F474064
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 670 | 266 | 1340 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100135327|Ga0070660_1001353273 |
| Length | 169 |
| Sequence | MSKVKSTSVEVRLPSQLGYEKVAMSTAAAVAKLMGFREDRVEDLKTAVAEACINAIEHGNMLNESLSVGVVLSAGADALEVKVIDDGKGLKAVPPKPDIDRKIHGEEDPRGMGMFLIQALVDEAEWVKGSNGKSSYVRLVIRLDAVAASQREDGETRSCRAKPKRASTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 41 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 42 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009828 | Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E | Metatranscriptome | Rhizosphere |
| 64 | 3300009829 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D | Metatranscriptome | Rhizosphere |
| 65 | 3300009835 | Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B | Metatranscriptome | Rhizosphere |
| 66 | 3300009850 | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C | Metatranscriptome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 92 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 93 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 94 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 95 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 146 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 153 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 157 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 158 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 164 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 166 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 168 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 177 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 190 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 191 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 192 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 193 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 194 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 195 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 196 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 197 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 198 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 199 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 200 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 201 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 255 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 256 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.78 |
| Metatranscriptomes | 5.22 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.45 |
| Nodule | 0 |
| Rhizoplane | 4.18 |
| Rhizosphere | 93.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 23.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070660_100135327 | 3300005339 | Bacteria | 1974 |
| 2 | rootH2_10042999 | 3300003320 | Unclassified | 1640 |
| 3 | rootH2_10066083 | 3300003320 | Bacteria | 4909 |
| 4 | rootH2_10066096 | 3300003320 | Bacteria | 1898 |
| 5 | rootH1_10393081 | 3300003323 | Bacteria | 1236 |
| 6 | Ga0058861_11488209 | 3300004800 | Bacteria | 678 |
| 7 | Ga0058861_11778718 | 3300004800 | Unclassified | 815 |
| 8 | Ga0070658_10005408 | 3300005327 | Bacteria | 10361 |
| 9 | Ga0070658_10006481 | 3300005327 | Bacteria | 9484 |
| 10 | Ga0070658_10973149 | 3300005327 | Unclassified | 738 |
| 11 | Ga0070676_10013742 | 3300005328 | Bacteria | 4438 |
| 12 | Ga0070683_100026956 | 3300005329 | Bacteria | 5179 |
| 13 | Ga0070683_100150487 | 3300005329 | Unclassified | 2206 |
| 14 | Ga0070683_100581527 | 3300005329 | Bacteria | 1071 |
| 15 | Ga0070670_100063184 | 3300005331 | Bacteria | 3178 |
| 16 | Ga0068869_100001913 | 3300005334 | Bacteria | 12502 |
| 17 | Ga0068869_100191268 | 3300005334 | Unclassified | 1609 |
| 18 | Ga0068869_100281621 | 3300005334 | Bacteria | 1337 |
| 19 | Ga0070666_10044562 | 3300005335 | Bacteria | 2972 |
| 20 | Ga0070666_10062598 | 3300005335 | Unclassified | 2521 |
| 21 | Ga0070680_100081136 | 3300005336 | Bacteria | 2676 |
| 22 | Ga0070680_100162693 | 3300005336 | Bacteria | 1876 |
| 23 | Ga0070680_100437397 | 3300005336 | Unclassified | 1117 |
| 24 | Ga0070682_100194644 | 3300005337 | Bacteria | 1426 |
| 25 | Ga0068868_100000009 | 3300005338 | Bacteria | 120604 |
| 26 | Ga0068868_100015740 | 3300005338 | Bacteria | 5601 |
| 27 | Ga0068868_100022926 | 3300005338 | Bacteria | 4720 |
| 28 | Ga0070660_100000311 | 3300005339 | Bacteria | 32366 |
| 29 | Ga0070660_100067433 | 3300005339 | Bacteria | 2788 |
| 30 | Ga0070660_101015614 | 3300005339 | Bacteria | 701 |
| 31 | Ga0070661_100021911 | 3300005344 | Bacteria | 4570 |
| 32 | Ga0070661_100165020 | 3300005344 | Bacteria | 1679 |
| 33 | Ga0070668_100084709 | 3300005347 | Bacteria | 2490 |
| 34 | Ga0070675_100034487 | 3300005354 | Bacteria | 4108 |
| 35 | Ga0070671_100154151 | 3300005355 | Bacteria | 1941 |
| 36 | Ga0070673_100010611 | 3300005364 | Bacteria | 6243 |
| 37 | Ga0070659_100172730 | 3300005366 | Bacteria | 1771 |
| 38 | Ga0070659_100181963 | 3300005366 | Bacteria | 1725 |
| 39 | Ga0070667_100001882 | 3300005367 | Bacteria | 18639 |
| 40 | Ga0070667_100012140 | 3300005367 | Bacteria | 7130 |
| 41 | Ga0070714_100017303 | 3300005435 | Bacteria | 5838 |
| 42 | Ga0070714_100168901 | 3300005435 | Bacteria | 1984 |
| 43 | Ga0070713_100190228 | 3300005436 | Bacteria | 1849 |
| 44 | Ga0070713_100225407 | 3300005436 | Unclassified | 1702 |
| 45 | Ga0070713_100235136 | 3300005436 | Bacteria | 1667 |
| 46 | Ga0070713_100256280 | 3300005436 | Unclassified | 1598 |
| 47 | Ga0070713_100650745 | 3300005436 | Bacteria | 1004 |
| 48 | Ga0070710_10333662 | 3300005437 | Bacteria | 999 |
| 49 | Ga0070710_11072337 | 3300005437 | Unclassified | 590 |
| 50 | Ga0070711_100046625 | 3300005439 | Bacteria | 2954 |
| 51 | Ga0070711_100221272 | 3300005439 | Unclassified | 1472 |
| 52 | Ga0070663_100188084 | 3300005455 | Bacteria | 1606 |
| 53 | Ga0070663_100329767 | 3300005455 | Unclassified | 1230 |
| 54 | Ga0070663_100494166 | 3300005455 | Bacteria | 1015 |
| 55 | Ga0070663_100980482 | 3300005455 | Unclassified | 734 |
| 56 | Ga0070663_101564620 | 3300005455 | Unclassified | 587 |
| 57 | Ga0070678_100062022 | 3300005456 | Bacteria | 2758 |
| 58 | Ga0070662_100010729 | 3300005457 | Bacteria | 6032 |
| 59 | Ga0070681_10000804 | 3300005458 | Bacteria | 26179 |
| 60 | Ga0070681_10046056 | 3300005458 | Unclassified | 4361 |
| 61 | Ga0070681_10181592 | 3300005458 | Bacteria | 2025 |
| 62 | Ga0070681_10373753 | 3300005458 | Bacteria | 1336 |
| 63 | Ga0070679_100000226 | 3300005530 | Bacteria | 46282 |
| 64 | Ga0070679_100004694 | 3300005530 | Bacteria | 12603 |
| 65 | Ga0070679_100044742 | 3300005530 | Unclassified | 4410 |
| 66 | Ga0070679_100300525 | 3300005530 | Bacteria | 1556 |
| 67 | Ga0070679_100357466 | 3300005530 | Unclassified | 1408 |
| 68 | Ga0070684_100025564 | 3300005535 | Bacteria | 4965 |
| 69 | Ga0070684_100078675 | 3300005535 | Unclassified | 2914 |
| 70 | Ga0070684_100111897 | 3300005535 | Bacteria | 2449 |
| 71 | Ga0068853_100000914 | 3300005539 | Bacteria | 20625 |
| 72 | Ga0068853_100034028 | 3300005539 | Bacteria | 4324 |
| 73 | Ga0068853_100042984 | 3300005539 | Bacteria | 3865 |
| 74 | Ga0068853_101287819 | 3300005539 | Unclassified | 706 |
| 75 | Ga0070665_100030820 | 3300005548 | Bacteria | 5398 |
| 76 | Ga0070665_100085640 | 3300005548 | Bacteria | 3157 |
| 77 | Ga0070665_100169901 | 3300005548 | Bacteria | 2182 |
| 78 | Ga0070665_100234765 | 3300005548 | Bacteria | 1834 |
| 79 | Ga0070665_100326624 | 3300005548 | Bacteria | 1538 |
| 80 | Ga0068855_100003316 | 3300005563 | Bacteria | 19696 |
| 81 | Ga0068855_100007673 | 3300005563 | Bacteria | 13036 |
| 82 | Ga0068855_100015507 | 3300005563 | Bacteria | 9174 |
| 83 | Ga0068855_100021636 | 3300005563 | Bacteria | 7714 |
| 84 | Ga0068855_100362979 | 3300005563 | Bacteria | 1593 |
| 85 | Ga0068855_100408414 | 3300005563 | Bacteria | 1487 |
| 86 | Ga0068855_100663659 | 3300005563 | Bacteria | 1119 |
| 87 | Ga0068855_102190800 | 3300005563 | Unclassified | 555 |
| 88 | Ga0070664_100165483 | 3300005564 | Unclassified | 1959 |
| 89 | Ga0070664_100171960 | 3300005564 | Unclassified | 1922 |
| 90 | Ga0068857_100000181 | 3300005577 | Bacteria | 40250 |
| 91 | Ga0068857_100014310 | 3300005577 | Bacteria | 6914 |
| 92 | Ga0068857_100054215 | 3300005577 | Unclassified | 3557 |
| 93 | Ga0068857_100055906 | 3300005577 | Bacteria | 3502 |
| 94 | Ga0068854_100003621 | 3300005578 | Bacteria | 9666 |
