F474064

General Info

Members Datasets Scaffolds Average Seq Length
670 266 1340 149

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100135327|Ga0070660_1001353273
Length 169
Sequence MSKVKSTSVEVRLPSQLGYEKVAMSTAAAVAKLMGFREDRVEDLKTAVAEACINAIEHGNMLNESLSVGVVLSAGADALEVKVIDDGKGLKAVPPKPDIDRKIHGEEDPRGMGMFLIQALVDEAEWVKGSNGKSSYVRLVIRLDAVAASQREDGETRSCRAKPKRASTS

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
64 3300009829 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D Metatranscriptome Rhizosphere
65 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
66 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
92 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
93 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
146 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
151 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
152 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
153 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
156 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
177 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
198 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
199 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
200 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
218 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
219 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.78
Metatranscriptomes 5.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.45
Nodule 0
Rhizoplane 4.18
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 23.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100135327 3300005339 Bacteria 1974
2 rootH2_10042999 3300003320 Unclassified 1640
3 rootH2_10066083 3300003320 Bacteria 4909
4 rootH2_10066096 3300003320 Bacteria 1898
5 rootH1_10393081 3300003323 Bacteria 1236
6 Ga0058861_11488209 3300004800 Bacteria 678
7 Ga0058861_11778718 3300004800 Unclassified 815
8 Ga0070658_10005408 3300005327 Bacteria 10361
9 Ga0070658_10006481 3300005327 Bacteria 9484
10 Ga0070658_10973149 3300005327 Unclassified 738
11 Ga0070676_10013742 3300005328 Bacteria 4438
12 Ga0070683_100026956 3300005329 Bacteria 5179
13 Ga0070683_100150487 3300005329 Unclassified 2206
14 Ga0070683_100581527 3300005329 Bacteria 1071
15 Ga0070670_100063184 3300005331 Bacteria 3178
16 Ga0068869_100001913 3300005334 Bacteria 12502
17 Ga0068869_100191268 3300005334 Unclassified 1609
18 Ga0068869_100281621 3300005334 Bacteria 1337
19 Ga0070666_10044562 3300005335 Bacteria 2972
20 Ga0070666_10062598 3300005335 Unclassified 2521
21 Ga0070680_100081136 3300005336 Bacteria 2676
22 Ga0070680_100162693 3300005336 Bacteria 1876
23 Ga0070680_100437397 3300005336 Unclassified 1117
24 Ga0070682_100194644 3300005337 Bacteria 1426
25 Ga0068868_100000009 3300005338 Bacteria 120604
26 Ga0068868_100015740 3300005338 Bacteria 5601
27 Ga0068868_100022926 3300005338 Bacteria 4720
28 Ga0070660_100000311 3300005339 Bacteria 32366
29 Ga0070660_100067433 3300005339 Bacteria 2788
30 Ga0070660_101015614 3300005339 Bacteria 701
31 Ga0070661_100021911 3300005344 Bacteria 4570
32 Ga0070661_100165020 3300005344 Bacteria 1679
33 Ga0070668_100084709 3300005347 Bacteria 2490
34 Ga0070675_100034487 3300005354 Bacteria 4108
35 Ga0070671_100154151 3300005355 Bacteria 1941
36 Ga0070673_100010611 3300005364 Bacteria 6243
37 Ga0070659_100172730 3300005366 Bacteria 1771
38 Ga0070659_100181963 3300005366 Bacteria 1725
39 Ga0070667_100001882 3300005367 Bacteria 18639
40 Ga0070667_100012140 3300005367 Bacteria 7130
41 Ga0070714_100017303 3300005435 Bacteria 5838
42 Ga0070714_100168901 3300005435 Bacteria 1984
43 Ga0070713_100190228 3300005436 Bacteria 1849
44 Ga0070713_100225407 3300005436 Unclassified 1702
45 Ga0070713_100235136 3300005436 Bacteria 1667
46 Ga0070713_100256280 3300005436 Unclassified 1598
47 Ga0070713_100650745 3300005436 Bacteria 1004
48 Ga0070710_10333662 3300005437 Bacteria 999
49 Ga0070710_11072337 3300005437 Unclassified 590
50 Ga0070711_100046625 3300005439 Bacteria 2954
51 Ga0070711_100221272 3300005439 Unclassified 1472
52 Ga0070663_100188084 3300005455 Bacteria 1606
53 Ga0070663_100329767 3300005455 Unclassified 1230
54 Ga0070663_100494166 3300005455 Bacteria 1015
55 Ga0070663_100980482 3300005455 Unclassified 734
56 Ga0070663_101564620 3300005455 Unclassified 587
57 Ga0070678_100062022 3300005456 Bacteria 2758
58 Ga0070662_100010729 3300005457 Bacteria 6032
59 Ga0070681_10000804 3300005458 Bacteria 26179
60 Ga0070681_10046056 3300005458 Unclassified 4361
61 Ga0070681_10181592 3300005458 Bacteria 2025
62 Ga0070681_10373753 3300005458 Bacteria 1336
63 Ga0070679_100000226 3300005530 Bacteria 46282
64 Ga0070679_100004694 3300005530 Bacteria 12603
65 Ga0070679_100044742 3300005530 Unclassified 4410
66 Ga0070679_100300525 3300005530 Bacteria 1556
67 Ga0070679_100357466 3300005530 Unclassified 1408
68 Ga0070684_100025564 3300005535 Bacteria 4965
69 Ga0070684_100078675 3300005535 Unclassified 2914
70 Ga0070684_100111897 3300005535 Bacteria 2449
71 Ga0068853_100000914 3300005539 Bacteria 20625
72 Ga0068853_100034028 3300005539 Bacteria 4324
73 Ga0068853_100042984 3300005539 Bacteria 3865
74 Ga0068853_101287819 3300005539 Unclassified 706
75 Ga0070665_100030820 3300005548 Bacteria 5398
76 Ga0070665_100085640 3300005548 Bacteria 3157
77 Ga0070665_100169901 3300005548 Bacteria 2182
78 Ga0070665_100234765 3300005548 Bacteria 1834
79 Ga0070665_100326624 3300005548 Bacteria 1538
80 Ga0068855_100003316 3300005563 Bacteria 19696
81 Ga0068855_100007673 3300005563 Bacteria 13036
82 Ga0068855_100015507 3300005563 Bacteria 9174
83 Ga0068855_100021636 3300005563 Bacteria 7714
84 Ga0068855_100362979 3300005563 Bacteria 1593
85 Ga0068855_100408414 3300005563 Bacteria 1487
86 Ga0068855_100663659 3300005563 Bacteria 1119
87 Ga0068855_102190800 3300005563 Unclassified 555
88 Ga0070664_100165483 3300005564 Unclassified 1959
89 Ga0070664_100171960 3300005564 Unclassified 1922
90 Ga0068857_100000181 3300005577 Bacteria 40250
91 Ga0068857_100014310 3300005577 Bacteria 6914
92 Ga0068857_100054215 3300005577 Unclassified 3557
93 Ga0068857_100055906 3300005577 Bacteria 3502
94 Ga0068854_100003621 3300005578 Bacteria 9666
95 Ga0068854_100030603 3300005578 Unclassified 3734
96 Ga0068854_100113951 3300005578 Bacteria 2043
97 Ga0068854_101304836 3300005578 Bacteria 653
98 Ga0068856_100012249 3300005614 Bacteria 8305
99 Ga0068856_100015932 3300005614 Bacteria 7268
100 Ga0068856_100017479 3300005614 Bacteria 6949
