F473975

General Info

Members Datasets Scaffolds Average Seq Length
669 319 1338 148

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100627950|Ga0070667_1006279502
Length 146
Sequence MELKDLYRDVILDHNRQPRNFGHLDNANAHAEGHNPLCGDRLSLDLQLTGDRIEDVRFEGKGCAISTASASMMTEAIKGKDRAAIGALFEKVHRLLTQNDAAPPDLGKLAALSGVREFPMRVKCATLCWHTLNAALERRAEPVSTE

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
171 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
199 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
200 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
227 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
293 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
297 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
298 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
299 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
300 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
301 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
302 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
303 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
304 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
305 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
308 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
311 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
312 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
313 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
314 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
315 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
316 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 3.89
Rhizosphere 86.1
Stem 0
Stem Tuber 0
Unclassified 2.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100627950 3300005367 Bacteria 991
2 JGI25406J46586_10013552 3300003203 Bacteria 3496
3 rootH1_10143354 3300003316 Bacteria 4972
4 rootH2_10216046 3300003320 Bacteria 1249
5 rootL2_10088425 3300003322 Bacteria 1801
6 Ga0058863_11431873 3300004799 Bacteria 1190
7 Ga0065704_10246285 3300005289 Bacteria 1001
8 Ga0065707_10081719 3300005295 Bacteria 66042
9 Ga0070658_10506725 3300005327 Bacteria 1043
10 Ga0070683_100158398 3300005329 Bacteria 2148
11 Ga0070690_100209384 3300005330 Bacteria 1360
12 Ga0070670_100120106 3300005331 Bacteria 2267
13 Ga0070666_10005349 3300005335 Bacteria 7871
14 Ga0070666_10954754 3300005335 Bacteria 635
15 Ga0070680_100010388 3300005336 Bacteria 7177
16 Ga0070680_100017610 3300005336 Bacteria 5635
17 Ga0070680_100049692 3300005336 Bacteria 3419
18 Ga0070680_100052652 3300005336 Bacteria 3322
19 Ga0070680_100704612 3300005336 Bacteria 869
20 Ga0070682_100348589 3300005337 Bacteria 1103
21 Ga0068868_100051168 3300005338 Bacteria 3247
22 Ga0070660_100365285 3300005339 Bacteria 1190
23 Ga0070689_101303010 3300005340 Bacteria 654
24 Ga0070661_100691849 3300005344 Bacteria 830
25 Ga0070692_11140622 3300005345 Bacteria 552
26 Ga0070669_100672659 3300005353 Bacteria 872
27 Ga0070671_100114226 3300005355 Bacteria 2270
28 Ga0070671_100199106 3300005355 Bacteria 1698
29 Ga0070671_100372176 3300005355 Bacteria 1220
30 Ga0070671_100449494 3300005355 Bacteria 1106
31 Ga0070674_100112301 3300005356 Bacteria 2003
32 Ga0070659_100291479 3300005366 Bacteria 1359
33 Ga0070667_100037632 3300005367 Bacteria 4056
34 Ga0070667_100078164 3300005367 Bacteria 2826
35 Ga0070709_10010617 3300005434 Bacteria 5106
36 Ga0070709_10030825 3300005434 Bacteria 3221
37 Ga0070709_10166978 3300005434 Bacteria 1535
38 Ga0070709_10428240 3300005434 Bacteria 993
39 Ga0070709_10904484 3300005434 Bacteria 698
40 Ga0070714_100059010 3300005435 Bacteria 3289
41 Ga0070714_100214842 3300005435 Bacteria 1765
42 Ga0070714_100405990 3300005435 Bacteria 1289
43 Ga0070713_100014093 3300005436 Bacteria 5921
44 Ga0070713_100043569 3300005436 Bacteria 3669
45 Ga0070713_100081606 3300005436 Bacteria 2759
46 Ga0070713_100270302 3300005436 Bacteria 1556