| 95 | Ga0068854_100030603 | 3300005578 | Unclassified | 3734 |
| 96 | Ga0068854_100113951 | 3300005578 | Bacteria | 2043 |
| 97 | Ga0068854_101304836 | 3300005578 | Bacteria | 653 |
| 98 | Ga0068856_100012249 | 3300005614 | Bacteria | 8305 |
| 99 | Ga0068856_100015932 | 3300005614 | Bacteria | 7268 |
| 100 | Ga0068856_100017479 | 3300005614 | Bacteria | 6949 |
| 101 | Ga0068856_100028898 | 3300005614 | Bacteria | 5417 |
| 102 | Ga0068856_100076409 | 3300005614 | Unclassified | 3318 |
| 103 | Ga0068856_100129642 | 3300005614 | Bacteria | 2526 |
| 104 | Ga0068856_100241622 | 3300005614 | Bacteria | 1821 |
| 105 | Ga0068856_100562375 | 3300005614 | Bacteria | 1162 |
| 106 | Ga0068856_100576719 | 3300005614 | Bacteria | 1146 |
| 107 | Ga0068856_100750727 | 3300005614 | Bacteria | 996 |
| 108 | Ga0068852_100000199 | 3300005616 | Bacteria | 40929 |
| 109 | Ga0068852_100001654 | 3300005616 | Bacteria | 15203 |
| 110 | Ga0068852_100027066 | 3300005616 | Bacteria | 4668 |
| 111 | Ga0068852_100044386 | 3300005616 | Bacteria | 3775 |
| 112 | Ga0068852_100097933 | 3300005616 | Bacteria | 2640 |
| 113 | Ga0068852_100150067 | 3300005616 | Bacteria | 2167 |
| 114 | Ga0068852_100203299 | 3300005616 | Unclassified | 1875 |
| 115 | Ga0068852_100293226 | 3300005616 | Unclassified | 1572 |
| 116 | Ga0068859_100002712 | 3300005617 | Bacteria | 17961 |
| 117 | Ga0068859_100184430 | 3300005617 | Bacteria | 2170 |
| 118 | Ga0068859_100313535 | 3300005617 | Bacteria | 1662 |
| 119 | Ga0068864_100003465 | 3300005618 | Bacteria | 13030 |
| 120 | Ga0068866_10131164 | 3300005718 | Bacteria | 1426 |
| 121 | Ga0068861_100428645 | 3300005719 | Bacteria | 1180 |
| 122 | Ga0068851_10012603 | 3300005834 | Bacteria | 3989 |
| 123 | Ga0068851_10026100 | 3300005834 | Bacteria | 2869 |
| 124 | Ga0068851_10048580 | 3300005834 | Unclassified | 2150 |
| 125 | Ga0068863_100000273 | 3300005841 | Bacteria | 53827 |
| 126 | Ga0068863_100019580 | 3300005841 | Bacteria | 6472 |
| 127 | Ga0068858_100026536 | 3300005842 | Bacteria | 5381 |
| 128 | Ga0068858_100058900 | 3300005842 | Unclassified | 3551 |
| 129 | Ga0068858_100431672 | 3300005842 | Unclassified | 1268 |
| 130 | Ga0068860_100000031 | 3300005843 | Bacteria | 255068 |
| 131 | Ga0068862_100112116 | 3300005844 | Unclassified | 2395 |
| 132 | Ga0068862_100558009 | 3300005844 | Bacteria | 1094 |
| 133 | Ga0081540_1003073 | 3300005983 | Bacteria | 13374 |
| 134 | Ga0070717_10000898 | 3300006028 | Bacteria | 19756 |
| 135 | Ga0070717_10728862 | 3300006028 | Bacteria | 901 |
| 136 | Ga0070717_11011773 | 3300006028 | Bacteria | 757 |
| 137 | Ga0070715_10243734 | 3300006163 | Unclassified | 936 |
| 138 | Ga0097621_100007467 | 3300006237 | Bacteria | 7820 |
| 139 | Ga0097621_101265071 | 3300006237 | Unclassified | 696 |
| 140 | Ga0068871_100002198 | 3300006358 | Bacteria | 13257 |
| 141 | Ga0068871_100138203 | 3300006358 | Bacteria | 2070 |
| 142 | Ga0068871_100416408 | 3300006358 | Bacteria | 1199 |
| 143 | Ga0068871_100487955 | 3300006358 | Unclassified | 1109 |
| 144 | Ga0068865_100044913 | 3300006881 | Bacteria | 3026 |
| 145 | Ga0097620_100002712 | 3300006931 | Bacteria | 17961 |
| 146 | Ga0097620_100184430 | 3300006931 | Bacteria | 2170 |
| 147 | Ga0097620_100313551 | 3300006931 | Bacteria | 1662 |
| 148 | Ga0105240_10000002 | 3300009093 | Bacteria | 1924170 |
| 149 | Ga0105240_10001070 | 3300009093 | Bacteria | 48381 |
| 150 | Ga0105240_10001619 | 3300009093 | Bacteria | 38195 |
| 151 | Ga0105240_10002552 | 3300009093 | Bacteria | 29190 |
| 152 | Ga0105240_10002933 | 3300009093 | Bacteria | 26905 |
| 153 | Ga0105240_10003422 | 3300009093 | Bacteria | 24653 |
| 154 | Ga0105240_10068958 | 3300009093 | Bacteria | 4379 |
| 155 | Ga0105240_10092329 | 3300009093 | Bacteria | 3697 |
| 156 | Ga0105240_10263729 | 3300009093 | Unclassified | 1986 |
| 157 | Ga0105240_10273791 | 3300009093 | Bacteria | 1942 |
| 158 | Ga0105240_11690566 | 3300009093 | Bacteria | 661 |
| 159 | Ga0105245_10003181 | 3300009098 | Bacteria | 14677 |
| 160 | Ga0105245_10039374 | 3300009098 | Bacteria | 4207 |
| 161 | Ga0105245_10273907 | 3300009098 | Unclassified | 1647 |
| 162 | Ga0105245_10318564 | 3300009098 | Bacteria | 1531 |
| 163 | Ga0105247_10003136 | 3300009101 | Bacteria | 10892 |
| 164 | Ga0105247_10028798 | 3300009101 | Unclassified | 3361 |
| 165 | Ga0105247_10037922 | 3300009101 | Bacteria | 2940 |
| 166 | Ga0105247_10647858 | 3300009101 | Unclassified | 789 |
| 167 | Ga0105241_10000673 | 3300009174 | Bacteria | 25723 |
| 168 | Ga0105241_10003894 | 3300009174 | Bacteria | 11057 |
| 169 | Ga0105241_10022664 | 3300009174 | Bacteria | 4653 |
| 170 | Ga0105241_10098299 | 3300009174 | Bacteria | 2322 |
| 171 | Ga0105241_10274294 | 3300009174 | Bacteria | 1438 |
| 172 | Ga0105248_10000047 | 3300009177 | Bacteria | 163513 |
| 173 | Ga0105248_10001252 | 3300009177 | Bacteria | 28377 |
| 174 | Ga0105248_10168927 | 3300009177 | Bacteria | 2465 |
| 175 | Ga0105248_10187362 | 3300009177 | Unclassified | 2332 |
| 176 | Ga0105248_10706673 | 3300009177 | Unclassified | 1137 |
| 177 | Ga0105248_10708469 | 3300009177 | Bacteria | 1136 |
| 178 | Ga0105237_10019065 | 3300009545 | Bacteria | 7091 |
| 179 | Ga0105237_10048761 | 3300009545 | Bacteria | 4257 |
| 180 | Ga0105237_10638549 | 3300009545 | Bacteria | 1071 |
| 181 | Ga0105237_10760971 | 3300009545 | Unclassified | 975 |
| 182 | Ga0105238_10011172 | 3300009551 | Bacteria | 9033 |
| 183 | Ga0105238_10021179 | 3300009551 | Bacteria | 6626 |
| 184 | Ga0105238_10027432 | 3300009551 | Bacteria | 5803 |
| 185 | Ga0105238_10038723 | 3300009551 | Bacteria | 4841 |
| 186 | Ga0105238_10041018 | 3300009551 | Bacteria | 4689 |
| 187 | Ga0105238_10239763 | 3300009551 | Bacteria | 1791 |
| 188 | Ga0105238_10508814 | 3300009551 | Unclassified | 1206 |
| 189 | Ga0105238_10812997 | 3300009551 | Unclassified | 951 |
| 190 | Ga0105249_10061447 | 3300009553 | Unclassified | 3447 |
| 191 | Ga0105249_10340065 | 3300009553 | Bacteria | 1517 |
| 192 | Ga0130087_1078875 | 3300009828 | Bacteria | 568 |
| 193 | Ga0130086_1004910 | 3300009829 | Bacteria | 568 |
| 194 | Ga0130084_1075844 | 3300009835 | Bacteria | 568 |
| 195 | Ga0130085_1124052 | 3300009850 | Bacteria | 568 |
| 196 | Ga0105239_10001864 | 3300010375 | Bacteria | 27591 |
| 197 | Ga0105239_10075008 | 3300010375 | Bacteria | 3719 |
| 198 | Ga0105239_10107380 | 3300010375 | Bacteria | 3093 |
| 199 | Ga0105239_10118191 | 3300010375 | Unclassified | 2942 |
| 200 | Ga0105239_10163775 | 3300010375 | Bacteria | 2486 |
| 201 | Ga0105239_10320208 | 3300010375 | Bacteria | 1748 |
| 202 | Ga0105239_10440968 | 3300010375 | Bacteria | 1476 |
| 203 | Ga0105239_10752216 | 3300010375 | Bacteria | 1116 |
| 204 | Ga0105239_10859899 | 3300010375 | Unclassified | 1040 |
| 205 | Ga0105239_10975988 | 3300010375 | Bacteria | 974 |
| 206 | Ga0105246_10001815 | 3300011119 | Bacteria | 12795 |
| 207 | Ga0105246_10235672 | 3300011119 | Bacteria | 1444 |
| 208 | Ga0157373_10145851 | 3300013100 | Bacteria | 1665 |
| 209 | Ga0157373_10193408 | 3300013100 | Bacteria | 1433 |
| 210 | Ga0157373_10392121 | 3300013100 | Bacteria | 994 |
| 211 | Ga0157373_10522071 | 3300013100 | Unclassified | 859 |
| 212 | Ga0157371_10076673 | 3300013102 | Bacteria | 2367 |
| 213 | Ga0157371_10215085 | 3300013102 | Bacteria | 1380 |
| 214 | Ga0157371_10251668 | 3300013102 | Unclassified | 1272 |
| 215 | Ga0157370_10000542 | 3300013104 | Bacteria | 47157 |
| 216 | Ga0157370_10010623 | 3300013104 | Bacteria | 9691 |
| 217 | Ga0157370_10020842 | 3300013104 | Bacteria | 6541 |
| 218 | Ga0157370_10116793 | 3300013104 | Bacteria | 2492 |
| 219 | Ga0157370_10477416 | 3300013104 | Bacteria | 1146 |
| 220 | Ga0157369_10001280 | 3300013105 | Bacteria | 31263 |
| 221 | Ga0157369_10002372 | 3300013105 | Bacteria | 22630 |
| 222 | Ga0157369_10026543 | 3300013105 | Bacteria | 6424 |
| 223 | Ga0157369_10046264 | 3300013105 | Bacteria | 4729 |
| 224 | Ga0157369_10048947 | 3300013105 | Bacteria | 4584 |
| 225 | Ga0157369_10081995 | 3300013105 | Bacteria | 3451 |
| 226 | Ga0157369_10143355 | 3300013105 | Bacteria | 2527 |
| 227 | Ga0157369_10163788 | 3300013105 | Bacteria | 2346 |
| 228 | Ga0157369_10171211 | 3300013105 | Bacteria | 2288 |
| 229 | Ga0157369_10213948 | 3300013105 | Bacteria | 2020 |
| 230 | Ga0157369_10355054 | 3300013105 | Bacteria | 1522 |
| 231 | Ga0157374_10002229 | 3300013296 | Bacteria | 16328 |
| 232 | Ga0157374_10034217 | 3300013296 | Bacteria | 4639 |