101 Ga0068856_100028898 3300005614 Bacteria 5417
102 Ga0068856_100076409 3300005614 Unclassified 3318
103 Ga0068856_100129642 3300005614 Bacteria 2526
104 Ga0068856_100241622 3300005614 Bacteria 1821
105 Ga0068856_100562375 3300005614 Bacteria 1162
106 Ga0068856_100576719 3300005614 Bacteria 1146
107 Ga0068856_100750727 3300005614 Bacteria 996
108 Ga0068852_100000199 3300005616 Bacteria 40929
109 Ga0068852_100001654 3300005616 Bacteria 15203
110 Ga0068852_100027066 3300005616 Bacteria 4668
111 Ga0068852_100044386 3300005616 Bacteria 3775
112 Ga0068852_100097933 3300005616 Bacteria 2640
113 Ga0068852_100150067 3300005616 Bacteria 2167
114 Ga0068852_100203299 3300005616 Unclassified 1875
115 Ga0068852_100293226 3300005616 Unclassified 1572
116 Ga0068859_100002712 3300005617 Bacteria 17961
117 Ga0068859_100184430 3300005617 Bacteria 2170
118 Ga0068859_100313535 3300005617 Bacteria 1662
119 Ga0068864_100003465 3300005618 Bacteria 13030
120 Ga0068866_10131164 3300005718 Bacteria 1426
121 Ga0068861_100428645 3300005719 Bacteria 1180
122 Ga0068851_10012603 3300005834 Bacteria 3989
123 Ga0068851_10026100 3300005834 Bacteria 2869
124 Ga0068851_10048580 3300005834 Unclassified 2150
125 Ga0068863_100000273 3300005841 Bacteria 53827
126 Ga0068863_100019580 3300005841 Bacteria 6472
127 Ga0068858_100026536 3300005842 Bacteria 5381
128 Ga0068858_100058900 3300005842 Unclassified 3551
129 Ga0068858_100431672 3300005842 Unclassified 1268
130 Ga0068860_100000031 3300005843 Bacteria 255068
131 Ga0068862_100112116 3300005844 Unclassified 2395
132 Ga0068862_100558009 3300005844 Bacteria 1094
133 Ga0081540_1003073 3300005983 Bacteria 13374
134 Ga0070717_10000898 3300006028 Bacteria 19756
135 Ga0070717_10728862 3300006028 Bacteria 901
136 Ga0070717_11011773 3300006028 Bacteria 757
137 Ga0070715_10243734 3300006163 Unclassified 936
138 Ga0097621_100007467 3300006237 Bacteria 7820
139 Ga0097621_101265071 3300006237 Unclassified 696
140 Ga0068871_100002198 3300006358 Bacteria 13257
141 Ga0068871_100138203 3300006358 Bacteria 2070
142 Ga0068871_100416408 3300006358 Bacteria 1199
143 Ga0068871_100487955 3300006358 Unclassified 1109
144 Ga0068865_100044913 3300006881 Bacteria 3026
145 Ga0097620_100002712 3300006931 Bacteria 17961
146 Ga0097620_100184430 3300006931 Bacteria 2170
147 Ga0097620_100313551 3300006931 Bacteria 1662
148 Ga0105240_10000002 3300009093 Bacteria 1924170
149 Ga0105240_10001070 3300009093 Bacteria 48381
150 Ga0105240_10001619 3300009093 Bacteria 38195
151 Ga0105240_10002552 3300009093 Bacteria 29190
152 Ga0105240_10002933 3300009093 Bacteria 26905
153 Ga0105240_10003422 3300009093 Bacteria 24653
154 Ga0105240_10068958 3300009093 Bacteria 4379
155 Ga0105240_10092329 3300009093 Bacteria 3697
156 Ga0105240_10263729 3300009093 Unclassified 1986
157 Ga0105240_10273791 3300009093 Bacteria 1942
158 Ga0105240_11690566 3300009093 Bacteria 661
159 Ga0105245_10003181 3300009098 Bacteria 14677
160 Ga0105245_10039374 3300009098 Bacteria 4207
161 Ga0105245_10273907 3300009098 Unclassified 1647
162 Ga0105245_10318564 3300009098 Bacteria 1531
163 Ga0105247_10003136 3300009101 Bacteria 10892
164 Ga0105247_10028798 3300009101 Unclassified 3361
165 Ga0105247_10037922 3300009101 Bacteria 2940
166 Ga0105247_10647858 3300009101 Unclassified 789
167 Ga0105241_10000673 3300009174 Bacteria 25723
168 Ga0105241_10003894 3300009174 Bacteria 11057
169 Ga0105241_10022664 3300009174 Bacteria 4653
170 Ga0105241_10098299 3300009174 Bacteria 2322
171 Ga0105241_10274294 3300009174 Bacteria 1438
172 Ga0105248_10000047 3300009177 Bacteria 163513
173 Ga0105248_10001252 3300009177 Bacteria 28377
174 Ga0105248_10168927 3300009177 Bacteria 2465
175 Ga0105248_10187362 3300009177 Unclassified 2332
176 Ga0105248_10706673 3300009177 Unclassified 1137
177 Ga0105248_10708469 3300009177 Bacteria 1136
178 Ga0105237_10019065 3300009545 Bacteria 7091
179 Ga0105237_10048761 3300009545 Bacteria 4257
180 Ga0105237_10638549 3300009545 Bacteria 1071
181 Ga0105237_10760971 3300009545 Unclassified 975
182 Ga0105238_10011172 3300009551 Bacteria 9033
183 Ga0105238_10021179 3300009551 Bacteria 6626
184 Ga0105238_10027432 3300009551 Bacteria 5803
185 Ga0105238_10038723 3300009551 Bacteria 4841
186 Ga0105238_10041018 3300009551 Bacteria 4689
187 Ga0105238_10239763 3300009551 Bacteria 1791
188 Ga0105238_10508814 3300009551 Unclassified 1206
189 Ga0105238_10812997 3300009551 Unclassified 951
190 Ga0105249_10061447 3300009553 Unclassified 3447
191 Ga0105249_10340065 3300009553 Bacteria 1517
192 Ga0130087_1078875 3300009828 Bacteria 568
193 Ga0130086_1004910 3300009829 Bacteria 568
194 Ga0130084_1075844 3300009835 Bacteria 568
195 Ga0130085_1124052 3300009850 Bacteria 568
196 Ga0105239_10001864 3300010375 Bacteria 27591
197 Ga0105239_10075008 3300010375 Bacteria 3719
198 Ga0105239_10107380 3300010375 Bacteria 3093
199 Ga0105239_10118191 3300010375 Unclassified 2942
200 Ga0105239_10163775 3300010375 Bacteria 2486
201 Ga0105239_10320208 3300010375 Bacteria 1748
202 Ga0105239_10440968 3300010375 Bacteria 1476
203 Ga0105239_10752216 3300010375 Bacteria 1116
204 Ga0105239_10859899 3300010375 Unclassified 1040
205 Ga0105239_10975988 3300010375 Bacteria 974
206 Ga0105246_10001815 3300011119 Bacteria 12795
207 Ga0105246_10235672 3300011119 Bacteria 1444
208 Ga0157373_10145851 3300013100 Bacteria 1665
209 Ga0157373_10193408 3300013100 Bacteria 1433
210 Ga0157373_10392121 3300013100 Bacteria 994
211 Ga0157373_10522071 3300013100 Unclassified 859
212 Ga0157371_10076673 3300013102 Bacteria 2367
213 Ga0157371_10215085 3300013102 Bacteria 1380
214 Ga0157371_10251668 3300013102 Unclassified 1272
215 Ga0157370_10000542 3300013104 Bacteria 47157
216 Ga0157370_10010623 3300013104 Bacteria 9691
217 Ga0157370_10020842 3300013104 Bacteria 6541
218 Ga0157370_10116793 3300013104 Bacteria 2492
219 Ga0157370_10477416 3300013104 Bacteria 1146
220 Ga0157369_10001280 3300013105 Bacteria 31263
221 Ga0157369_10002372 3300013105 Bacteria 22630
222 Ga0157369_10026543 3300013105 Bacteria 6424
223 Ga0157369_10046264 3300013105 Bacteria 4729
224 Ga0157369_10048947 3300013105 Bacteria 4584
225 Ga0157369_10081995 3300013105 Bacteria 3451
226 Ga0157369_10143355 3300013105 Bacteria 2527
227 Ga0157369_10163788 3300013105 Bacteria 2346
228 Ga0157369_10171211 3300013105 Bacteria 2288
229 Ga0157369_10213948 3300013105 Bacteria 2020
230 Ga0157369_10355054 3300013105 Bacteria 1522
231 Ga0157374_10002229 3300013296 Bacteria 16328