47 Ga0070713_101268789 3300005436 Unclassified 714
48 Ga0070713_101400692 3300005436 Bacteria 678
49 Ga0070710_10237739 3300005437 Bacteria 1166
50 Ga0070710_10420069 3300005437 Bacteria 900
51 Ga0070710_10427694 3300005437 Bacteria 893
52 Ga0070711_100000863 3300005439 Bacteria 15939
53 Ga0070711_100021128 3300005439 Bacteria 4205
54 Ga0070711_100260993 3300005439 Bacteria 1363
55 Ga0070711_100798664 3300005439 Bacteria 800
56 Ga0070711_101467461 3300005439 Bacteria 594
57 Ga0070705_100516685 3300005440 Bacteria 909
58 Ga0070663_100271888 3300005455 Bacteria 1347
59 Ga0070678_100027473 3300005456 Bacteria 3864
60 Ga0070662_100214477 3300005457 Bacteria 1533
61 Ga0070681_10001176 3300005458 Bacteria 22633
62 Ga0070681_10030784 3300005458 Bacteria 5386
63 Ga0070681_10032074 3300005458 Bacteria 5273
64 Ga0070681_10035252 3300005458 Bacteria 5026
65 Ga0070681_10048386 3300005458 Bacteria 4249
66 Ga0070681_10100889 3300005458 Bacteria 2832
67 Ga0070681_10109022 3300005458 Bacteria 2709
68 Ga0068867_101609341 3300005459 Unclassified 607
69 Ga0070685_10578911 3300005466 Bacteria 805
70 Ga0070685_11408227 3300005466 Bacteria 535
71 Ga0070706_101082096 3300005467 Bacteria 738
72 Ga0070706_101625585 3300005467 Bacteria 589
73 Ga0070698_100269352 3300005471 Bacteria 1635
74 Ga0070699_100053614 3300005518 Bacteria 3490
75 Ga0070699_100056432 3300005518 Bacteria 3401
76 Ga0070679_100001010 3300005530 Bacteria 24545
77 Ga0070679_100063699 3300005530 Bacteria 3675
78 Ga0070679_100076024 3300005530 Bacteria 3348
79 Ga0070679_100089262 3300005530 Bacteria 3070
80 Ga0070679_100093745 3300005530 Bacteria 2990
81 Ga0070679_100155054 3300005530 Bacteria 2265
82 Ga0070679_101117402 3300005530 Bacteria 733
83 Ga0070684_100082605 3300005535 Bacteria 2845
84 Ga0070684_100789398 3300005535 Bacteria 887
85 Ga0068853_102288129 3300005539 Unclassified 524
86 Ga0070672_100194587 3300005543 Bacteria 1694
87 Ga0070686_100012385 3300005544 Bacteria 4856
88 Ga0070696_100244816 3300005546 Bacteria 1354
89 Ga0070696_100666080 3300005546 Bacteria 845
90 Ga0070693_100091455 3300005547 Bacteria 1835
91 Ga0070665_100001170 3300005548 Bacteria 32187
92 Ga0070665_100004552 3300005548 Bacteria 14531
93 Ga0070665_100030339 3300005548 Bacteria 5442
94 Ga0070665_100033649 3300005548 Bacteria 5156
95 Ga0070665_100036498 3300005548 Bacteria 4944
96 Ga0070665_100118131 3300005548 Bacteria 2654
97 Ga0068855_100000938 3300005563 Bacteria 36318
98 Ga0068855_100003091 3300005563 Bacteria 20379
99 Ga0068855_100052235 3300005563 Bacteria 4812
100 Ga0068855_100059546 3300005563 Bacteria 4468
101 Ga0068855_100148848 3300005563 Bacteria 2663
102 Ga0068855_100531456 3300005563 Bacteria 1275
103 Ga0068855_100692818 3300005563 Bacteria 1091
104 Ga0070664_100335541 3300005564 Bacteria 1372
105 Ga0070664_101032104 3300005564 Bacteria 773
106 Ga0070664_101619584 3300005564 Bacteria 613
107 Ga0068854_100467227 3300005578 Bacteria 1057
108 Ga0068854_100498623 3300005578 Bacteria 1025
109 Ga0068856_100008903 3300005614 Bacteria 9764
110 Ga0068856_100019165 3300005614 Bacteria 6642
111 Ga0068856_100114476 3300005614 Bacteria 2696
112 Ga0068856_100512237 3300005614 Bacteria 1221
113 Ga0068856_101309319 3300005614 Bacteria 740
114 Ga0068852_100210901 3300005616 Bacteria 1842
115 Ga0068859_100000879 3300005617 Bacteria 30647
116 Ga0068859_100047348 3300005617 Bacteria 4320
117 Ga0068859_100187719 3300005617 Bacteria 2151
118 Ga0068859_100230287 3300005617 Bacteria 1941
119 Ga0068859_101091788 3300005617 Bacteria 878
120 Ga0068864_100192324 3300005618 Bacteria 1871
121 Ga0068864_100836777 3300005618 Bacteria 906
122 Ga0068864_101715570 3300005618 Bacteria 633
123 Ga0068866_10048712 3300005718 Bacteria 2143
124 Ga0068861_100023309 3300005719 Bacteria 4464
125 Ga0068863_100061262 3300005841 Bacteria 3557
126 Ga0068863_100726409 3300005841 Bacteria 988
127 Ga0068863_101301480 3300005841 Bacteria 734