| 233 | Ga0157374_10042612 | 3300013296 | Unclassified | 4187 |
| 234 | Ga0157374_10105065 | 3300013296 | Bacteria | 2712 |
| 235 | Ga0157374_10145427 | 3300013296 | Bacteria | 2302 |
| 236 | Ga0157374_10539209 | 3300013296 | Bacteria | 1174 |
| 237 | Ga0157374_11046605 | 3300013296 | Unclassified | 836 |
| 238 | Ga0157378_10007247 | 3300013297 | Bacteria | 9682 |
| 239 | Ga0157378_10013136 | 3300013297 | Bacteria | 7247 |
| 240 | Ga0157378_10066515 | 3300013297 | Bacteria | 3228 |
| 241 | Ga0157378_10172143 | 3300013297 | Unclassified | 2031 |
| 242 | Ga0157378_10647715 | 3300013297 | Bacteria | 1072 |
| 243 | Ga0163162_10115828 | 3300013306 | Bacteria | 2780 |
| 244 | Ga0163162_10709340 | 3300013306 | Unclassified | 1127 |
| 245 | Ga0163162_11165302 | 3300013306 | Unclassified | 874 |
| 246 | Ga0157372_10000408 | 3300013307 | Bacteria | 47157 |
| 247 | Ga0157372_10002226 | 3300013307 | Bacteria | 21043 |
| 248 | Ga0157372_10003039 | 3300013307 | Bacteria | 18084 |
| 249 | Ga0157372_10003426 | 3300013307 | Bacteria | 17114 |
| 250 | Ga0157372_10021880 | 3300013307 | Bacteria | 6912 |
| 251 | Ga0157372_10100329 | 3300013307 | Bacteria | 3304 |
| 252 | Ga0157372_10292889 | 3300013307 | Bacteria | 1893 |
| 253 | Ga0157372_10345838 | 3300013307 | Unclassified | 1733 |
| 254 | Ga0157372_10386506 | 3300013307 | Bacteria | 1630 |
| 255 | Ga0157372_10393699 | 3300013307 | Bacteria | 1614 |
| 256 | Ga0157372_10419692 | 3300013307 | Bacteria | 1559 |
| 257 | Ga0157372_10485241 | 3300013307 | Bacteria | 1441 |
| 258 | Ga0157372_10763684 | 3300013307 | Bacteria | 1124 |
| 259 | Ga0157372_10914201 | 3300013307 | Bacteria | 1018 |
| 260 | Ga0157375_10006678 | 3300013308 | Bacteria | 10046 |
| 261 | Ga0157375_10034594 | 3300013308 | Bacteria | 4815 |
| 262 | Ga0157375_10164572 | 3300013308 | Bacteria | 2362 |
| 263 | Ga0163163_10000237 | 3300014325 | Bacteria | 56191 |
| 264 | Ga0163163_10930455 | 3300014325 | Unclassified | 933 |
| 265 | Ga0163163_11468326 | 3300014325 | Unclassified | 743 |
| 266 | Ga0157380_10137554 | 3300014326 | Bacteria | 2093 |
| 267 | Ga0182008_10297901 | 3300014497 | Bacteria | 843 |
| 268 | Ga0157377_10140699 | 3300014745 | Bacteria | 1483 |
| 269 | Ga0157379_10015308 | 3300014968 | Bacteria | 6727 |
| 270 | Ga0157379_10052254 | 3300014968 | Bacteria | 3650 |
| 271 | Ga0157379_10351789 | 3300014968 | Unclassified | 1349 |
| 272 | Ga0157376_10000386 | 3300014969 | Bacteria | 28694 |
| 273 | Ga0157376_10015969 | 3300014969 | Bacteria | 5689 |
| 274 | Ga0157376_10018459 | 3300014969 | Bacteria | 5349 |
| 275 | Ga0157376_10047670 | 3300014969 | Bacteria | 3539 |
| 276 | Ga0157376_10062577 | 3300014969 | Bacteria | 3132 |
| 277 | Ga0157376_10134642 | 3300014969 | Bacteria | 2210 |
| 278 | Ga0157376_10545664 | 3300014969 | Unclassified | 1146 |
| 279 | Ga0163161_10128650 | 3300017792 | Bacteria | 1908 |
| 280 | Ga0206349_1950787 | 3300020075 | Unclassified | 711 |
| 281 | Ga0206351_10231283 | 3300020077 | Unclassified | 971 |
| 282 | Ga0206352_10818192 | 3300020078 | Bacteria | 718 |
| 283 | Ga0206350_10428001 | 3300020080 | Bacteria | 787 |
| 284 | Ga0206350_11401342 | 3300020080 | Bacteria | 983 |
| 285 | Ga0206354_11683905 | 3300020081 | Bacteria | 590 |
| 286 | Ga0206353_10193638 | 3300020082 | Bacteria | 1161 |
| 287 | Ga0224570_100061 | 3300022730 | Bacteria | 5840 |
| 288 | Ga0224569_101946 | 3300022732 | Unclassified | 1706 |
| 289 | Ga0224572_1003039 | 3300024225 | Bacteria | 2790 |
| 290 | Ga0224572_1003818 | 3300024225 | Bacteria | 2572 |
| 291 | Ga0228598_1004954 | 3300024227 | Bacteria | 2802 |
| 292 | Ga0209233_1021243 | 3300025261 | Bacteria | 1685 |
| 293 | Ga0207697_10031456 | 3300025315 | Bacteria | 2171 |
| 294 | Ga0207656_10003780 | 3300025321 | Bacteria | 5243 |
| 295 | Ga0207656_10013842 | 3300025321 | Bacteria | 3093 |
| 296 | Ga0207656_10052383 | 3300025321 | Unclassified | 1767 |
| 297 | Ga0207692_10103896 | 3300025898 | Bacteria | 1565 |
| 298 | Ga0207642_10102103 | 3300025899 | Bacteria | 1442 |
| 299 | Ga0207710_10001408 | 3300025900 | Bacteria | 12030 |
| 300 | Ga0207688_10342059 | 3300025901 | Bacteria | 920 |
| 301 | Ga0207680_10045351 | 3300025903 | Bacteria | 2591 |
| 302 | Ga0207680_10051850 | 3300025903 | Bacteria | 2455 |
| 303 | Ga0207680_10072280 | 3300025903 | Bacteria | 2141 |
| 304 | Ga0207647_10038062 | 3300025904 | Unclassified | 3044 |
| 305 | Ga0207647_10041732 | 3300025904 | Bacteria | 2883 |
| 306 | Ga0207647_10306155 | 3300025904 | Unclassified | 904 |
| 307 | Ga0207645_10057989 | 3300025907 | Bacteria | 2472 |
| 308 | Ga0207705_10816132 | 3300025909 | Unclassified | 724 |
| 309 | Ga0207654_10000078 | 3300025911 | Bacteria | 63974 |
| 310 | Ga0207654_10000095 | 3300025911 | Bacteria | 59415 |
| 311 | Ga0207654_10000236 | 3300025911 | Bacteria | 33775 |
| 312 | Ga0207654_10021215 | 3300025911 | Bacteria | 3452 |
| 313 | Ga0207654_10060307 | 3300025911 | Bacteria | 2216 |
| 314 | Ga0207707_10020940 | 3300025912 | Bacteria | 5713 |
| 315 | Ga0207707_10143838 | 3300025912 | Bacteria | 2084 |
| 316 | Ga0207707_10382273 | 3300025912 | Bacteria | 1210 |
| 317 | Ga0207707_10452822 | 3300025912 | Unclassified | 1098 |
| 318 | Ga0207695_10000002 | 3300025913 | Bacteria | 2188391 |
| 319 | Ga0207695_10000075 | 3300025913 | Bacteria | 308496 |
| 320 | Ga0207695_10000145 | 3300025913 | Bacteria | 209555 |
| 321 | Ga0207695_10000787 | 3300025913 | Bacteria | 59756 |
| 322 | Ga0207695_10001098 | 3300025913 | Bacteria | 47165 |
| 323 | Ga0207695_10001570 | 3300025913 | Bacteria | 37221 |
| 324 | Ga0207695_10005982 | 3300025913 | Bacteria | 15912 |
| 325 | Ga0207695_10020928 | 3300025913 | Bacteria | 7476 |
| 326 | Ga0207695_10081808 | 3300025913 | Bacteria | 3267 |
| 327 | Ga0207695_10120524 | 3300025913 | Bacteria | 2592 |
| 328 | Ga0207695_10124594 | 3300025913 | Bacteria | 2541 |
| 329 | Ga0207695_10130213 | 3300025913 | Bacteria | 2474 |
| 330 | Ga0207695_10160348 | 3300025913 | Unclassified | 2181 |
| 331 | Ga0207695_10298617 | 3300025913 | Bacteria | 1502 |
| 332 | Ga0207671_10000032 | 3300025914 | Bacteria | 245878 |
| 333 | Ga0207671_10000324 | 3300025914 | Bacteria | 70145 |
| 334 | Ga0207671_10114340 | 3300025914 | Bacteria | 2057 |
| 335 | Ga0207671_11014145 | 3300025914 | Bacteria | 654 |
| 336 | Ga0207663_10400454 | 3300025916 | Unclassified | 1050 |
| 337 | Ga0207660_10056514 | 3300025917 | Unclassified | 2808 |
| 338 | Ga0207660_10061047 | 3300025917 | Bacteria | 2712 |
| 339 | Ga0207660_10145932 | 3300025917 | Unclassified | 1813 |
| 340 | Ga0207657_10001924 | 3300025919 | Bacteria | 22428 |
| 341 | Ga0207649_10044728 | 3300025920 | Bacteria | 2712 |
| 342 | Ga0207652_10018951 | 3300025921 | Bacteria | 5651 |
| 343 | Ga0207652_10029748 | 3300025921 | Bacteria | 4570 |
| 344 | Ga0207681_10126464 | 3300025923 | Bacteria | 1883 |
| 345 | Ga0207694_10000024 | 3300025924 | Bacteria | 259443 |
| 346 | Ga0207694_10000259 | 3300025924 | Bacteria | 50419 |
| 347 | Ga0207694_10004199 | 3300025924 | Bacteria | 11285 |
| 348 | Ga0207694_10005121 | 3300025924 | Bacteria | 10118 |
| 349 | Ga0207694_10038917 | 3300025924 | Bacteria | 3657 |
| 350 | Ga0207694_10114135 | 3300025924 | Bacteria | 2151 |
| 351 | Ga0207694_10435050 | 3300025924 | Unclassified | 1094 |
| 352 | Ga0207650_10002268 | 3300025925 | Bacteria | 13423 |
| 353 | Ga0207687_10000208 | 3300025927 | Bacteria | 39686 |
| 354 | Ga0207687_10015318 | 3300025927 | Bacteria | 5024 |
| 355 | Ga0207687_10083925 | 3300025927 | Bacteria | 2308 |
| 356 | Ga0207687_10113093 | 3300025927 | Bacteria | 2019 |
| 357 | Ga0207700_10133289 | 3300025928 | Bacteria | 2032 |
| 358 | Ga0207664_10149234 | 3300025929 | Bacteria | 1985 |
| 359 | Ga0207664_10385618 | 3300025929 | Unclassified | 1244 |
| 360 | Ga0207644_10104501 | 3300025931 | Unclassified | 2132 |
| 361 | Ga0207644_10338217 | 3300025931 | Unclassified | 1220 |
| 362 | Ga0207690_10141739 | 3300025932 | Bacteria | 1772 |
| 363 | Ga0207706_10002070 | 3300025933 | Bacteria | 19666 |
| 364 | Ga0207704_10021101 | 3300025938 | Bacteria | 3461 |
| 365 | Ga0207665_10421223 | 3300025939 | Unclassified | 1020 |
| 366 | Ga0207711_10000040 | 3300025941 | Bacteria | 162754 |
| 367 | Ga0207711_10001178 | 3300025941 | Bacteria | 24859 |
| 368 | Ga0207711_10143846 | 3300025941 | Bacteria | 2147 |
| 369 | Ga0207711_10175034 | 3300025941 | Unclassified | 1949 |
| 370 | Ga0207711_10730544 | 3300025941 | Bacteria | 923 |
| 371 | Ga0207689_10000487 | 3300025942 | Bacteria | 37505 |