232 Ga0157374_10034217 3300013296 Bacteria 4639
233 Ga0157374_10042612 3300013296 Unclassified 4187
234 Ga0157374_10105065 3300013296 Bacteria 2712
235 Ga0157374_10145427 3300013296 Bacteria 2302
236 Ga0157374_10539209 3300013296 Bacteria 1174
237 Ga0157374_11046605 3300013296 Unclassified 836
238 Ga0157378_10007247 3300013297 Bacteria 9682
239 Ga0157378_10013136 3300013297 Bacteria 7247
240 Ga0157378_10066515 3300013297 Bacteria 3228
241 Ga0157378_10172143 3300013297 Unclassified 2031
242 Ga0157378_10647715 3300013297 Bacteria 1072
243 Ga0163162_10115828 3300013306 Bacteria 2780
244 Ga0163162_10709340 3300013306 Unclassified 1127
245 Ga0163162_11165302 3300013306 Unclassified 874
246 Ga0157372_10000408 3300013307 Bacteria 47157
247 Ga0157372_10002226 3300013307 Bacteria 21043
248 Ga0157372_10003039 3300013307 Bacteria 18084
249 Ga0157372_10003426 3300013307 Bacteria 17114
250 Ga0157372_10021880 3300013307 Bacteria 6912
251 Ga0157372_10100329 3300013307 Bacteria 3304
252 Ga0157372_10292889 3300013307 Bacteria 1893
253 Ga0157372_10345838 3300013307 Unclassified 1733
254 Ga0157372_10386506 3300013307 Bacteria 1630
255 Ga0157372_10393699 3300013307 Bacteria 1614
256 Ga0157372_10419692 3300013307 Bacteria 1559
257 Ga0157372_10485241 3300013307 Bacteria 1441
258 Ga0157372_10763684 3300013307 Bacteria 1124
259 Ga0157372_10914201 3300013307 Bacteria 1018
260 Ga0157375_10006678 3300013308 Bacteria 10046
261 Ga0157375_10034594 3300013308 Bacteria 4815
262 Ga0157375_10164572 3300013308 Bacteria 2362
263 Ga0163163_10000237 3300014325 Bacteria 56191
264 Ga0163163_10930455 3300014325 Unclassified 933
265 Ga0163163_11468326 3300014325 Unclassified 743
266 Ga0157380_10137554 3300014326 Bacteria 2093
267 Ga0182008_10297901 3300014497 Bacteria 843
268 Ga0157377_10140699 3300014745 Bacteria 1483
269 Ga0157379_10015308 3300014968 Bacteria 6727
270 Ga0157379_10052254 3300014968 Bacteria 3650
271 Ga0157379_10351789 3300014968 Unclassified 1349
272 Ga0157376_10000386 3300014969 Bacteria 28694
273 Ga0157376_10015969 3300014969 Bacteria 5689
274 Ga0157376_10018459 3300014969 Bacteria 5349
275 Ga0157376_10047670 3300014969 Bacteria 3539
276 Ga0157376_10062577 3300014969 Bacteria 3132
277 Ga0157376_10134642 3300014969 Bacteria 2210
278 Ga0157376_10545664 3300014969 Unclassified 1146
279 Ga0163161_10128650 3300017792 Bacteria 1908
280 Ga0206349_1950787 3300020075 Unclassified 711
281 Ga0206351_10231283 3300020077 Unclassified 971
282 Ga0206352_10818192 3300020078 Bacteria 718
283 Ga0206350_10428001 3300020080 Bacteria 787
284 Ga0206350_11401342 3300020080 Bacteria 983
285 Ga0206354_11683905 3300020081 Bacteria 590
286 Ga0206353_10193638 3300020082 Bacteria 1161
287 Ga0224570_100061 3300022730 Bacteria 5840
288 Ga0224569_101946 3300022732 Unclassified 1706
289 Ga0224572_1003039 3300024225 Bacteria 2790
290 Ga0224572_1003818 3300024225 Bacteria 2572
291 Ga0228598_1004954 3300024227 Bacteria 2802
292 Ga0209233_1021243 3300025261 Bacteria 1685
293 Ga0207697_10031456 3300025315 Bacteria 2171
294 Ga0207656_10003780 3300025321 Bacteria 5243
295 Ga0207656_10013842 3300025321 Bacteria 3093
296 Ga0207656_10052383 3300025321 Unclassified 1767
297 Ga0207692_10103896 3300025898 Bacteria 1565
298 Ga0207642_10102103 3300025899 Bacteria 1442
299 Ga0207710_10001408 3300025900 Bacteria 12030
300 Ga0207688_10342059 3300025901 Bacteria 920
301 Ga0207680_10045351 3300025903 Bacteria 2591
302 Ga0207680_10051850 3300025903 Bacteria 2455
303 Ga0207680_10072280 3300025903 Bacteria 2141
304 Ga0207647_10038062 3300025904 Unclassified 3044
305 Ga0207647_10041732 3300025904 Bacteria 2883
306 Ga0207647_10306155 3300025904 Unclassified 904
307 Ga0207645_10057989 3300025907 Bacteria 2472
308 Ga0207705_10816132 3300025909 Unclassified 724
309 Ga0207654_10000078 3300025911 Bacteria 63974
310 Ga0207654_10000095 3300025911 Bacteria 59415
311 Ga0207654_10000236 3300025911 Bacteria 33775
312 Ga0207654_10021215 3300025911 Bacteria 3452
313 Ga0207654_10060307 3300025911 Bacteria 2216
314 Ga0207707_10020940 3300025912 Bacteria 5713
315 Ga0207707_10143838 3300025912 Bacteria 2084
316 Ga0207707_10382273 3300025912 Bacteria 1210
317 Ga0207707_10452822 3300025912 Unclassified 1098
318 Ga0207695_10000002 3300025913 Bacteria 2188391
319 Ga0207695_10000075 3300025913 Bacteria 308496
320 Ga0207695_10000145 3300025913 Bacteria 209555
321 Ga0207695_10000787 3300025913 Bacteria 59756
322 Ga0207695_10001098 3300025913 Bacteria 47165
323 Ga0207695_10001570 3300025913 Bacteria 37221
324 Ga0207695_10005982 3300025913 Bacteria 15912
325 Ga0207695_10020928 3300025913 Bacteria 7476
326 Ga0207695_10081808 3300025913 Bacteria 3267
327 Ga0207695_10120524 3300025913 Bacteria 2592
328 Ga0207695_10124594 3300025913 Bacteria 2541
329 Ga0207695_10130213 3300025913 Bacteria 2474
330 Ga0207695_10160348 3300025913 Unclassified 2181
331 Ga0207695_10298617 3300025913 Bacteria 1502
332 Ga0207671_10000032 3300025914 Bacteria 245878
333 Ga0207671_10000324 3300025914 Bacteria 70145
334 Ga0207671_10114340 3300025914 Bacteria 2057
335 Ga0207671_11014145 3300025914 Bacteria 654
336 Ga0207663_10400454 3300025916 Unclassified 1050
337 Ga0207660_10056514 3300025917 Unclassified 2808
338 Ga0207660_10061047 3300025917 Bacteria 2712
339 Ga0207660_10145932 3300025917 Unclassified 1813
340 Ga0207657_10001924 3300025919 Bacteria 22428
341 Ga0207649_10044728 3300025920 Bacteria 2712
342 Ga0207652_10018951 3300025921 Bacteria 5651
343 Ga0207652_10029748 3300025921 Bacteria 4570
344 Ga0207681_10126464 3300025923 Bacteria 1883
345 Ga0207694_10000024 3300025924 Bacteria 259443
346 Ga0207694_10000259 3300025924 Bacteria 50419
347 Ga0207694_10004199 3300025924 Bacteria 11285
348 Ga0207694_10005121 3300025924 Bacteria 10118
349 Ga0207694_10038917 3300025924 Bacteria 3657
350 Ga0207694_10114135 3300025924 Bacteria 2151
351 Ga0207694_10435050 3300025924 Unclassified 1094
352 Ga0207650_10002268 3300025925 Bacteria 13423
353 Ga0207687_10000208 3300025927 Bacteria 39686
354 Ga0207687_10015318 3300025927 Bacteria 5024
355 Ga0207687_10083925 3300025927 Bacteria 2308
356 Ga0207687_10113093 3300025927 Bacteria 2019
357 Ga0207700_10133289 3300025928 Bacteria 2032
358 Ga0207664_10149234 3300025929 Bacteria 1985
359 Ga0207664_10385618 3300025929 Unclassified 1244
360 Ga0207644_10104501 3300025931 Unclassified 2132
361 Ga0207644_10338217 3300025931 Unclassified 1220
362 Ga0207690_10141739 3300025932 Bacteria 1772
