ga0496108_0246796 Ga0496108_0246796_561_1499 310
669 3300048918 Ga0496115_0018467 Ga0496115_0018467_4119_5057 310
670 2162886012 MBSR1b_contig_13535307 MBSR1b_0502.00002360 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07478

Dala_Dala_lig_C

D-ala D-ala ligase C-terminus

135

330

0.96

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

78

118

0.95

PF01820

Dala_Dala_lig_N

D-ala D-ala ligase N-terminus

36

86

0.91

PF02786

CPSase_L_D2

Carbamoyl-phosphate synthase L chain, ATP binding domain

128

302

0.85

PF13535

ATP-grasp_4

ATP-grasp domain

164

305

0.8

PF08443

RimK

RimK-like ATP-grasp domain

126

319

0.76

PF02655

ATP-grasp_3

ATP-grasp domain

126

303

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nri-assembly2.cif.gz_B crystal structure of burkholderia pseudomallei d-alanine-d-alanine ligase in complex with amp and d-ala-d-ala 0.9165 12 306
1iow-assembly1.cif.gz_A complex of y216f d-ala:d-ala ligase with adp and a phosphoryl phosphinate 0.9157 9 305
4c5b-assembly1.cif.gz_A the x-ray crystal structure of d-alanyl-d-alanine ligase in complex with atp and d-ala-d-ala 0.9149 9 305
8evx-assembly1.cif.gz_B ddla from pseudomonas aeruginosa pao1 in complex with adp and phosphorylated d-cycloserine 0.903 12 309
7u9k-assembly1.cif.gz_B staphylococcus aureus d-alanine-d-alanine ligase in complex with atp, d-ala-d-ala, mg2+ and k+ 0.9003 13 312
ID Description Score Start End Superfamily
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9487 91 305 3.30.470.20
5bpfD02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9294 91 305 3.30.470.20
3q1kB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9071 176 312 3.30.470.20
2i8cA02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.905 91 312 3.30.470.20
2yzgC02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9027 92 307 3.30.470.20
ID Description Score Start End GO Terms
AF-A0A352XNI3-F1-model_v4 D-alanine--D-alanine ligase 0.9972 11 87 GO:0016874
AF-A0A059X3G1-F1-model_v4 D-ala D-ala ligase N-terminus 0.9902 9 127 GO:0008716
AF-A0A7W0YC08-F1-model_v4 D-alanine--D-alanine ligase (EC 6.3.2.4) 0.9876 11 273 GO:0005524
GO:0008716
GO:0046872
GO:0071555
AF-A0A2V6JM71-F1-model_v4 D-alanine--D-alanine ligase 0.9757 8 174 GO:0005524
GO:0008716
GO:0046872
GO:0071555
AF-A0A7U6DW68-F1-model_v4 deleted 0.9693 61 311

Feature Viewer

pLDDT pTM Quality
89.94 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map