| 372 | Ga0207689_10171493 | 3300025942 | Bacteria | 1788 |
| 373 | Ga0207661_10000123 | 3300025944 | Bacteria | 49544 |
| 374 | Ga0207661_10016981 | 3300025944 | Bacteria | 5376 |
| 375 | Ga0207661_10117736 | 3300025944 | Bacteria | 2257 |
| 376 | Ga0207661_10232131 | 3300025944 | Bacteria | 1634 |
| 377 | Ga0207661_10240726 | 3300025944 | Unclassified | 1605 |
| 378 | Ga0207661_10610603 | 3300025944 | Bacteria | 1001 |
| 379 | Ga0207679_10207770 | 3300025945 | Bacteria | 1640 |
| 380 | Ga0207679_10344300 | 3300025945 | Bacteria | 1297 |
| 381 | Ga0207667_10000188 | 3300025949 | Bacteria | 90598 |
| 382 | Ga0207667_10000659 | 3300025949 | Bacteria | 44741 |
| 383 | Ga0207667_10009596 | 3300025949 | Bacteria | 11389 |
| 384 | Ga0207667_10020170 | 3300025949 | Bacteria | 7421 |
| 385 | Ga0207667_10070194 | 3300025949 | Bacteria | 3646 |
| 386 | Ga0207667_10261180 | 3300025949 | Bacteria | 1771 |
| 387 | Ga0207651_10042316 | 3300025960 | Bacteria | 3031 |
| 388 | Ga0207668_10050977 | 3300025972 | Bacteria | 2856 |
| 389 | Ga0207640_10012003 | 3300025981 | Bacteria | 4923 |
| 390 | Ga0207640_10138733 | 3300025981 | Bacteria | 1769 |
| 391 | Ga0207640_11206333 | 3300025981 | Bacteria | 673 |
| 392 | Ga0207640_11333929 | 3300025981 | Bacteria | 641 |
| 393 | Ga0207658_10000135 | 3300025986 | Bacteria | 77651 |
| 394 | Ga0207658_10013447 | 3300025986 | Bacteria | 5590 |
| 395 | Ga0207677_10090329 | 3300026023 | Bacteria | 2225 |
| 396 | Ga0207677_10164829 | 3300026023 | Unclassified | 1726 |
| 397 | Ga0207703_10023052 | 3300026035 | Unclassified | 4888 |
| 398 | Ga0207703_10181957 | 3300026035 | Bacteria | 1855 |
| 399 | Ga0207703_10388071 | 3300026035 | Unclassified | 1293 |
| 400 | Ga0207703_10607108 | 3300026035 | Unclassified | 1035 |
| 401 | Ga0207639_10000050 | 3300026041 | Bacteria | 121432 |
| 402 | Ga0207639_10009673 | 3300026041 | Bacteria | 6660 |
| 403 | Ga0207639_10059914 | 3300026041 | Bacteria | 2935 |
| 404 | Ga0207639_11244107 | 3300026041 | Unclassified | 699 |
| 405 | Ga0207678_10051293 | 3300026067 | Bacteria | 3562 |
| 406 | Ga0207678_10313195 | 3300026067 | Unclassified | 1350 |
| 407 | Ga0207678_10462456 | 3300026067 | Bacteria | 1104 |
| 408 | Ga0207678_10820234 | 3300026067 | Unclassified | 822 |
| 409 | Ga0207702_10000109 | 3300026078 | Bacteria | 95381 |
| 410 | Ga0207702_10003095 | 3300026078 | Bacteria | 15424 |
| 411 | Ga0207702_10186276 | 3300026078 | Bacteria | 1914 |
| 412 | Ga0207702_10239730 | 3300026078 | Bacteria | 1698 |
| 413 | Ga0207702_10252317 | 3300026078 | Bacteria | 1657 |
| 414 | Ga0207702_10319703 | 3300026078 | Bacteria | 1478 |
| 415 | Ga0207702_10417969 | 3300026078 | Bacteria | 1296 |
| 416 | Ga0207702_11352080 | 3300026078 | Unclassified | 706 |
| 417 | Ga0207641_10004397 | 3300026088 | Bacteria | 12208 |
| 418 | Ga0207641_10091516 | 3300026088 | Bacteria | 2662 |
| 419 | Ga0207676_10000316 | 3300026095 | Bacteria | 41392 |
| 420 | Ga0207676_10066634 | 3300026095 | Bacteria | 2873 |
| 421 | Ga0207674_10000815 | 3300026116 | Bacteria | 40507 |
| 422 | Ga0207674_10082621 | 3300026116 | Bacteria | 3213 |
| 423 | Ga0207674_10165399 | 3300026116 | Unclassified | 2166 |
| 424 | Ga0207674_10278425 | 3300026116 | Bacteria | 1621 |
| 425 | Ga0207674_10890904 | 3300026116 | Bacteria | 858 |
| 426 | Ga0207683_10042955 | 3300026121 | Bacteria | 3948 |
| 427 | Ga0207698_10000129 | 3300026142 | Bacteria | 47118 |
| 428 | Ga0207698_10000393 | 3300026142 | Bacteria | 25270 |
| 429 | Ga0207698_10023255 | 3300026142 | Bacteria | 4326 |
| 430 | Ga0207698_10023960 | 3300026142 | Bacteria | 4274 |
| 431 | Ga0207698_10063497 | 3300026142 | Bacteria | 2890 |
| 432 | Ga0207698_10189601 | 3300026142 | Unclassified | 1830 |
| 433 | Ga0207698_10258585 | 3300026142 | Bacteria | 1598 |
| 434 | Ga0265354_1005936 | 3300028016 | Bacteria | 1225 |
| 435 | Ga0265355_1001386 | 3300028036 | Unclassified | 1565 |
| 436 | Ga0268266_10015978 | 3300028379 | Bacteria | 6420 |
| 437 | Ga0268266_10179211 | 3300028379 | Bacteria | 1928 |
| 438 | Ga0268265_10087580 | 3300028380 | Unclassified | 2478 |
| 439 | Ga0268265_10443295 | 3300028380 | Bacteria | 1211 |
| 440 | Ga0268264_10000540 | 3300028381 | Bacteria | 47743 |
| 441 | Ga0268264_10038935 | 3300028381 | Bacteria | 3926 |
| 442 | Ga0265334_10183244 | 3300028573 | Unclassified | 731 |
| 443 | Ga0265318_10005203 | 3300028577 | Bacteria | 6140 |
| 444 | Ga0265318_10028158 | 3300028577 | Unclassified | 2200 |
| 445 | Ga0265323_10045661 | 3300028653 | Bacteria | 1573 |
| 446 | Ga0265336_10000499 | 3300028666 | Bacteria | 22942 |
| 447 | Ga0265338_10000529 | 3300028800 | Bacteria | 67074 |
| 448 | Ga0265338_10011218 | 3300028800 | Bacteria | 10384 |
| 449 | Ga0265338_10084444 | 3300028800 | Bacteria | 2651 |
| 450 | Ga0265338_10102619 | 3300028800 | Bacteria | 2325 |
| 451 | Ga0265338_10108441 | 3300028800 | Bacteria | 2243 |
| 452 | Ga0265338_10112450 | 3300028800 | Bacteria | 2190 |
| 453 | Ga0265338_10571319 | 3300028800 | Unclassified | 790 |
| 454 | Ga0265338_10651160 | 3300028800 | Unclassified | 730 |
| 455 | Ga0265324_10048953 | 3300029957 | Bacteria | 1453 |
| 456 | Ga0265762_1010793 | 3300030760 | Unclassified | 1631 |
| 457 | Ga0265762_1042991 | 3300030760 | Unclassified | 889 |
| 458 | Ga0265762_1063727 | 3300030760 | Unclassified | 762 |
| 459 | Ga0265762_1089285 | 3300030760 | Unclassified | 670 |
| 460 | Ga0265766_1016733 | 3300030863 | Unclassified | 577 |
| 461 | Ga0265770_1017206 | 3300030878 | Bacteria | 1115 |
| 462 | Ga0265765_1001407 | 3300030879 | Bacteria | 2195 |
| 463 | Ga0265760_10038134 | 3300031090 | Bacteria | 1428 |
| 464 | Ga0265760_10040134 | 3300031090 | Unclassified | 1394 |
| 465 | Ga0265760_10211718 | 3300031090 | Unclassified | 658 |
| 466 | Ga0265330_10000726 | 3300031235 | Bacteria | 20709 |
| 467 | Ga0265330_10001029 | 3300031235 | Bacteria | 16863 |
| 468 | Ga0265330_10006052 | 3300031235 | Bacteria | 5991 |
| 469 | Ga0265330_10057097 | 3300031235 | Bacteria | 1703 |
| 470 | Ga0265332_10006106 | 3300031238 | Bacteria | 5501 |
| 471 | Ga0265328_10003631 | 3300031239 | Bacteria | 6808 |
| 472 | Ga0265328_10007337 | 3300031239 | Bacteria | 4602 |
| 473 | Ga0265328_10014278 | 3300031239 | Bacteria | 3129 |
| 474 | Ga0265328_10080507 | 3300031239 | Bacteria | 1200 |
| 475 | Ga0265320_10128358 | 3300031240 | Bacteria | 1153 |
| 476 | Ga0265320_10179379 | 3300031240 | Bacteria | 949 |
| 477 | Ga0265325_10000249 | 3300031241 | Bacteria | 38332 |
| 478 | Ga0265325_10000335 | 3300031241 | Bacteria | 33298 |
| 479 | Ga0265325_10019175 | 3300031241 | Bacteria | 3785 |
| 480 | Ga0265325_10139868 | 3300031241 | Bacteria | 1152 |
| 481 | Ga0265325_10244446 | 3300031241 | Bacteria | 814 |
| 482 | Ga0265325_10285418 | 3300031241 | Bacteria | 739 |
| 483 | Ga0265329_10022784 | 3300031242 | Bacteria | 2091 |
| 484 | Ga0265329_10029539 | 3300031242 | Bacteria | 1790 |
| 485 | Ga0265340_10009847 | 3300031247 | Bacteria | 5122 |
| 486 | Ga0265340_10017776 | 3300031247 | Bacteria | 3678 |
| 487 | Ga0265340_10180620 | 3300031247 | Unclassified | 954 |
| 488 | Ga0265339_10000183 | 3300031249 | Bacteria | 53140 |
| 489 | Ga0265339_10003154 | 3300031249 | Bacteria | 11607 |
| 490 | Ga0265339_10003965 | 3300031249 | Bacteria | 10229 |
| 491 | Ga0265339_10004030 | 3300031249 | Bacteria | 10148 |
| 492 | Ga0265339_10020874 | 3300031249 | Unclassified | 3821 |
| 493 | Ga0265339_10030191 | 3300031249 | Bacteria | 3071 |
| 494 | Ga0265339_10093982 | 3300031249 | Bacteria | 1568 |
| 495 | Ga0265339_10251843 | 3300031249 | Bacteria | 854 |
| 496 | Ga0265339_10259699 | 3300031249 | Bacteria | 838 |
| 497 | Ga0265331_10023059 | 3300031250 | Bacteria | 3168 |
| 498 | Ga0265331_10139547 | 3300031250 | Bacteria | 1103 |
| 499 | Ga0265327_10207709 | 3300031251 | Unclassified | 885 |
| 500 | Ga0265316_10001212 | 3300031344 | Bacteria | 27775 |
| 501 | Ga0265316_10001361 | 3300031344 | Bacteria | 26314 |
| 502 | Ga0265316_10007811 | 3300031344 | Bacteria | 10013 |
| 503 | Ga0265316_10011127 | 3300031344 | Bacteria | 8143 |
| 504 | Ga0265316_10012098 | 3300031344 | Bacteria | 7750 |
| 505 | Ga0265316_10035952 | 3300031344 | Bacteria | 4008 |
| 506 | Ga0265316_10043045 | 3300031344 | Bacteria | 3604 |
| 507 | Ga0265316_10062172 | 3300031344 | Bacteria | 2898 |
| 508 | Ga0265316_10090814 | 3300031344 | Bacteria | 2330 |
| 509 | Ga0265316_10117671 | 3300031344 | Bacteria | 2009 |