363 Ga0207706_10002070 3300025933 Bacteria 19666
364 Ga0207704_10021101 3300025938 Bacteria 3461
365 Ga0207665_10421223 3300025939 Unclassified 1020
366 Ga0207711_10000040 3300025941 Bacteria 162754
367 Ga0207711_10001178 3300025941 Bacteria 24859
368 Ga0207711_10143846 3300025941 Bacteria 2147
369 Ga0207711_10175034 3300025941 Unclassified 1949
370 Ga0207711_10730544 3300025941 Bacteria 923
371 Ga0207689_10000487 3300025942 Bacteria 37505
372 Ga0207689_10171493 3300025942 Bacteria 1788
373 Ga0207661_10000123 3300025944 Bacteria 49544
374 Ga0207661_10016981 3300025944 Bacteria 5376
375 Ga0207661_10117736 3300025944 Bacteria 2257
376 Ga0207661_10232131 3300025944 Bacteria 1634
377 Ga0207661_10240726 3300025944 Unclassified 1605
378 Ga0207661_10610603 3300025944 Bacteria 1001
379 Ga0207679_10207770 3300025945 Bacteria 1640
380 Ga0207679_10344300 3300025945 Bacteria 1297
381 Ga0207667_10000188 3300025949 Bacteria 90598
382 Ga0207667_10000659 3300025949 Bacteria 44741
383 Ga0207667_10009596 3300025949 Bacteria 11389
384 Ga0207667_10020170 3300025949 Bacteria 7421
385 Ga0207667_10070194 3300025949 Bacteria 3646
386 Ga0207667_10261180 3300025949 Bacteria 1771
387 Ga0207651_10042316 3300025960 Bacteria 3031
388 Ga0207668_10050977 3300025972 Bacteria 2856
389 Ga0207640_10012003 3300025981 Bacteria 4923
390 Ga0207640_10138733 3300025981 Bacteria 1769
391 Ga0207640_11206333 3300025981 Bacteria 673
392 Ga0207640_11333929 3300025981 Bacteria 641
393 Ga0207658_10000135 3300025986 Bacteria 77651
394 Ga0207658_10013447 3300025986 Bacteria 5590
395 Ga0207677_10090329 3300026023 Bacteria 2225
396 Ga0207677_10164829 3300026023 Unclassified 1726
397 Ga0207703_10023052 3300026035 Unclassified 4888
398 Ga0207703_10181957 3300026035 Bacteria 1855
399 Ga0207703_10388071 3300026035 Unclassified 1293
400 Ga0207703_10607108 3300026035 Unclassified 1035
401 Ga0207639_10000050 3300026041 Bacteria 121432
402 Ga0207639_10009673 3300026041 Bacteria 6660
403 Ga0207639_10059914 3300026041 Bacteria 2935
404 Ga0207639_11244107 3300026041 Unclassified 699
405 Ga0207678_10051293 3300026067 Bacteria 3562
406 Ga0207678_10313195 3300026067 Unclassified 1350
407 Ga0207678_10462456 3300026067 Bacteria 1104
408 Ga0207678_10820234 3300026067 Unclassified 822
409 Ga0207702_10000109 3300026078 Bacteria 95381
410 Ga0207702_10003095 3300026078 Bacteria 15424
411 Ga0207702_10186276 3300026078 Bacteria 1914
412 Ga0207702_10239730 3300026078 Bacteria 1698
413 Ga0207702_10252317 3300026078 Bacteria 1657
414 Ga0207702_10319703 3300026078 Bacteria 1478
415 Ga0207702_10417969 3300026078 Bacteria 1296
416 Ga0207702_11352080 3300026078 Unclassified 706
417 Ga0207641_10004397 3300026088 Bacteria 12208
418 Ga0207641_10091516 3300026088 Bacteria 2662
419 Ga0207676_10000316 3300026095 Bacteria 41392
420 Ga0207676_10066634 3300026095 Bacteria 2873
421 Ga0207674_10000815 3300026116 Bacteria 40507
422 Ga0207674_10082621 3300026116 Bacteria 3213
423 Ga0207674_10165399 3300026116 Unclassified 2166
424 Ga0207674_10278425 3300026116 Bacteria 1621
425 Ga0207674_10890904 3300026116 Bacteria 858
426 Ga0207683_10042955 3300026121 Bacteria 3948
427 Ga0207698_10000129 3300026142 Bacteria 47118
428 Ga0207698_10000393 3300026142 Bacteria 25270
429 Ga0207698_10023255 3300026142 Bacteria 4326
430 Ga0207698_10023960 3300026142 Bacteria 4274
431 Ga0207698_10063497 3300026142 Bacteria 2890
432 Ga0207698_10189601 3300026142 Unclassified 1830
433 Ga0207698_10258585 3300026142 Bacteria 1598
434 Ga0265354_1005936 3300028016 Bacteria 1225
435 Ga0265355_1001386 3300028036 Unclassified 1565
436 Ga0268266_10015978 3300028379 Bacteria 6420
437 Ga0268266_10179211 3300028379 Bacteria 1928
438 Ga0268265_10087580 3300028380 Unclassified 2478
439 Ga0268265_10443295 3300028380 Bacteria 1211
440 Ga0268264_10000540 3300028381 Bacteria 47743
441 Ga0268264_10038935 3300028381 Bacteria 3926
442 Ga0265334_10183244 3300028573 Unclassified 731
443 Ga0265318_10005203 3300028577 Bacteria 6140
444 Ga0265318_10028158 3300028577 Unclassified 2200
445 Ga0265323_10045661 3300028653 Bacteria 1573
446 Ga0265336_10000499 3300028666 Bacteria 22942
447 Ga0265338_10000529 3300028800 Bacteria 67074
448 Ga0265338_10011218 3300028800 Bacteria 10384
449 Ga0265338_10084444 3300028800 Bacteria 2651
450 Ga0265338_10102619 3300028800 Bacteria 2325
451 Ga0265338_10108441 3300028800 Bacteria 2243
452 Ga0265338_10112450 3300028800 Bacteria 2190
453 Ga0265338_10571319 3300028800 Unclassified 790
454 Ga0265338_10651160 3300028800 Unclassified 730
455 Ga0265324_10048953 3300029957 Bacteria 1453
456 Ga0265762_1010793 3300030760 Unclassified 1631
457 Ga0265762_1042991 3300030760 Unclassified 889
458 Ga0265762_1063727 3300030760 Unclassified 762
459 Ga0265762_1089285 3300030760 Unclassified 670
460 Ga0265766_1016733 3300030863 Unclassified 577
461 Ga0265770_1017206 3300030878 Bacteria 1115
462 Ga0265765_1001407 3300030879 Bacteria 2195
463 Ga0265760_10038134 3300031090 Bacteria 1428
464 Ga0265760_10040134 3300031090 Unclassified 1394
465 Ga0265760_10211718 3300031090 Unclassified 658
466 Ga0265330_10000726 3300031235 Bacteria 20709
467 Ga0265330_10001029 3300031235 Bacteria 16863
468 Ga0265330_10006052 3300031235 Bacteria 5991
469 Ga0265330_10057097 3300031235 Bacteria 1703
470 Ga0265332_10006106 3300031238 Bacteria 5501
471 Ga0265328_10003631 3300031239 Bacteria 6808
472 Ga0265328_10007337 3300031239 Bacteria 4602
473 Ga0265328_10014278 3300031239 Bacteria 3129
474 Ga0265328_10080507 3300031239 Bacteria 1200
475 Ga0265320_10128358 3300031240 Bacteria 1153
476 Ga0265320_10179379 3300031240 Bacteria 949
477 Ga0265325_10000249 3300031241 Bacteria 38332
478 Ga0265325_10000335 3300031241 Bacteria 33298
479 Ga0265325_10019175 3300031241 Bacteria 3785
480 Ga0265325_10139868 3300031241 Bacteria 1152
481 Ga0265325_10244446 3300031241 Bacteria 814
482 Ga0265325_10285418 3300031241 Bacteria 739
483 Ga0265329_10022784 3300031242 Bacteria 2091
484 Ga0265329_10029539 3300031242 Bacteria 1790
485 Ga0265340_10009847 3300031247 Bacteria 5122
486 Ga0265340_10017776 3300031247 Bacteria 3678
487 Ga0265340_10180620 3300031247 Unclassified 954
488 Ga0265339_10000183 3300031249 Bacteria 53140
489 Ga0265339_10003154 3300031249 Bacteria 11607
490 Ga0265339_10003965 3300031249 Bacteria 10229
491 Ga0265339_10004030 3300031249 Bacteria 10148
492 Ga0265339_10020874 3300031249 Unclassified 3821
493 Ga0265339_10030191 3300031249 Bacteria 3071
494 Ga0265339_10093982 3300031249 Bacteria 1568