| 510 | Ga0265316_10129118 | 3300031344 | Bacteria | 1905 |
| 511 | Ga0265316_10225980 | 3300031344 | Bacteria | 1380 |
| 512 | Ga0265316_10288897 | 3300031344 | Bacteria | 1197 |
| 513 | Ga0265316_10425595 | 3300031344 | Bacteria | 954 |
| 514 | Ga0265316_10472772 | 3300031344 | Bacteria | 898 |
| 515 | Ga0265313_10007115 | 3300031595 | Bacteria | 7714 |
| 516 | Ga0265313_10007256 | 3300031595 | Bacteria | 7614 |
| 517 | Ga0265313_10036859 | 3300031595 | Unclassified | 2452 |
| 518 | Ga0265313_10040410 | 3300031595 | Bacteria | 2306 |
| 519 | Ga0265313_10390427 | 3300031595 | Unclassified | 547 |
| 520 | Ga0265314_10000239 | 3300031711 | Bacteria | 80839 |
| 521 | Ga0265314_10005184 | 3300031711 | Bacteria | 11831 |
| 522 | Ga0265314_10031922 | 3300031711 | Bacteria | 3881 |
| 523 | Ga0265314_10077470 | 3300031711 | Bacteria | 2205 |
| 524 | Ga0265314_10195858 | 3300031711 | Bacteria | 1198 |
| 525 | Ga0265314_10229355 | 3300031711 | Bacteria | 1078 |
| 526 | Ga0265314_10259401 | 3300031711 | Bacteria | 993 |
| 527 | Ga0265342_10001693 | 3300031712 | Bacteria | 20222 |
| 528 | Ga0265342_10002138 | 3300031712 | Bacteria | 17433 |
| 529 | Ga0265342_10006731 | 3300031712 | Bacteria | 8516 |
| 530 | Ga0265342_10010813 | 3300031712 | Bacteria | 6288 |
| 531 | Ga0265342_10015765 | 3300031712 | Bacteria | 4962 |
| 532 | Ga0265342_10038168 | 3300031712 | Bacteria | 2926 |
| 533 | Ga0265342_10058747 | 3300031712 | Bacteria | 2273 |
| 534 | Ga0265342_10069506 | 3300031712 | Bacteria | 2056 |
| 535 | Ga0265342_10085101 | 3300031712 | Bacteria | 1820 |
| 536 | Ga0316053_101140 | 3300032120 | Bacteria | 1359 |
| 537 | Ga0316212_1017762 | 3300033547 | Unclassified | 1001 |
| 538 | Ga0373954_0116407 | 3300035118 | Bacteria | 1295 |
| 539 | Ga0373957_0258981 | 3300035120 | Bacteria | 733 |
| 540 | Ga0373955_0028996 | 3300035172 | Bacteria | 2875 |
| 541 | Ga0373955_0864742 | 3300035172 | Unclassified | 556 |
| 542 | Ga0373931_0098718 | 3300035691 | Bacteria | 1639 |
| 543 | Ga0373935_1018702 | 3300035692 | Unclassified | 615 |
| 544 | Ga0373933_0035547 | 3300035724 | Bacteria | 2910 |
| 545 | Ga0373933_0790788 | 3300035724 | Unclassified | 624 |
| 546 | Ga0373937_0043808 | 3300036401 | Bacteria | 4087 |
| 547 | Ga0373937_0134727 | 3300036401 | Bacteria | 2309 |
| 548 | Ga0265778_025231 | 3300036457 | Bacteria | 750 |
| 549 | Ga0373925_0282808 | 3300037068 | Bacteria | 1336 |
| 550 | Ga0395900_0156328 | 3300037418 | Unclassified | 2329 |
| 551 | Ga0395900_0636865 | 3300037418 | Bacteria | 1004 |
| 552 | Ga0395898_0218267 | 3300037466 | Unclassified | 1819 |
| 553 | Ga0395898_1187193 | 3300037466 | Bacteria | 695 |
| 554 | Ga0395901_0759468 | 3300038443 | Bacteria | 962 |
| 555 | Ga0395901_0929381 | 3300038443 | Bacteria | 850 |
| 556 | Ga0436360_0142677 | 3300039438 | Unclassified | 1115 |
| 557 | Ga0436361_0789764 | 3300039447 | Unclassified | 3702 |
| 558 | Ga0436361_1143868 | 3300039447 | Unclassified | 3774 |
| 559 | Ga0436363_1390236 | 3300039450 | Unclassified | 1776 |
| 560 | Ga0451577_0360908 | 3300042876 | Unclassified | 1318 |
| 561 | Ga0466969_0121069 | 3300044656 | Bacteria | 1218 |
| 562 | Ga0453683_0825014 | 3300044673 | Unclassified | 611 |
| 563 | Ga0466961_0044708 | 3300044693 | Bacteria | 2834 |
| 564 | Ga0466963_0187589 | 3300044694 | Bacteria | 1444 |
| 565 | Ga0453684_0151344 | 3300044712 | Bacteria | 2757 |
| 566 | Ga0466971_0135604 | 3300044719 | Bacteria | 1145 |
| 567 | Ga0466959_0238849 | 3300045049 | Bacteria | 1256 |
| 568 | Ga0466958_0274652 | 3300045836 | Bacteria | 1080 |
| 569 | Ga0466958_0378813 | 3300045836 | Bacteria | 912 |
| 570 | Ga0466958_0930567 | 3300045836 | Unclassified | 567 |
| 571 | Ga0466967_0000871 | 3300045976 | Bacteria | 16075 |
| 572 | Ga0466967_0476111 | 3300045976 | Bacteria | 1223 |
| 573 | Ga0466967_0560712 | 3300045976 | Bacteria | 1125 |
| 574 | Ga0495592_0300629 | 3300046454 | Bacteria | 1043 |
| 575 | Ga0495629_0033730 | 3300046459 | Unclassified | 3620 |
| 576 | Ga0495629_0251369 | 3300046459 | Unclassified | 1216 |
| 577 | Ga0495651_0187478 | 3300046462 | Bacteria | 1458 |
| 578 | Ga0495580_0086130 | 3300046472 | Bacteria | 2188 |
| 579 | Ga0495580_0357617 | 3300046472 | Unclassified | 988 |
| 580 | Ga0495664_0016591 | 3300046477 | Bacteria | 4198 |
| 581 | Ga0495664_0099506 | 3300046477 | Unclassified | 1751 |
| 582 | Ga0495606_0152030 | 3300046507 | Bacteria | 1358 |
| 583 | Ga0495643_0008438 | 3300046522 | Bacteria | 6520 |
| 584 | Ga0495652_0017267 | 3300046529 | Bacteria | 6443 |
| 585 | Ga0495665_0094382 | 3300046531 | Bacteria | 1571 |
| 586 | Ga0495665_0148265 | 3300046531 | Unclassified | 1225 |
| 587 | Ga0495587_0091758 | 3300046536 | Bacteria | 1754 |
| 588 | Ga0495587_0160448 | 3300046536 | Unclassified | 1279 |
| 589 | Ga0495587_0205547 | 3300046536 | Bacteria | 1113 |
| 590 | Ga0495645_0000851 | 3300046543 | Bacteria | 20792 |
| 591 | Ga0495645_0004067 | 3300046543 | Bacteria | 9990 |
| 592 | Ga0495645_0259622 | 3300046543 | Bacteria | 1151 |
| 593 | Ga0495667_0407338 | 3300046559 | Unclassified | 856 |
| 594 | Ga0495668_0196331 | 3300046616 | Bacteria | 1105 |
| 595 | Ga0495635_0310197 | 3300046663 | Bacteria | 1057 |
| 596 | Ga0495588_0554716 | 3300046674 | Unclassified | 602 |
| 597 | Ga0495599_0268148 | 3300046678 | Unclassified | 1036 |
| 598 | Ga0495623_0183616 | 3300046679 | Bacteria | 1213 |
| 599 | Ga0495646_0087380 | 3300046680 | Unclassified | 1807 |
| 600 | Ga0495647_0250128 | 3300046681 | Unclassified | 789 |
| 601 | Ga0495658_0143447 | 3300046683 | Bacteria | 1462 |
| 602 | Ga0495669_0074570 | 3300046684 | Unclassified | 1551 |
| 603 | Ga0495613_0120640 | 3300046689 | Bacteria | 1883 |
| 604 | Ga0495613_0170750 | 3300046689 | Unclassified | 1543 |
| 605 | Ga0495649_0209536 | 3300046694 | Bacteria | 1010 |
| 606 | Ga0495600_0013179 | 3300046809 | Bacteria | 5188 |
| 607 | Ga0495600_0035008 | 3300046809 | Unclassified | 3261 |
| 608 | Ga0495600_0518669 | 3300046809 | Unclassified | 731 |
| 609 | Ga0495604_0023379 | 3300047317 | Bacteria | 4931 |
| 610 | Ga0495604_0622195 | 3300047317 | Unclassified | 691 |
| 611 | Ga0495674_1025142 | 3300047319 | Unclassified | 631 |
| 612 | Ga0495680_0611796 | 3300047322 | Unclassified | 728 |
| 613 | Ga0495687_061375 | 3300047443 | Bacteria | 1546 |
| 614 | Ga0495675_0611588 | 3300047444 | Unclassified | 617 |
| 615 | Ga0495679_184635 | 3300047446 | Unclassified | 552 |
| 616 | Ga0495684_0543379 | 3300047471 | Bacteria | 792 |
| 617 | Ga0495602_0153560 | 3300048088 | Unclassified | 1806 |
| 618 | Ga0495602_0153583 | 3300048088 | Bacteria | 1806 |
| 619 | Ga0495602_0160872 | 3300048088 | Bacteria | 1753 |
| 620 | Ga0495602_0298344 | 3300048088 | Unclassified | 1180 |
| 621 | Ga0496100_0006877 | 3300048903 | Bacteria | 6230 |
| 622 | Ga0496100_0201471 | 3300048903 | Bacteria | 1451 |
| 623 | Ga0496100_0623108 | 3300048903 | Unclassified | 839 |
| 624 | Ga0496100_1083413 | 3300048903 | Unclassified | 631 |
| 625 | Ga0496101_0040914 | 3300048904 | Bacteria | 3302 |
| 626 | Ga0496104_0023520 | 3300048907 | Bacteria | 5665 |
| 627 | Ga0496104_0224458 | 3300048907 | Bacteria | 1791 |
| 628 | Ga0496104_0268862 | 3300048907 | Bacteria | 1617 |
| 629 | Ga0496104_1058448 | 3300048907 | Unclassified | 715 |
| 630 | Ga0496105_0033315 | 3300048908 | Bacteria | 4229 |
| 631 | Ga0496105_0313877 | 3300048908 | Bacteria | 1258 |
| 632 | Ga0496105_0328160 | 3300048908 | Bacteria | 1225 |
| 633 | Ga0496106_0686848 | 3300048909 | Unclassified | 816 |
| 634 | Ga0496107_0015330 | 3300048910 | Bacteria | 5370 |
| 635 | Ga0496108_0123375 | 3300048911 | Bacteria | 2223 |
| 636 | Ga0496108_1066578 | 3300048911 | Bacteria | 688 |
| 637 | Ga0496109_0069772 | 3300048912 | Bacteria | 3224 |
| 638 | Ga0496110_0234798 | 3300048913 | Bacteria | 1668 |
| 639 | Ga0496111_0072169 | 3300048914 | Bacteria | 2513 |
| 640 | Ga0496112_0121928 | 3300048915 | Unclassified | 2577 |
| 641 | Ga0496112_0585561 | 3300048915 | Bacteria | 1048 |
| 642 | Ga0496113_0253422 | 3300048916 | Bacteria | 1405 |
| 643 | Ga0496114_0005695 | 3300048917 | Bacteria | 9773 |
| 644 | Ga0496114_0296303 | 3300048917 | Bacteria | 1428 |
| 645 | Ga0496115_0023844 | 3300048918 | Bacteria | 4752 |
| 646 | Ga0496115_0154171 | 3300048918 | Unclassified | 1897 |
| 647 | Ga0496115_0269720 | 3300048918 | Bacteria | 1398 |
| 648 | Ga0496115_0431031 | 3300048918 | Bacteria | 1067 |
| 649 | Ga0496118_0215470 | 3300048921 | Bacteria | 1123 |
| 650 | Ga0496119_0170540 | 3300048922 | Unclassified | 1150 |