495 Ga0265339_10251843 3300031249 Bacteria 854
496 Ga0265339_10259699 3300031249 Bacteria 838
497 Ga0265331_10023059 3300031250 Bacteria 3168
498 Ga0265331_10139547 3300031250 Bacteria 1103
499 Ga0265327_10207709 3300031251 Unclassified 885
500 Ga0265316_10001212 3300031344 Bacteria 27775
501 Ga0265316_10001361 3300031344 Bacteria 26314
502 Ga0265316_10007811 3300031344 Bacteria 10013
503 Ga0265316_10011127 3300031344 Bacteria 8143
504 Ga0265316_10012098 3300031344 Bacteria 7750
505 Ga0265316_10035952 3300031344 Bacteria 4008
506 Ga0265316_10043045 3300031344 Bacteria 3604
507 Ga0265316_10062172 3300031344 Bacteria 2898
508 Ga0265316_10090814 3300031344 Bacteria 2330
509 Ga0265316_10117671 3300031344 Bacteria 2009
510 Ga0265316_10129118 3300031344 Bacteria 1905
511 Ga0265316_10225980 3300031344 Bacteria 1380
512 Ga0265316_10288897 3300031344 Bacteria 1197
513 Ga0265316_10425595 3300031344 Bacteria 954
514 Ga0265316_10472772 3300031344 Bacteria 898
515 Ga0265313_10007115 3300031595 Bacteria 7714
516 Ga0265313_10007256 3300031595 Bacteria 7614
517 Ga0265313_10036859 3300031595 Unclassified 2452
518 Ga0265313_10040410 3300031595 Bacteria 2306
519 Ga0265313_10390427 3300031595 Unclassified 547
520 Ga0265314_10000239 3300031711 Bacteria 80839
521 Ga0265314_10005184 3300031711 Bacteria 11831
522 Ga0265314_10031922 3300031711 Bacteria 3881
523 Ga0265314_10077470 3300031711 Bacteria 2205
524 Ga0265314_10195858 3300031711 Bacteria 1198
525 Ga0265314_10229355 3300031711 Bacteria 1078
526 Ga0265314_10259401 3300031711 Bacteria 993
527 Ga0265342_10001693 3300031712 Bacteria 20222
528 Ga0265342_10002138 3300031712 Bacteria 17433
529 Ga0265342_10006731 3300031712 Bacteria 8516
530 Ga0265342_10010813 3300031712 Bacteria 6288
531 Ga0265342_10015765 3300031712 Bacteria 4962
532 Ga0265342_10038168 3300031712 Bacteria 2926
533 Ga0265342_10058747 3300031712 Bacteria 2273
534 Ga0265342_10069506 3300031712 Bacteria 2056
535 Ga0265342_10085101 3300031712 Bacteria 1820
536 Ga0316053_101140 3300032120 Bacteria 1359
537 Ga0316212_1017762 3300033547 Unclassified 1001
538 Ga0373954_0116407 3300035118 Bacteria 1295
539 Ga0373957_0258981 3300035120 Bacteria 733
540 Ga0373955_0028996 3300035172 Bacteria 2875
541 Ga0373955_0864742 3300035172 Unclassified 556
542 Ga0373931_0098718 3300035691 Bacteria 1639
543 Ga0373935_1018702 3300035692 Unclassified 615
544 Ga0373933_0035547 3300035724 Bacteria 2910
545 Ga0373933_0790788 3300035724 Unclassified 624
546 Ga0373937_0043808 3300036401 Bacteria 4087
547 Ga0373937_0134727 3300036401 Bacteria 2309
548 Ga0265778_025231 3300036457 Bacteria 750
549 Ga0373925_0282808 3300037068 Bacteria 1336
550 Ga0395900_0156328 3300037418 Unclassified 2329
551 Ga0395900_0636865 3300037418 Bacteria 1004
552 Ga0395898_0218267 3300037466 Unclassified 1819
553 Ga0395898_1187193 3300037466 Bacteria 695
554 Ga0395901_0759468 3300038443 Bacteria 962
555 Ga0395901_0929381 3300038443 Bacteria 850
556 Ga0436360_0142677 3300039438 Unclassified 1115
557 Ga0436361_0789764 3300039447 Unclassified 3702
558 Ga0436361_1143868 3300039447 Unclassified 3774
559 Ga0436363_1390236 3300039450 Unclassified 1776
560 Ga0451577_0360908 3300042876 Unclassified 1318
561 Ga0466969_0121069 3300044656 Bacteria 1218
562 Ga0453683_0825014 3300044673 Unclassified 611
563 Ga0466961_0044708 3300044693 Bacteria 2834
564 Ga0466963_0187589 3300044694 Bacteria 1444
565 Ga0453684_0151344 3300044712 Bacteria 2757
566 Ga0466971_0135604 3300044719 Bacteria 1145
567 Ga0466959_0238849 3300045049 Bacteria 1256
568 Ga0466958_0274652 3300045836 Bacteria 1080
569 Ga0466958_0378813 3300045836 Bacteria 912
570 Ga0466958_0930567 3300045836 Unclassified 567
571 Ga0466967_0000871 3300045976 Bacteria 16075
572 Ga0466967_0476111 3300045976 Bacteria 1223
573 Ga0466967_0560712 3300045976 Bacteria 1125
574 Ga0495592_0300629 3300046454 Bacteria 1043
575 Ga0495629_0033730 3300046459 Unclassified 3620
576 Ga0495629_0251369 3300046459 Unclassified 1216
577 Ga0495651_0187478 3300046462 Bacteria 1458
578 Ga0495580_0086130 3300046472 Bacteria 2188
579 Ga0495580_0357617 3300046472 Unclassified 988
580 Ga0495664_0016591 3300046477 Bacteria 4198
581 Ga0495664_0099506 3300046477 Unclassified 1751
582 Ga0495606_0152030 3300046507 Bacteria 1358
583 Ga0495643_0008438 3300046522 Bacteria 6520
584 Ga0495652_0017267 3300046529 Bacteria 6443
585 Ga0495665_0094382 3300046531 Bacteria 1571
586 Ga0495665_0148265 3300046531 Unclassified 1225
587 Ga0495587_0091758 3300046536 Bacteria 1754
588 Ga0495587_0160448 3300046536 Unclassified 1279
589 Ga0495587_0205547 3300046536 Bacteria 1113
590 Ga0495645_0000851 3300046543 Bacteria 20792
591 Ga0495645_0004067 3300046543 Bacteria 9990
592 Ga0495645_0259622 3300046543 Bacteria 1151
593 Ga0495667_0407338 3300046559 Unclassified 856
594 Ga0495668_0196331 3300046616 Bacteria 1105
595 Ga0495635_0310197 3300046663 Bacteria 1057
596 Ga0495588_0554716 3300046674 Unclassified 602
597 Ga0495599_0268148 3300046678 Unclassified 1036
598 Ga0495623_0183616 3300046679 Bacteria 1213
599 Ga0495646_0087380 3300046680 Unclassified 1807
600 Ga0495647_0250128 3300046681 Unclassified 789
601 Ga0495658_0143447 3300046683 Bacteria 1462
602 Ga0495669_0074570 3300046684 Unclassified 1551
603 Ga0495613_0120640 3300046689 Bacteria 1883
604 Ga0495613_0170750 3300046689 Unclassified 1543
605 Ga0495649_0209536 3300046694 Bacteria 1010
606 Ga0495600_0013179 3300046809 Bacteria 5188
607 Ga0495600_0035008 3300046809 Unclassified 3261
608 Ga0495600_0518669 3300046809 Unclassified 731
609 Ga0495604_0023379 3300047317 Bacteria 4931
610 Ga0495604_0622195 3300047317 Unclassified 691
611 Ga0495674_1025142 3300047319 Unclassified 631
612 Ga0495680_0611796 3300047322 Unclassified 728
613 Ga0495687_061375 3300047443 Bacteria 1546
614 Ga0495675_0611588 3300047444 Unclassified 617
615 Ga0495679_184635 3300047446 Unclassified 552
616 Ga0495684_0543379 3300047471 Bacteria 792
617 Ga0495602_0153560 3300048088 Unclassified 1806
618 Ga0495602_0153583 3300048088 Bacteria 1806
619 Ga0495602_0160872 3300048088 Bacteria 1753
620 Ga0495602_0298344 3300048088 Unclassified 1180
621 Ga0496100_0006877 3300048903 Bacteria 6230
622 Ga0496100_0201471 3300048903 Bacteria 1451
623 Ga0496100_0623108 3300048903 Unclassified 839
624 Ga0496100_1083413 3300048903 Unclassified 631
625 Ga0496101_0040914 3300048904 Bacteria 3302
626 Ga0496104_0023520 3300048907 Bacteria 5665
627 Ga0496104_0224458 3300048907 Bacteria 1791
628 Ga0496104_0268862 3300048907 Bacteria 1617
629 Ga0496104_1058448 3300048907 Unclassified 715
630 Ga0496105_0033315 3300048908 Bacteria 4229
631 Ga0496105_0313877 3300048908 Bacteria 1258
632 Ga0496105_0328160 3300048908 Bacteria 1225
633 Ga0496106_0686848 3300048909 Unclassified 816
634 Ga0496107_0015330 3300048910 Bacteria 5370
635 Ga0496108_0123375 3300048911 Bacteria 2223
636 Ga0496108_1066578 3300048911 Bacteria 688
637 Ga0496109_0069772 3300048912 Bacteria 3224
638 Ga0496110_0234798 3300048913 Bacteria 1668
639 Ga0496111_0072169 3300048914 Bacteria 2513
640 Ga0496112_0121928 3300048915 Unclassified 2577
641 Ga0496112_0585561 3300048915 Bacteria 1048
642 Ga0496113_0253422 3300048916 Bacteria 1405
643 Ga0496114_0005695 3300048917 Bacteria 9773
644 Ga0496114_0296303 3300048917 Bacteria 1428
645 Ga0496115_0023844 3300048918 Bacteria 4752
646 Ga0496115_0154171 3300048918 Unclassified 1897
647 Ga0496115_0269720 3300048918 Bacteria 1398
648 Ga0496115_0431031 3300048918 Bacteria 1067
649 Ga0496118_0215470 3300048921 Bacteria 1123
650 Ga0496119_0170540 3300048922 Unclassified 1150
651 Ga0496126_0001522 3300048929 Bacteria 35736
652 Ga0496126_0019634 3300048929 Bacteria 6652
653 Ga0496126_0185187 3300048929 Bacteria 1766
654 Ga0495682_0148677 3300049460 Bacteria 836
655 Ga0495601_0253612 3300053077 Unclassified 1149
656 Ga0495619_0089378 3300053085 Unclassified 2084
657 Ga0495619_0352281 3300053085 Unclassified 1018
658 Ga0500644_0030343 3300053088 Bacteria 1709
659 Ga0500595_032198 3300053119 Bacteria 1752
660 Ga0587093_052592 3300059478 Unclassified 647
661 Ga0587085_013311 3300059506 Unclassified 1143
662 Ga0587091_045131 3300059511 Unclassified 884
663 Ga0587092_014861 3300059512 Bacteria 1133
664 Ga0587094_017734 3300059513 Unclassified 1005
665 Ga0587101_019722 3300059623 Unclassified 958
666 Ga0587109_033136 3300059624 Unclassified 991
667 Ga0587117_017967 3300059627 Unclassified 957
668 Ga0587068_024958 3300059641 Unclassified 1004
669 Ga0587114_017560 3300059655 Unclassified 972
670 Ga0466962_0380729 3300061719 Bacteria 705
671 Ga0070660_100135327
672 rootH2_10042999
673 rootH2_10066083
674 rootH2_10066096
675 rootH1_10393081
676 Ga0058861_11488209
677 Ga0058861_11778718
678 Ga0070658_10005408
679 Ga0070658_10006481
680 Ga0070658_10973149
681 Ga0070676_10013742
682 Ga0070683_100026956
683 Ga0070683_100150487
684 Ga0070683_100581527
685 Ga0070670_100063184
686 Ga0068869_100001913
687 Ga0068869_100191268
688 Ga0068869_100281621
689 Ga0070666_10044562
690 Ga0070666_10062598
691 Ga0070680_100081136
692 Ga0070680_100162693
693 Ga0070680_100437397
694 Ga0070682_100194644
695 Ga0068868_100000009
696 Ga0068868_100015740
697 Ga0068868_100022926
698 Ga0070660_100000311
699 Ga0070660_100067433
700 Ga0070660_101015614
701 Ga0070661_100021911
702 Ga0070661_100165020
703 Ga0070668_100084709
704 Ga0070675_100034487
705 Ga0070671_100154151
706 Ga0070673_100010611
707 Ga0070659_100172730
708 Ga0070659_100181963
709 Ga0070667_100001882
710 Ga0070667_100012140
711 Ga0070714_100017303
712 Ga0070714_100168901
713 Ga0070713_100190228
714 Ga0070713_100225407
715 Ga0070713_100235136
716 Ga0070713_100256280
717 Ga0070713_100650745
718 Ga0070710_10333662
719 Ga0070710_11072337
720 Ga0070711_100046625
721 Ga0070711_100221272
722 Ga0070663_100188084
723 Ga0070663_100329767
724 Ga0070663_100494166
725 Ga0070663_100980482
726 Ga0070663_101564620
727 Ga0070678_100062022
728 Ga0070662_100010729
729 Ga0070681_10000804
730 Ga0070681_10046056
731 Ga0070681_10181592
732 Ga0070681_10373753
733 Ga0070679_100000226
734 Ga0070679_100004694
735 Ga0070679_100044742
736 Ga0070679_100300525
737 Ga0070679_100357466
738 Ga0070684_100025564
739 Ga0070684_100078675
740 Ga0070684_100111897
741 Ga0068853_100000914
742 Ga0068853_100034028
743 Ga0068853_100042984
744 Ga0068853_101287819
745 Ga0070665_100030820
746 Ga0070665_100085640
747 Ga0070665_100169901
748 Ga0070665_100234765
749 Ga0070665_100326624
750 Ga0068855_100003316
751 Ga0068855_100007673
752 Ga0068855_100015507
753 Ga0068855_100021636
754 Ga0068855_100362979
755 Ga0068855_100408414
756 Ga0068855_100663659
757 Ga0068855_102190800
758 Ga0070664_100165483
759 Ga0070664_100171960
760 Ga0068857_100000181
761 Ga0068857_100014310
762 Ga0068857_100054215
763 Ga0068857_100055906
764 Ga0068854_100003621
765 Ga0068854_100030603
766 Ga0068854_100113951
767 Ga0068854_101304836
768 Ga0068856_100012249
769 Ga0068856_100015932
770 Ga0068856_100017479
771 Ga0068856_100028898
772 Ga0068856_100076409
773 Ga0068856_100129642
774 Ga0068856_100241622
775 Ga0068856_100562375
776 Ga0068856_100576719
777 Ga0068856_100750727
778 Ga0068852_100000199
779 Ga0068852_100001654
780 Ga0068852_100027066
781 Ga0068852_100044386
782 Ga0068852_100097933
783 Ga0068852_100150067
784 Ga0068852_100203299
785 Ga0068852_100293226
786 Ga0068859_100002712
787 Ga0068859_100184430
788 Ga0068859_100313535
789 Ga0068864_100003465
790 Ga0068866_10131164
791 Ga0068861_100428645
792 Ga0068851_10012603
793 Ga0068851_10026100
794 Ga0068851_10048580
795 Ga0068863_100000273
796 Ga0068863_100019580
797 Ga0068858_100026536
798 Ga0068858_100058900
799 Ga0068858_100431672
800 Ga0068860_100000031
801 Ga0068862_100112116
802 Ga0068862_100558009
803 Ga0081540_1003073
804 Ga0070717_10000898
805 Ga0070717_10728862
806 Ga0070717_11011773
807 Ga0070715_10243734
808 Ga0097621_100007467
809 Ga0097621_101265071
810 Ga0068871_100002198
811 Ga0068871_100138203
812 Ga0068871_100416408
813 Ga0068871_100487955
814 Ga0068865_100044913
815 Ga0097620_100002712
816 Ga0097620_100184430
817 Ga0097620_100313551
818 Ga0105240_10000002
819 Ga0105240_10001070
820 Ga0105240_10001619
821 Ga0105240_10002552
822 Ga0105240_10002933
823 Ga0105240_10003422
824 Ga0105240_10068958
825 Ga0105240_10092329
826 Ga0105240_10263729
827 Ga0105240_10273791
828 Ga0105240_11690566
829 Ga0105245_10003181
830 Ga0105245_10039374
831 Ga0105245_10273907
832 Ga0105245_10318564
833 Ga0105247_10003136
834 Ga0105247_10028798
835 Ga0105247_10037922
836 Ga0105247_10647858
837 Ga0105241_10000673
838 Ga0105241_10003894
839 Ga0105241_10022664
840 Ga0105241_10098299
841 Ga0105241_10274294
842 Ga0105248_10000047
843 Ga0105248_10001252
844 Ga0105248_10168927
845 Ga0105248_10187362
846 Ga0105248_10706673
847 Ga0105248_10708469
848 Ga0105237_10019065
849 Ga0105237_10048761
850 Ga0105237_10638549
851 Ga0105237_10760971
852 Ga0105238_10011172
853 Ga0105238_10021179
854 Ga0105238_10027432