| 651 | Ga0496126_0001522 | 3300048929 | Bacteria | 35736 |
| 652 | Ga0496126_0019634 | 3300048929 | Bacteria | 6652 |
| 653 | Ga0496126_0185187 | 3300048929 | Bacteria | 1766 |
| 654 | Ga0495682_0148677 | 3300049460 | Bacteria | 836 |
| 655 | Ga0495601_0253612 | 3300053077 | Unclassified | 1149 |
| 656 | Ga0495619_0089378 | 3300053085 | Unclassified | 2084 |
| 657 | Ga0495619_0352281 | 3300053085 | Unclassified | 1018 |
| 658 | Ga0500644_0030343 | 3300053088 | Bacteria | 1709 |
| 659 | Ga0500595_032198 | 3300053119 | Bacteria | 1752 |
| 660 | Ga0587093_052592 | 3300059478 | Unclassified | 647 |
| 661 | Ga0587085_013311 | 3300059506 | Unclassified | 1143 |
| 662 | Ga0587091_045131 | 3300059511 | Unclassified | 884 |
| 663 | Ga0587092_014861 | 3300059512 | Bacteria | 1133 |
| 664 | Ga0587094_017734 | 3300059513 | Unclassified | 1005 |
| 665 | Ga0587101_019722 | 3300059623 | Unclassified | 958 |
| 666 | Ga0587109_033136 | 3300059624 | Unclassified | 991 |
| 667 | Ga0587117_017967 | 3300059627 | Unclassified | 957 |
| 668 | Ga0587068_024958 | 3300059641 | Unclassified | 1004 |
| 669 | Ga0587114_017560 | 3300059655 | Unclassified | 972 |
| 670 | Ga0466962_0380729 | 3300061719 | Bacteria | 705 |
| 671 | Ga0070660_100135327 | |||
| 672 | rootH2_10042999 | |||
| 673 | rootH2_10066083 | |||
| 674 | rootH2_10066096 | |||
| 675 | rootH1_10393081 | |||
| 676 | Ga0058861_11488209 | |||
| 677 | Ga0058861_11778718 | |||
| 678 | Ga0070658_10005408 | |||
| 679 | Ga0070658_10006481 | |||
| 680 | Ga0070658_10973149 | |||
| 681 | Ga0070676_10013742 | |||
| 682 | Ga0070683_100026956 | |||
| 683 | Ga0070683_100150487 | |||
| 684 | Ga0070683_100581527 | |||
| 685 | Ga0070670_100063184 | |||
| 686 | Ga0068869_100001913 | |||
| 687 | Ga0068869_100191268 | |||
| 688 | Ga0068869_100281621 | |||
| 689 | Ga0070666_10044562 | |||
| 690 | Ga0070666_10062598 | |||
| 691 | Ga0070680_100081136 | |||
| 692 | Ga0070680_100162693 | |||
| 693 | Ga0070680_100437397 | |||
| 694 | Ga0070682_100194644 | |||
| 695 | Ga0068868_100000009 | |||
| 696 | Ga0068868_100015740 | |||
| 697 | Ga0068868_100022926 | |||
| 698 | Ga0070660_100000311 | |||
| 699 | Ga0070660_100067433 | |||
| 700 | Ga0070660_101015614 | |||
| 701 | Ga0070661_100021911 | |||
| 702 | Ga0070661_100165020 | |||
| 703 | Ga0070668_100084709 | |||
| 704 | Ga0070675_100034487 | |||
| 705 | Ga0070671_100154151 | |||
| 706 | Ga0070673_100010611 | |||
| 707 | Ga0070659_100172730 | |||
| 708 | Ga0070659_100181963 | |||
| 709 | Ga0070667_100001882 | |||
| 710 | Ga0070667_100012140 | |||
| 711 | Ga0070714_100017303 | |||
| 712 | Ga0070714_100168901 | |||
| 713 | Ga0070713_100190228 | |||
| 714 | Ga0070713_100225407 | |||
| 715 | Ga0070713_100235136 | |||
| 716 | Ga0070713_100256280 | |||
| 717 | Ga0070713_100650745 | |||
| 718 | Ga0070710_10333662 | |||
| 719 | Ga0070710_11072337 | |||
| 720 | Ga0070711_100046625 | |||
| 721 | Ga0070711_100221272 | |||
| 722 | Ga0070663_100188084 | |||
| 723 | Ga0070663_100329767 | |||
| 724 | Ga0070663_100494166 | |||
| 725 | Ga0070663_100980482 | |||
| 726 | Ga0070663_101564620 | |||
| 727 | Ga0070678_100062022 | |||
| 728 | Ga0070662_100010729 | |||
| 729 | Ga0070681_10000804 | |||
| 730 | Ga0070681_10046056 | |||
| 731 | Ga0070681_10181592 | |||
| 732 | Ga0070681_10373753 | |||
| 733 | Ga0070679_100000226 | |||
| 734 | Ga0070679_100004694 | |||
| 735 | Ga0070679_100044742 | |||
| 736 | Ga0070679_100300525 | |||
| 737 | Ga0070679_100357466 | |||
| 738 | Ga0070684_100025564 | |||
| 739 | Ga0070684_100078675 | |||
| 740 | Ga0070684_100111897 | |||
| 741 | Ga0068853_100000914 | |||
| 742 | Ga0068853_100034028 | |||
| 743 | Ga0068853_100042984 | |||
| 744 | Ga0068853_101287819 | |||
| 745 | Ga0070665_100030820 | |||
| 746 | Ga0070665_100085640 | |||
| 747 | Ga0070665_100169901 | |||
| 748 | Ga0070665_100234765 | |||
| 749 | Ga0070665_100326624 | |||
| 750 | Ga0068855_100003316 | |||
| 751 | Ga0068855_100007673 | |||
| 752 | Ga0068855_100015507 | |||
| 753 | Ga0068855_100021636 | |||
| 754 | Ga0068855_100362979 | |||
| 755 | Ga0068855_100408414 | |||
| 756 | Ga0068855_100663659 | |||
| 757 | Ga0068855_102190800 | |||
| 758 | Ga0070664_100165483 | |||
| 759 | Ga0070664_100171960 | |||
| 760 | Ga0068857_100000181 | |||
| 761 | Ga0068857_100014310 | |||
| 762 | Ga0068857_100054215 | |||
| 763 | Ga0068857_100055906 | |||
| 764 | Ga0068854_100003621 | |||
| 765 | Ga0068854_100030603 | |||
| 766 | Ga0068854_100113951 | |||
| 767 | Ga0068854_101304836 | |||
| 768 | Ga0068856_100012249 | |||
| 769 | Ga0068856_100015932 | |||
| 770 | Ga0068856_100017479 | |||
| 771 | Ga0068856_100028898 | |||
| 772 | Ga0068856_100076409 | |||
| 773 | Ga0068856_100129642 | |||
| 774 | Ga0068856_100241622 | |||
| 775 | Ga0068856_100562375 | |||
| 776 | Ga0068856_100576719 | |||
| 777 | Ga0068856_100750727 | |||
| 778 | Ga0068852_100000199 | |||
| 779 | Ga0068852_100001654 | |||
| 780 | Ga0068852_100027066 | |||
| 781 | Ga0068852_100044386 | |||
| 782 | Ga0068852_100097933 | |||
| 783 | Ga0068852_100150067 | |||
| 784 | Ga0068852_100203299 | |||
| 785 | Ga0068852_100293226 | |||
| 786 | Ga0068859_100002712 | |||
| 787 | Ga0068859_100184430 | |||
| 788 | Ga0068859_100313535 | |||
| 789 | Ga0068864_100003465 | |||
| 790 | Ga0068866_10131164 | |||
| 791 | Ga0068861_100428645 | |||
| 792 | Ga0068851_10012603 | |||
| 793 | Ga0068851_10026100 | |||
| 794 | Ga0068851_10048580 | |||
| 795 | Ga0068863_100000273 | |||
| 796 | Ga0068863_100019580 | |||
| 797 | Ga0068858_100026536 | |||
| 798 | Ga0068858_100058900 | |||
| 799 | Ga0068858_100431672 | |||
| 800 | Ga0068860_100000031 | |||
| 801 | Ga0068862_100112116 | |||
| 802 | Ga0068862_100558009 | |||
| 803 | Ga0081540_1003073 | |||
| 804 | Ga0070717_10000898 | |||
| 805 | Ga0070717_10728862 | |||
| 806 | Ga0070717_11011773 | |||
| 807 | Ga0070715_10243734 | |||
| 808 | Ga0097621_100007467 | |||
| 809 | Ga0097621_101265071 | |||
| 810 | Ga0068871_100002198 | |||
| 811 | Ga0068871_100138203 | |||
| 812 | Ga0068871_100416408 | |||
| 813 | Ga0068871_100487955 | |||
| 814 | Ga0068865_100044913 | |||
| 815 | Ga0097620_100002712 | |||
| 816 | Ga0097620_100184430 | |||
| 817 | Ga0097620_100313551 | |||
| 818 | Ga0105240_10000002 | |||
| 819 | Ga0105240_10001070 | |||
| 820 | Ga0105240_10001619 | |||
| 821 | Ga0105240_10002552 | |||
| 822 | Ga0105240_10002933 | |||
| 823 | Ga0105240_10003422 | |||
| 824 | Ga0105240_10068958 | |||
| 825 | Ga0105240_10092329 | |||
| 826 | Ga0105240_10263729 | |||
| 827 | Ga0105240_10273791 | |||
| 828 | Ga0105240_11690566 | |||
| 829 | Ga0105245_10003181 | |||
| 830 | Ga0105245_10039374 | |||
| 831 | Ga0105245_10273907 | |||
| 832 | Ga0105245_10318564 | |||
| 833 | Ga0105247_10003136 | |||
| 834 | Ga0105247_10028798 | |||
| 835 | Ga0105247_10037922 | |||
| 836 | Ga0105247_10647858 | |||
| 837 | Ga0105241_10000673 | |||
| 838 | Ga0105241_10003894 | |||
| 839 | Ga0105241_10022664 | |||
| 840 | Ga0105241_10098299 | |||
| 841 | Ga0105241_10274294 | |||
| 842 | Ga0105248_10000047 | |||
| 843 | Ga0105248_10001252 | |||
| 844 | Ga0105248_10168927 | |||
| 845 | Ga0105248_10187362 | |||
| 846 | Ga0105248_10706673 | |||
| 847 | Ga0105248_10708469 | |||
| 848 | Ga0105237_10019065 | |||
| 849 | Ga0105237_10048761 | |||
| 850 | Ga0105237_10638549 | |||
| 851 | Ga0105237_10760971 | |||
| 852 | Ga0105238_10011172 | |||
| 853 | Ga0105238_10021179 | |||
| 854 | Ga0105238_10027432 | |||
| 855 | Ga0105238_10038723 | |||
| 856 | Ga0105238_10041018 | |||
| 857 | Ga0105238_10239763 | |||
| 858 | Ga0105238_10508814 | |||
| 859 | Ga0105238_10812997 | |||
| 860 | Ga0105249_10061447 | |||
| 861 | Ga0105249_10340065 | |||
| 862 | Ga0130087_1078875 | |||
| 863 | Ga0130086_1004910 | |||
| 864 | Ga0130084_1075844 | |||
| 865 | Ga0130085_1124052 | |||
| 866 | Ga0105239_10001864 | |||
| 867 | Ga0105239_10075008 | |||
| 868 | Ga0105239_10107380 | |||
| 869 | Ga0105239_10118191 | |||
| 870 | Ga0105239_10163775 | |||
| 871 | Ga0105239_10320208 | |||
| 872 | Ga0105239_10440968 | |||
| 873 | Ga0105239_10752216 | |||
| 874 | Ga0105239_10859899 | |||
| 875 | Ga0105239_10975988 | |||
| 876 | Ga0105246_10001815 | |||
| 877 | Ga0105246_10235672 | |||
| 878 | Ga0157373_10145851 | |||
| 879 | Ga0157373_10193408 | |||
| 880 | Ga0157373_10392121 | |||
| 881 | Ga0157373_10522071 | |||
| 882 | Ga0157371_10076673 | |||
| 883 | Ga0157371_10215085 | |||
| 884 | Ga0157371_10251668 | |||
| 885 | Ga0157370_10000542 | |||