855 Ga0105238_10038723
856 Ga0105238_10041018
857 Ga0105238_10239763
858 Ga0105238_10508814
859 Ga0105238_10812997
860 Ga0105249_10061447
861 Ga0105249_10340065
862 Ga0130087_1078875
863 Ga0130086_1004910
864 Ga0130084_1075844
865 Ga0130085_1124052
866 Ga0105239_10001864
867 Ga0105239_10075008
868 Ga0105239_10107380
869 Ga0105239_10118191
870 Ga0105239_10163775
871 Ga0105239_10320208
872 Ga0105239_10440968
873 Ga0105239_10752216
874 Ga0105239_10859899
875 Ga0105239_10975988
876 Ga0105246_10001815
877 Ga0105246_10235672
878 Ga0157373_10145851
879 Ga0157373_10193408
880 Ga0157373_10392121
881 Ga0157373_10522071
882 Ga0157371_10076673
883 Ga0157371_10215085
884 Ga0157371_10251668
885 Ga0157370_10000542
886 Ga0157370_10010623
887 Ga0157370_10020842
888 Ga0157370_10116793
889 Ga0157370_10477416
890 Ga0157369_10001280
891 Ga0157369_10002372
892 Ga0157369_10026543
893 Ga0157369_10046264
894 Ga0157369_10048947
895 Ga0157369_10081995
896 Ga0157369_10143355
897 Ga0157369_10163788
898 Ga0157369_10171211
899 Ga0157369_10213948
900 Ga0157369_10355054
901 Ga0157374_10002229
902 Ga0157374_10034217
903 Ga0157374_10042612
904 Ga0157374_10105065
905 Ga0157374_10145427
906 Ga0157374_10539209
907 Ga0157374_11046605
908 Ga0157378_10007247
909 Ga0157378_10013136
910 Ga0157378_10066515
911 Ga0157378_10172143
912 Ga0157378_10647715
913 Ga0163162_10115828
914 Ga0163162_10709340
915 Ga0163162_11165302
916 Ga0157372_10000408
917 Ga0157372_10002226
918 Ga0157372_10003039
919 Ga0157372_10003426
920 Ga0157372_10021880
921 Ga0157372_10100329
922 Ga0157372_10292889
923 Ga0157372_10345838
924 Ga0157372_10386506
925 Ga0157372_10393699
926 Ga0157372_10419692
927 Ga0157372_10485241
928 Ga0157372_10763684
929 Ga0157372_10914201
930 Ga0157375_10006678
931 Ga0157375_10034594
932 Ga0157375_10164572
933 Ga0163163_10000237
934 Ga0163163_10930455
935 Ga0163163_11468326
936 Ga0157380_10137554
937 Ga0182008_10297901
938 Ga0157377_10140699
939 Ga0157379_10015308
940 Ga0157379_10052254
941 Ga0157379_10351789
942 Ga0157376_10000386
943 Ga0157376_10015969
944 Ga0157376_10018459
945 Ga0157376_10047670
946 Ga0157376_10062577
947 Ga0157376_10134642
948 Ga0157376_10545664
949 Ga0163161_10128650
950 Ga0206349_1950787
951 Ga0206351_10231283
952 Ga0206352_10818192
953 Ga0206350_10428001
954 Ga0206350_11401342
955 Ga0206354_11683905
956 Ga0206353_10193638
957 Ga0224570_100061
958 Ga0224569_101946
959 Ga0224572_1003039
960 Ga0224572_1003818
961 Ga0228598_1004954
962 Ga0209233_1021243
963 Ga0207697_10031456
964 Ga0207656_10003780
965 Ga0207656_10013842
966 Ga0207656_10052383
967 Ga0207692_10103896
968 Ga0207642_10102103
969 Ga0207710_10001408
970 Ga0207688_10342059
971 Ga0207680_10045351
972 Ga0207680_10051850
973 Ga0207680_10072280
974 Ga0207647_10038062
975 Ga0207647_10041732
976 Ga0207647_10306155
977 Ga0207645_10057989
978 Ga0207705_10816132
979 Ga0207654_10000078
980 Ga0207654_10000095
981 Ga0207654_10000236
982 Ga0207654_10021215
983 Ga0207654_10060307
984 Ga0207707_10020940
985 Ga0207707_10143838
986 Ga0207707_10382273
987 Ga0207707_10452822
988 Ga0207695_10000002
989 Ga0207695_10000075
990 Ga0207695_10000145
991 Ga0207695_10000787
992 Ga0207695_10001098
993 Ga0207695_10001570
994 Ga0207695_10005982
995 Ga0207695_10020928
996 Ga0207695_10081808
997 Ga0207695_10120524
998 Ga0207695_10124594
999 Ga0207695_10130213
1000 Ga0207695_10160348
1001 Ga0207695_10298617
1002 Ga0207671_10000032
1003 Ga0207671_10000324
1004 Ga0207671_10114340
1005 Ga0207671_11014145
1006 Ga0207663_10400454
1007 Ga0207660_10056514
1008 Ga0207660_10061047
1009 Ga0207660_10145932
1010 Ga0207657_10001924
1011 Ga0207649_10044728
1012 Ga0207652_10018951
1013 Ga0207652_10029748
1014 Ga0207681_10126464
1015 Ga0207694_10000024
1016 Ga0207694_10000259
1017 Ga0207694_10004199
1018 Ga0207694_10005121
1019 Ga0207694_10038917
1020 Ga0207694_10114135
1021 Ga0207694_10435050
1022 Ga0207650_10002268
1023 Ga0207687_10000208
1024 Ga0207687_10015318
1025 Ga0207687_10083925
1026 Ga0207687_10113093
1027 Ga0207700_10133289
1028 Ga0207664_10149234
1029 Ga0207664_10385618
1030 Ga0207644_10104501
1031 Ga0207644_10338217
1032 Ga0207690_10141739
1033 Ga0207706_10002070
1034 Ga0207704_10021101
1035 Ga0207665_10421223
1036 Ga0207711_10000040
1037 Ga0207711_10001178
1038 Ga0207711_10143846
1039 Ga0207711_10175034
1040 Ga0207711_10730544
1041 Ga0207689_10000487
1042 Ga0207689_10171493
1043 Ga0207661_10000123
1044 Ga0207661_10016981
1045 Ga0207661_10117736
1046 Ga0207661_10232131
1047 Ga0207661_10240726
1048 Ga0207661_10610603
1049 Ga0207679_10207770
1050 Ga0207679_10344300
1051 Ga0207667_10000188
1052 Ga0207667_10000659
1053 Ga0207667_10009596
1054 Ga0207667_10020170
1055 Ga0207667_10070194
1056 Ga0207667_10261180
1057 Ga0207651_10042316
1058 Ga0207668_10050977
1059 Ga0207640_10012003
1060 Ga0207640_10138733
1061 Ga0207640_11206333
1062 Ga0207640_11333929
1063 Ga0207658_10000135
1064 Ga0207658_10013447
1065 Ga0207677_10090329
1066 Ga0207677_10164829
1067 Ga0207703_10023052
1068 Ga0207703_10181957
1069 Ga0207703_10388071
1070 Ga0207703_10607108
1071 Ga0207639_10000050
1072 Ga0207639_10009673
1073 Ga0207639_10059914
1074 Ga0207639_11244107
1075 Ga0207678_10051293
1076 Ga0207678_10313195
1077 Ga0207678_10462456
1078 Ga0207678_10820234
1079 Ga0207702_10000109
1080 Ga0207702_10003095
1081 Ga0207702_10186276
1082 Ga0207702_10239730
1083 Ga0207702_10252317
1084 Ga0207702_10319703
1085 Ga0207702_10417969
1086 Ga0207702_11352080
1087 Ga0207641_10004397
1088 Ga0207641_10091516
1089 Ga0207676_10000316
1090 Ga0207676_10066634
1091 Ga0207674_10000815
1092 Ga0207674_10082621
1093 Ga0207674_10165399
1094 Ga0207674_10278425
1095 Ga0207674_10890904
1096 Ga0207683_10042955
1097 Ga0207698_10000129
1098 Ga0207698_10000393
1099 Ga0207698_10023255
1100 Ga0207698_10023960
1101 Ga0207698_10063497
1102 Ga0207698_10189601
1103 Ga0207698_10258585
1104 Ga0265354_1005936
1105 Ga0265355_1001386
1106 Ga0268266_10015978
1107 Ga0268266_10179211
1108 Ga0268265_10087580
1109 Ga0268265_10443295
1110 Ga0268264_10000540
1111 Ga0268264_10038935
1112 Ga0265334_10183244
1113 Ga0265318_10005203
1114 Ga0265318_10028158
1115 Ga0265323_10045661
1116 Ga0265336_10000499
1117 Ga0265338_10000529
1118 Ga0265338_10011218
1119 Ga0265338_10084444
1120 Ga0265338_10102619
1121 Ga0265338_10108441
1122 Ga0265338_10112450
1123 Ga0265338_10571319
1124 Ga0265338_10651160
1125 Ga0265324_10048953
1126 Ga0265762_1010793
1127 Ga0265762_1042991
1128 Ga0265762_1063727
1129 Ga0265762_1089285
1130 Ga0265766_1016733
1131 Ga0265770_1017206
1132 Ga0265765_1001407
1133 Ga0265760_10038134
1134 Ga0265760_10040134
1135 Ga0265760_10211718
1136 Ga0265330_10000726
1137 Ga0265330_10001029
1138 Ga0265330_10006052
1139 Ga0265330_10057097
1140 Ga0265332_10006106
1141 Ga0265328_10003631
1142 Ga0265328_10007337
1143 Ga0265328_10014278
1144 Ga0265328_10080507
1145 Ga0265320_10128358
1146 Ga0265320_10179379
1147 Ga0265325_10000249
1148 Ga0265325_10000335
1149 Ga0265325_10019175
1150 Ga0265325_10139868
1151 Ga0265325_10244446
1152 Ga0265325_10285418
1153 Ga0265329_10022784
1154 Ga0265329_10029539
1155 Ga0265340_10009847
1156 Ga0265340_10017776
1157 Ga0265340_10180620
1158 Ga0265339_10000183
1159 Ga0265339_10003154
1160 Ga0265339_10003965
1161 Ga0265339_10004030
1162 Ga0265339_10020874
1163 Ga0265339_10030191
1164 Ga0265339_10093982
1165 Ga0265339_10251843
1166 Ga0265339_10259699
1167 Ga0265331_10023059
1168 Ga0265331_10139547
1169 Ga0265327_10207709
1170 Ga0265316_10001212
1171 Ga0265316_10001361
1172 Ga0265316_10007811
1173 Ga0265316_10011127
1174 Ga0265316_10012098
1175 Ga0265316_10035952
1176 Ga0265316_10043045
1177 Ga0265316_10062172
1178 Ga0265316_10090814
1179 Ga0265316_10117671
1180 Ga0265316_10129118
1181 Ga0265316_10225980
1182 Ga0265316_10288897
1183 Ga0265316_10425595
1184 Ga0265316_10472772
1185 Ga0265313_10007115
1186 Ga0265313_10007256
1187 Ga0265313_10036859
1188 Ga0265313_10040410
1189 Ga0265313_10390427
1190 Ga0265314_10000239
1191 Ga0265314_10005184
1192 Ga0265314_10031922
1193 Ga0265314_10077470
1194 Ga0265314_10195858
1195 Ga0265314_10229355
1196 Ga0265314_10259401
1197 Ga0265342_10001693
1198 Ga0265342_10002138
1199 Ga0265342_10006731
1200 Ga0265342_10010813
1201 Ga0265342_10015765
1202 Ga0265342_10038168
1203 Ga0265342_10058747
1204 Ga0265342_10069506
1205 Ga0265342_10085101
1206 Ga0316053_101140
1207 Ga0316212_1017762
1208 Ga0373954_0116407
1209 Ga0373957_0258981
1210 Ga0373955_0028996
1211 Ga0373955_0864742
1212 Ga0373931_0098718
1213 Ga0373935_1018702
1214 Ga0373933_0035547
1215 Ga0373933_0790788
1216 Ga0373937_0043808
1217 Ga0373937_0134727
1218 Ga0265778_025231
1219 Ga0373925_0282808
1220 Ga0395900_0156328
1221 Ga0395900_0636865
1222 Ga0395898_0218267
1223 Ga0395898_1187193
1224 Ga0395901_0759468
1225 Ga0395901_0929381
1226 Ga0436360_0142677
1227 Ga0436361_0789764
1228 Ga0436361_1143868
1229 Ga0436363_1390236
1230 Ga0451577_0360908
1231 Ga0466969_0121069
1232 Ga0453683_0825014
1233 Ga0466961_0044708
1234 Ga0466963_0187589
1235 Ga0453684_0151344
1236 Ga0466971_0135604
1237 Ga0466959_0238849
1238 Ga0466958_0274652
1239 Ga0466958_0378813
1240 Ga0466958_0930567
1241 Ga0466967_0000871
1242 Ga0466967_0476111
1243 Ga0466967_0560712
1244 Ga0495592_0300629
1245 Ga0495629_0033730
1246 Ga0495629_0251369
1247 Ga0495651_0187478
1248 Ga0495580_0086130
1249 Ga0495580_0357617
1250 Ga0495664_0016591
1251 Ga0495664_0099506
1252 Ga0495606_0152030
1253 Ga0495643_0008438
1254 Ga0495652_0017267
1255 Ga0495665_0094382
1256 Ga0495665_0148265
1257 Ga0495587_0091758
1258 Ga0495587_0160448
1259 Ga0495587_0205547
1260 Ga0495645_0000851
1261 Ga0495645_0004067
1262 Ga0495645_0259622
1263 Ga0495667_0407338
1264 Ga0495668_0196331
1265 Ga0495635_0310197
1266 Ga0495588_0554716
1267 Ga0495599_0268148
1268 Ga0495623_0183616
1269 Ga0495646_0087380
1270 Ga0495647_0250128
1271 Ga0495658_0143447
1272 Ga0495669_0074570
1273 Ga0495613_0120640
1274 Ga0495613_0170750
1275 Ga0495649_0209536
1276 Ga0495600_0013179
1277 Ga0495600_0035008
1278 Ga0495600_0518669
1279 Ga0495604_0023379
1280 Ga0495604_0622195
1281 Ga0495674_1025142
1282 Ga0495680_0611796
1283 Ga0495687_061375
1284 Ga0495675_0611588
1285 Ga0495679_184635
1286 Ga0495684_0543379
1287 Ga0495602_0153560
1288 Ga0495602_0153583
1289 Ga0495602_0160872
1290 Ga0495602_0298344
1291 Ga0496100_0006877
1292 Ga0496100_0201471
1293 Ga0496100_0623108
1294 Ga0496100_1083413
1295 Ga0496101_0040914
1296 Ga0496104_0023520
1297 Ga0496104_0224458
1298 Ga0496104_0268862
1299 Ga0496104_1058448
1300 Ga0496105_0033315
1301 Ga0496105_0313877
1302 Ga0496105_0328160
1303 Ga0496106_0686848
1304 Ga0496107_0015330
1305 Ga0496108_0123375
1306 Ga0496108_1066578
1307 Ga0496109_0069772
1308 Ga0496110_0234798
1309 Ga0496111_0072169
1310 Ga0496112_0121928
1311 Ga0496112_0585561
1312 Ga0496113_0253422
1313 Ga0496114_0005695
1314 Ga0496114_0296303
1315 Ga0496115_0023844
1316 Ga0496115_0154171
1317 Ga0496115_0269720
1318 Ga0496115_0431031
1319 Ga0496118_0215470
1320 Ga0496119_0170540
1321 Ga0496126_0001522
1322 Ga0496126_0019634
1323 Ga0496126_0185187
1324 Ga0495682_0148677
1325 Ga0495601_0253612
1326 Ga0495619_0089378
1327 Ga0495619_0352281
1328 Ga0500644_0030343
1329 Ga0500595_032198
1330 Ga0587093_052592
1331 Ga0587085_013311
1332 Ga0587091_045131
1333 Ga0587092_014861
1334 Ga0587094_017734
1335 Ga0587101_019722
1336 Ga0587109_033136
1337 Ga0587117_017967
1338 Ga0587068_024958
1339 Ga0587114_017560
1340 Ga0466962_0380729

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13581

HATPase_c_2

Histidine kinase-like ATPase domain

13

141

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9437 11 148
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9346 11 148
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9279 11 148
6m36-assembly2.cif.gz_K the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9193 11 148
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9174 11 148
ID Description Score Start End Superfamily
af_P9WLZ7_398_539_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8284 11 152 3.30.565.10
af_P9WGX7_40_164_3.90.1100.10 Alpha Beta;Alpha-Beta Complex;Rna Polymerase Beta Subunit; Chain: C,domain 2; 0.8048 13 146 3.90.1100.10
af_K7LNG1_19_256_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.804 70 93 2.70.98.10
3ke6B02 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8015 11 152 3.30.565.10
af_P71568_133_255_3.30.565.10 Alpha Beta;2-Layer Sandwich;Heat Shock Protein 90;Histidine kinase-like ATPase, C-terminal domain 0.8009 11 146 3.30.565.10
ID Description Score Start End GO Terms
AF-W0Z7V5-F1-model_v4 Protein serine phosphatase with GAF(S) sensor(S) 0.9325 12 148 GO:0016791
AF-A0A3A0BSI1-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9006 11 148
AF-A0A2G9SML9-F1-model_v4 ATPase 0.9002 10 146 GO:0004674
AF-A0A2N0VH87-F1-model_v4 ATP-binding protein 0.8995 9 147 GO:0004674
GO:0005524
AF-A0A7C4IWZ6-F1-model_v4 ATP-binding protein 0.8994 12 148 GO:0004674
GO:0005524

Map