| 886 | Ga0157370_10010623 | |||
| 887 | Ga0157370_10020842 | |||
| 888 | Ga0157370_10116793 | |||
| 889 | Ga0157370_10477416 | |||
| 890 | Ga0157369_10001280 | |||
| 891 | Ga0157369_10002372 | |||
| 892 | Ga0157369_10026543 | |||
| 893 | Ga0157369_10046264 | |||
| 894 | Ga0157369_10048947 | |||
| 895 | Ga0157369_10081995 | |||
| 896 | Ga0157369_10143355 | |||
| 897 | Ga0157369_10163788 | |||
| 898 | Ga0157369_10171211 | |||
| 899 | Ga0157369_10213948 | |||
| 900 | Ga0157369_10355054 | |||
| 901 | Ga0157374_10002229 | |||
| 902 | Ga0157374_10034217 | |||
| 903 | Ga0157374_10042612 | |||
| 904 | Ga0157374_10105065 | |||
| 905 | Ga0157374_10145427 | |||
| 906 | Ga0157374_10539209 | |||
| 907 | Ga0157374_11046605 | |||
| 908 | Ga0157378_10007247 | |||
| 909 | Ga0157378_10013136 | |||
| 910 | Ga0157378_10066515 | |||
| 911 | Ga0157378_10172143 | |||
| 912 | Ga0157378_10647715 | |||
| 913 | Ga0163162_10115828 | |||
| 914 | Ga0163162_10709340 | |||
| 915 | Ga0163162_11165302 | |||
| 916 | Ga0157372_10000408 | |||
| 917 | Ga0157372_10002226 | |||
| 918 | Ga0157372_10003039 | |||
| 919 | Ga0157372_10003426 | |||
| 920 | Ga0157372_10021880 | |||
| 921 | Ga0157372_10100329 | |||
| 922 | Ga0157372_10292889 | |||
| 923 | Ga0157372_10345838 | |||
| 924 | Ga0157372_10386506 | |||
| 925 | Ga0157372_10393699 | |||
| 926 | Ga0157372_10419692 | |||
| 927 | Ga0157372_10485241 | |||
| 928 | Ga0157372_10763684 | |||
| 929 | Ga0157372_10914201 | |||
| 930 | Ga0157375_10006678 | |||
| 931 | Ga0157375_10034594 | |||
| 932 | Ga0157375_10164572 | |||
| 933 | Ga0163163_10000237 | |||
| 934 | Ga0163163_10930455 | |||
| 935 | Ga0163163_11468326 | |||
| 936 | Ga0157380_10137554 | |||
| 937 | Ga0182008_10297901 | |||
| 938 | Ga0157377_10140699 | |||
| 939 | Ga0157379_10015308 | |||
| 940 | Ga0157379_10052254 | |||
| 941 | Ga0157379_10351789 | |||
| 942 | Ga0157376_10000386 | |||
| 943 | Ga0157376_10015969 | |||
| 944 | Ga0157376_10018459 | |||
| 945 | Ga0157376_10047670 | |||
| 946 | Ga0157376_10062577 | |||
| 947 | Ga0157376_10134642 | |||
| 948 | Ga0157376_10545664 | |||
| 949 | Ga0163161_10128650 | |||
| 950 | Ga0206349_1950787 | |||
| 951 | Ga0206351_10231283 | |||
| 952 | Ga0206352_10818192 | |||
| 953 | Ga0206350_10428001 | |||
| 954 | Ga0206350_11401342 | |||
| 955 | Ga0206354_11683905 | |||
| 956 | Ga0206353_10193638 | |||
| 957 | Ga0224570_100061 | |||
| 958 | Ga0224569_101946 | |||
| 959 | Ga0224572_1003039 | |||
| 960 | Ga0224572_1003818 | |||
| 961 | Ga0228598_1004954 | |||
| 962 | Ga0209233_1021243 | |||
| 963 | Ga0207697_10031456 | |||
| 964 | Ga0207656_10003780 | |||
| 965 | Ga0207656_10013842 | |||
| 966 | Ga0207656_10052383 | |||
| 967 | Ga0207692_10103896 | |||
| 968 | Ga0207642_10102103 | |||
| 969 | Ga0207710_10001408 | |||
| 970 | Ga0207688_10342059 | |||
| 971 | Ga0207680_10045351 | |||
| 972 | Ga0207680_10051850 | |||
| 973 | Ga0207680_10072280 | |||
| 974 | Ga0207647_10038062 | |||
| 975 | Ga0207647_10041732 | |||
| 976 | Ga0207647_10306155 | |||
| 977 | Ga0207645_10057989 | |||
| 978 | Ga0207705_10816132 | |||
| 979 | Ga0207654_10000078 | |||
| 980 | Ga0207654_10000095 | |||
| 981 | Ga0207654_10000236 | |||
| 982 | Ga0207654_10021215 | |||
| 983 | Ga0207654_10060307 | |||
| 984 | Ga0207707_10020940 | |||
| 985 | Ga0207707_10143838 | |||
| 986 | Ga0207707_10382273 | |||
| 987 | Ga0207707_10452822 | |||
| 988 | Ga0207695_10000002 | |||
| 989 | Ga0207695_10000075 | |||
| 990 | Ga0207695_10000145 | |||
| 991 | Ga0207695_10000787 | |||
| 992 | Ga0207695_10001098 | |||
| 993 | Ga0207695_10001570 | |||
| 994 | Ga0207695_10005982 | |||
| 995 | Ga0207695_10020928 | |||
| 996 | Ga0207695_10081808 | |||
| 997 | Ga0207695_10120524 | |||
| 998 | Ga0207695_10124594 | |||
| 999 | Ga0207695_10130213 | |||
| 1000 | Ga0207695_10160348 | |||
| 1001 | Ga0207695_10298617 | |||
| 1002 | Ga0207671_10000032 | |||
| 1003 | Ga0207671_10000324 | |||
| 1004 | Ga0207671_10114340 | |||
| 1005 | Ga0207671_11014145 | |||
| 1006 | Ga0207663_10400454 | |||
| 1007 | Ga0207660_10056514 | |||
| 1008 | Ga0207660_10061047 | |||
| 1009 | Ga0207660_10145932 | |||
| 1010 | Ga0207657_10001924 | |||
| 1011 | Ga0207649_10044728 | |||
| 1012 | Ga0207652_10018951 | |||
| 1013 | Ga0207652_10029748 | |||
| 1014 | Ga0207681_10126464 | |||
| 1015 | Ga0207694_10000024 | |||
| 1016 | Ga0207694_10000259 | |||
| 1017 | Ga0207694_10004199 | |||
| 1018 | Ga0207694_10005121 | |||
| 1019 | Ga0207694_10038917 | |||
| 1020 | Ga0207694_10114135 | |||
| 1021 | Ga0207694_10435050 | |||
| 1022 | Ga0207650_10002268 | |||
| 1023 | Ga0207687_10000208 | |||
| 1024 | Ga0207687_10015318 | |||
| 1025 | Ga0207687_10083925 | |||
| 1026 | Ga0207687_10113093 | |||
| 1027 | Ga0207700_10133289 | |||
| 1028 | Ga0207664_10149234 | |||
| 1029 | Ga0207664_10385618 | |||
| 1030 | Ga0207644_10104501 | |||
| 1031 | Ga0207644_10338217 | |||
| 1032 | Ga0207690_10141739 | |||
| 1033 | Ga0207706_10002070 | |||
| 1034 | Ga0207704_10021101 | |||
| 1035 | Ga0207665_10421223 | |||
| 1036 | Ga0207711_10000040 | |||
| 1037 | Ga0207711_10001178 | |||
| 1038 | Ga0207711_10143846 | |||
| 1039 | Ga0207711_10175034 | |||
| 1040 | Ga0207711_10730544 | |||
| 1041 | Ga0207689_10000487 | |||
| 1042 | Ga0207689_10171493 | |||
| 1043 | Ga0207661_10000123 | |||
| 1044 | Ga0207661_10016981 | |||
| 1045 | Ga0207661_10117736 | |||
| 1046 | Ga0207661_10232131 | |||
| 1047 | Ga0207661_10240726 | |||
| 1048 | Ga0207661_10610603 | |||
| 1049 | Ga0207679_10207770 | |||
| 1050 | Ga0207679_10344300 | |||
| 1051 | Ga0207667_10000188 | |||
| 1052 | Ga0207667_10000659 | |||
| 1053 | Ga0207667_10009596 | |||
| 1054 | Ga0207667_10020170 | |||
| 1055 | Ga0207667_10070194 | |||
| 1056 | Ga0207667_10261180 | |||
| 1057 | Ga0207651_10042316 | |||
| 1058 | Ga0207668_10050977 | |||
| 1059 | Ga0207640_10012003 | |||
| 1060 | Ga0207640_10138733 | |||
| 1061 | Ga0207640_11206333 | |||
| 1062 | Ga0207640_11333929 | |||
| 1063 | Ga0207658_10000135 | |||
| 1064 | Ga0207658_10013447 | |||
| 1065 | Ga0207677_10090329 | |||
| 1066 | Ga0207677_10164829 | |||
| 1067 | Ga0207703_10023052 | |||
| 1068 | Ga0207703_10181957 | |||
| 1069 | Ga0207703_10388071 | |||
| 1070 | Ga0207703_10607108 | |||
| 1071 | Ga0207639_10000050 | |||
| 1072 | Ga0207639_10009673 | |||
| 1073 | Ga0207639_10059914 | |||
| 1074 | Ga0207639_11244107 | |||
| 1075 | Ga0207678_10051293 | |||
| 1076 | Ga0207678_10313195 | |||
| 1077 | Ga0207678_10462456 | |||
| 1078 | Ga0207678_10820234 | |||
| 1079 | Ga0207702_10000109 | |||
| 1080 | Ga0207702_10003095 | |||
| 1081 | Ga0207702_10186276 | |||
| 1082 | Ga0207702_10239730 | |||
| 1083 | Ga0207702_10252317 | |||
| 1084 | Ga0207702_10319703 | |||
| 1085 | Ga0207702_10417969 | |||
| 1086 | Ga0207702_11352080 | |||
| 1087 | Ga0207641_10004397 | |||
| 1088 | Ga0207641_10091516 | |||
| 1089 | Ga0207676_10000316 | |||
| 1090 | Ga0207676_10066634 | |||
| 1091 | Ga0207674_10000815 | |||
| 1092 | Ga0207674_10082621 | |||
| 1093 | Ga0207674_10165399 | |||
| 1094 | Ga0207674_10278425 | |||
| 1095 | Ga0207674_10890904 | |||
| 1096 | Ga0207683_10042955 | |||
| 1097 | Ga0207698_10000129 | |||
| 1098 | Ga0207698_10000393 | |||
| 1099 | Ga0207698_10023255 | |||
| 1100 | Ga0207698_10023960 | |||
| 1101 | Ga0207698_10063497 | |||
| 1102 | Ga0207698_10189601 | |||
| 1103 | Ga0207698_10258585 | |||
| 1104 | Ga0265354_1005936 | |||
| 1105 | Ga0265355_1001386 | |||
| 1106 | Ga0268266_10015978 | |||
| 1107 | Ga0268266_10179211 | |||
| 1108 | Ga0268265_10087580 | |||
| 1109 | Ga0268265_10443295 | |||
| 1110 | Ga0268264_10000540 | |||
| 1111 | Ga0268264_10038935 | |||
| 1112 | Ga0265334_10183244 | |||
| 1113 | Ga0265318_10005203 | |||
| 1114 | Ga0265318_10028158 | |||
| 1115 | Ga0265323_10045661 | |||
| 1116 | Ga0265336_10000499 | |||
| 1117 | Ga0265338_10000529 | |||
| 1118 | Ga0265338_10011218 | |||
| 1119 | Ga0265338_10084444 | |||
| 1120 | Ga0265338_10102619 | |||
| 1121 | Ga0265338_10108441 | |||
| 1122 | Ga0265338_10112450 | |||
| 1123 | Ga0265338_10571319 | |||
| 1124 | Ga0265338_10651160 | |||
| 1125 | Ga0265324_10048953 | |||
| 1126 | Ga0265762_1010793 | |||
| 1127 | Ga0265762_1042991 | |||
| 1128 | Ga0265762_1063727 | |||
| 1129 | Ga0265762_1089285 | |||
| 1130 | Ga0265766_1016733 | |||
| 1131 | Ga0265770_1017206 | |||
| 1132 | Ga0265765_1001407 | |||
| 1133 | Ga0265760_10038134 | |||
| 1134 | Ga0265760_10040134 | |||
| 1135 | Ga0265760_10211718 | |||
| 1136 | Ga0265330_10000726 | |||
| 1137 | Ga0265330_10001029 | |||
| 1138 | Ga0265330_10006052 | |||
| 1139 | Ga0265330_10057097 | |||
| 1140 | Ga0265332_10006106 | |||
| 1141 | Ga0265328_10003631 | |||
| 1142 | Ga0265328_10007337 | |||
| 1143 | Ga0265328_10014278 | |||
| 1144 | Ga0265328_10080507 | |||
| 1145 | Ga0265320_10128358 | |||
| 1146 | Ga0265320_10179379 | |||
| 1147 | Ga0265325_10000249 | |||
| 1148 | Ga0265325_10000335 | |||
| 1149 | Ga0265325_10019175 | |||
| 1150 | Ga0265325_10139868 | |||
| 1151 | Ga0265325_10244446 | |||
| 1152 | Ga0265325_10285418 | |||
| 1153 | Ga0265329_10022784 | |||
| 1154 | Ga0265329_10029539 | |||
| 1155 | Ga0265340_10009847 | |||
| 1156 | Ga0265340_10017776 | |||
| 1157 | Ga0265340_10180620 | |||
| 1158 | Ga0265339_10000183 | |||
| 1159 | Ga0265339_10003154 | |||
| 1160 | Ga0265339_10003965 | |||
| 1161 | Ga0265339_10004030 | |||
| 1162 | Ga0265339_10020874 | |||
| 1163 | Ga0265339_10030191 | |||
| 1164 | Ga0265339_10093982 | |||
| 1165 | Ga0265339_10251843 | |||
| 1166 | Ga0265339_10259699 | |||
| 1167 | Ga0265331_10023059 | |||
| 1168 | Ga0265331_10139547 | |||
| 1169 | Ga0265327_10207709 | |||
| 1170 | Ga0265316_10001212 | |||
| 1171 | Ga0265316_10001361 | |||
| 1172 | Ga0265316_10007811 | |||
| 1173 | Ga0265316_10011127 | |||
| 1174 | Ga0265316_10012098 | |||
| 1175 | Ga0265316_10035952 | |||
| 1176 | Ga0265316_10043045 | |||
| 1177 | Ga0265316_10062172 | |||
| 1178 | Ga0265316_10090814 | |||
| 1179 | Ga0265316_10117671 | |||
| 1180 | Ga0265316_10129118 | |||
| 1181 | Ga0265316_10225980 | |||
| 1182 | Ga0265316_10288897 | |||
| 1183 | Ga0265316_10425595 | |||
| 1184 | Ga0265316_10472772 | |||
| 1185 | Ga0265313_10007115 | |||
| 1186 | Ga0265313_10007256 | |||
| 1187 | Ga0265313_10036859 | |||
| 1188 | Ga0265313_10040410 | |||
| 1189 | Ga0265313_10390427 | |||
| 1190 | Ga0265314_10000239 | |||
| 1191 | Ga0265314_10005184 | |||
| 1192 | Ga0265314_10031922 | |||
| 1193 | Ga0265314_10077470 | |||
| 1194 | Ga0265314_10195858 | |||
| 1195 | Ga0265314_10229355 | |||
| 1196 | Ga0265314_10259401 | |||
| 1197 | Ga0265342_10001693 | |||
| 1198 | Ga0265342_10002138 | |||
| 1199 | Ga0265342_10006731 | |||
| 1200 | Ga0265342_10010813 | |||
| 1201 | Ga0265342_10015765 | |||
| 1202 | Ga0265342_10038168 | |||
| 1203 | Ga0265342_10058747 | |||
| 1204 | Ga0265342_10069506 | |||
| 1205 | Ga0265342_10085101 | |||
| 1206 | Ga0316053_101140 | |||
| 1207 | Ga0316212_1017762 | |||
| 1208 | Ga0373954_0116407 | |||
| 1209 | Ga0373957_0258981 | |||
| 1210 | Ga0373955_0028996 | |||
| 1211 | Ga0373955_0864742 | |||
| 1212 | Ga0373931_0098718 | |||
| 1213 | Ga0373935_1018702 | |||
| 1214 | Ga0373933_0035547 | |||
| 1215 | Ga0373933_0790788 | |||
| 1216 | Ga0373937_0043808 | |||
| 1217 | Ga0373937_0134727 | |||
| 1218 | Ga0265778_025231 | |||
| 1219 | Ga0373925_0282808 | |||
| 1220 | Ga0395900_0156328 | |||
| 1221 | Ga0395900_0636865 | |||
| 1222 | Ga0395898_0218267 | |||
| 1223 | Ga0395898_1187193 | |||
| 1224 | Ga0395901_0759468 | |||
| 1225 | Ga0395901_0929381 | |||
| 1226 | Ga0436360_0142677 | |||
| 1227 | Ga0436361_0789764 | |||
| 1228 | Ga0436361_1143868 | |||
| 1229 | Ga0436363_1390236 | |||
| 1230 | Ga0451577_0360908 | |||
| 1231 | Ga0466969_0121069 | |||
| 1232 | Ga0453683_0825014 | |||
| 1233 | Ga0466961_0044708 | |||
| 1234 | Ga0466963_0187589 | |||
| 1235 | Ga0453684_0151344 | |||
| 1236 | Ga0466971_0135604 | |||
| 1237 | Ga0466959_0238849 | |||
| 1238 | Ga0466958_0274652 | |||
| 1239 | Ga0466958_0378813 | |||
| 1240 | Ga0466958_0930567 | |||
| 1241 | Ga0466967_0000871 | |||
| 1242 | Ga0466967_0476111 | |||
| 1243 | Ga0466967_0560712 | |||
| 1244 | Ga0495592_0300629 | |||
| 1245 | Ga0495629_0033730 | |||
| 1246 | Ga0495629_0251369 | |||
| 1247 | Ga0495651_0187478 | |||
| 1248 | Ga0495580_0086130 | |||
| 1249 | Ga0495580_0357617 | |||
| 1250 | Ga0495664_0016591 | |||
| 1251 | Ga0495664_0099506 | |||
| 1252 | Ga0495606_0152030 | |||
| 1253 | Ga0495643_0008438 | |||
| 1254 | Ga0495652_0017267 | |||
| 1255 | Ga0495665_0094382 | |||
| 1256 | Ga0495665_0148265 | |||
| 1257 | Ga0495587_0091758 | |||
| 1258 | Ga0495587_0160448 | |||
| 1259 | Ga0495587_0205547 | |||
| 1260 | Ga0495645_0000851 | |||
| 1261 | Ga0495645_0004067 | |||
| 1262 | Ga0495645_0259622 | |||
| 1263 | Ga0495667_0407338 | |||
| 1264 | Ga0495668_0196331 | |||
| 1265 | Ga0495635_0310197 | |||
| 1266 | Ga0495588_0554716 | |||
| 1267 | Ga0495599_0268148 | |||
| 1268 | Ga0495623_0183616 | |||
| 1269 | Ga0495646_0087380 | |||
| 1270 | Ga0495647_0250128 | |||
| 1271 | Ga0495658_0143447 | |||
| 1272 | Ga0495669_0074570 | |||
| 1273 | Ga0495613_0120640 | |||
| 1274 | Ga0495613_0170750 | |||
| 1275 | Ga0495649_0209536 | |||
| 1276 | Ga0495600_0013179 | |||
| 1277 | Ga0495600_0035008 | |||
| 1278 | Ga0495600_0518669 | |||
| 1279 | Ga0495604_0023379 | |||
| 1280 | Ga0495604_0622195 | |||
| 1281 | Ga0495674_1025142 | |||
| 1282 | Ga0495680_0611796 | |||
| 1283 | Ga0495687_061375 | |||
| 1284 | Ga0495675_0611588 | |||
| 1285 | Ga0495679_184635 | |||
| 1286 | Ga0495684_0543379 | |||
| 1287 | Ga0495602_0153560 | |||
| 1288 | Ga0495602_0153583 | |||
| 1289 | Ga0495602_0160872 | |||
| 1290 | Ga0495602_0298344 | |||
| 1291 | Ga0496100_0006877 | |||
| 1292 | Ga0496100_0201471 | |||
| 1293 | Ga0496100_0623108 | |||
| 1294 | Ga0496100_1083413 | |||
| 1295 | Ga0496101_0040914 | |||
| 1296 | Ga0496104_0023520 | |||
| 1297 | Ga0496104_0224458 | |||
| 1298 | Ga0496104_0268862 | |||
| 1299 | Ga0496104_1058448 | |||
| 1300 | Ga0496105_0033315 | |||
| 1301 | Ga0496105_0313877 | |||
| 1302 | Ga0496105_0328160 | |||
| 1303 | Ga0496106_0686848 | |||
| 1304 | Ga0496107_0015330 | |||
| 1305 | Ga0496108_0123375 | |||
| 1306 | Ga0496108_1066578 | |||
| 1307 | Ga0496109_0069772 | |||
| 1308 | Ga0496110_0234798 | |||
| 1309 | Ga0496111_0072169 | |||
| 1310 | Ga0496112_0121928 | |||
| 1311 | Ga0496112_0585561 | |||
| 1312 | Ga0496113_0253422 | |||
| 1313 | Ga0496114_0005695 | |||
| 1314 | Ga0496114_0296303 | |||
| 1315 | Ga0496115_0023844 | |||
| 1316 | Ga0496115_0154171 | |||
| 1317 | Ga0496115_0269720 | |||
| 1318 | Ga0496115_0431031 | |||
| 1319 | Ga0496118_0215470 | |||
| 1320 | Ga0496119_0170540 | |||
| 1321 | Ga0496126_0001522 | |||
| 1322 | Ga0496126_0019634 | |||
| 1323 | Ga0496126_0185187 | |||
| 1324 | Ga0495682_0148677 | |||
| 1325 | Ga0495601_0253612 | |||
| 1326 | Ga0495619_0089378 | |||
| 1327 | Ga0495619_0352281 | |||
| 1328 | Ga0500644_0030343 | |||
| 1329 | Ga0500595_032198 | |||
| 1330 | Ga0587093_052592 | |||
| 1331 | Ga0587085_013311 | |||
| 1332 | Ga0587091_045131 | |||
| 1333 | Ga0587092_014861 | |||
| 1334 | Ga0587094_017734 | |||
| 1335 | Ga0587101_019722 | |||
| 1336 | Ga0587109_033136 | |||
| 1337 | Ga0587117_017967 | |||
| 1338 | Ga0587068_024958 | |||
| 1339 | Ga0587114_017560 | |||
| 1340 | Ga0466962_0380729 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6m36-assembly1.cif.gz_E | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9437 | 11 | 148 |
| 6m36-assembly1.cif.gz_E | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9346 | 11 | 148 |
| 6m36-assembly2.cif.gz_K | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9279 | 11 | 148 |
| 6m36-assembly2.cif.gz_K | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9193 | 11 | 148 |
| 6m36-assembly1.cif.gz_G | the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form | 0.9174 | 11 | 148 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WLZ7_398_539_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.8284 | 11 | 152 | 3.30.565.10 |
| af_P9WGX7_40_164_3.90.1100.10 | Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; | 0.8048 | 13 | 146 | 3.90.1100.10 |
| af_K7LNG1_19_256_2.70.98.10 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.804 | 70 | 93 | 2.70.98.10 |
| 3ke6B02 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.8015 | 11 | 152 | 3.30.565.10 |
| af_P71568_133_255_3.30.565.10 | Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain | 0.8009 | 11 | 146 | 3.30.565.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-W0Z7V5-F1-model_v4 | Protein serine phosphatase with GAF(S) sensor(S) | 0.9325 | 12 | 148 |
GO:0016791
|
| AF-A0A3A0BSI1-F1-model_v4 | Histidine kinase/HSP90-like ATPase domain-containing protein | 0.9006 | 11 | 148 |
|
| AF-A0A2G9SML9-F1-model_v4 | ATPase | 0.9002 | 10 | 146 |
GO:0004674
|
| AF-A0A2N0VH87-F1-model_v4 | ATP-binding protein | 0.8995 | 9 | 147 |
GO:0004674
GO:0005524 |
| AF-A0A7C4IWZ6-F1-model_v4 | ATP-binding protein | 0.8994 | 12 | 148 |
GO:0004674
GO:0005524 |