128 Ga0068863_101485546 3300005841 Bacteria 686
129 Ga0068858_100000605 3300005842 Bacteria 37465
130 Ga0068858_100002827 3300005842 Bacteria 17443
131 Ga0068858_100023461 3300005842 Bacteria 5746
132 Ga0068858_100024226 3300005842 Bacteria 5656
133 Ga0068858_100401712 3300005842 Bacteria 1317
134 Ga0068858_101002819 3300005842 Bacteria 818
135 Ga0068860_100001307 3300005843 Bacteria 27083
136 Ga0068860_100016246 3300005843 Bacteria 7257
137 Ga0068860_100022285 3300005843 Bacteria 6130
138 Ga0068860_102217438 3300005843 Bacteria 570
139 Ga0068862_100067243 3300005844 Bacteria 3089
140 Ga0068862_100428416 3300005844 Bacteria 1243
141 Ga0068862_100709226 3300005844 Bacteria 975
142 Ga0068862_100733630 3300005844 Bacteria 960
143 Ga0081455_10000043 3300005937 Bacteria 132283
144 Ga0081539_10000046 3300005985 Bacteria 275677
145 Ga0070717_10003444 3300006028 Bacteria 11322
146 Ga0070717_11074172 3300006028 Bacteria 733
147 Ga0070715_10006734 3300006163 Bacteria 3924
148 Ga0070716_100040483 3300006173 Bacteria 2592
149 Ga0070716_100209630 3300006173 Bacteria 1301
150 Ga0070712_100010853 3300006175 Bacteria 5761
151 Ga0070712_100135538 3300006175 Bacteria 1872
152 Ga0070712_100160603 3300006175 Bacteria 1735
153 Ga0097621_100012516 3300006237 Bacteria 6294
154 Ga0097621_100641328 3300006237 Bacteria 974
155 Ga0097621_101947016 3300006237 Bacteria 561
156 Ga0075428_100019755 3300006844 Bacteria 7455
157 Ga0075431_101073498 3300006847 Bacteria 770
158 Ga0075434_100298537 3300006871 Bacteria 1631
159 Ga0068865_100069115 3300006881 Bacteria 2499
160 Ga0068865_101260030 3300006881 Bacteria 656
161 Ga0097620_100000879 3300006931 Bacteria 30647
162 Ga0097620_100047348 3300006931 Bacteria 4320
163 Ga0097620_100187726 3300006931 Bacteria 2151
164 Ga0097620_100230301 3300006931 Bacteria 1941
165 Ga0097620_101091805 3300006931 Bacteria 878
166 Ga0075435_100092840 3300007076 Bacteria 2493
167 Ga0099795_10000008 3300007788 Bacteria 103465
168 Ga0105240_10003890 3300009093 Bacteria 23061
169 Ga0105240_10010497 3300009093 Bacteria 13020
170 Ga0105240_10012720 3300009093 Bacteria 11600
171 Ga0105240_10032513 3300009093 Bacteria 6754
172 Ga0105240_10058205 3300009093 Bacteria 4825
173 Ga0105240_10100434 3300009093 Bacteria 3521
174 Ga0105240_10166088 3300009093 Bacteria 2618
175 Ga0105240_10247773 3300009093 Bacteria 2062
176 Ga0105240_10349987 3300009093 Bacteria 1676
177 Ga0105240_10919035 3300009093 Unclassified 940
178 Ga0111539_10506580 3300009094 Bacteria 1406
179 Ga0105245_10029049 3300009098 Bacteria 4882
180 Ga0105245_10955161 3300009098 Bacteria 900
181 Ga0105247_10001482 3300009101 Bacteria 16878
182 Ga0105247_10007060 3300009101 Bacteria 6907
183 Ga0105247_10173970 3300009101 Bacteria 1433
184 Ga0105241_10390501 3300009174 Bacteria 1218
185 Ga0105242_10002115 3300009176 Bacteria 15662
186 Ga0105242_11640759 3300009176 Bacteria 678
187 Ga0105248_10024570 3300009177 Bacteria 6700
188 Ga0105248_10087140 3300009177 Bacteria 3514
189 Ga0105248_10195389 3300009177 Bacteria 2279
190 Ga0105237_10058308 3300009545 Bacteria 3864
191 Ga0105237_10081666 3300009545 Bacteria 3223
192 Ga0105237_10153339 3300009545 Bacteria 2300
193 Ga0105237_10204961 3300009545 Bacteria 1972
194 Ga0105237_10281769 3300009545 Bacteria 1665
195 Ga0105237_10461678 3300009545 Bacteria 1276
196 Ga0105238_10012968 3300009551 Bacteria 8414
197 Ga0105238_10034479 3300009551 Bacteria 5150
198 Ga0105238_10100433 3300009551 Bacteria 2877
199 Ga0105238_10277315 3300009551 Bacteria 1657
200 Ga0105238_10760886 3300009551 Bacteria 983
201 Ga0105238_11014486 3300009551 Bacteria 851
202 Ga0105238_11159589 3300009551 Bacteria 796
203 Ga0105238_11301960 3300009551 Bacteria 753
204 Ga0105249_10034981 3300009553 Bacteria 4554
205 Ga0105249_10067185 3300009553 Bacteria 3302
206 Ga0099796_10000012 3300010159 Bacteria 55750
207 Ga0099796_10062828 3300010159 Bacteria 1321
208 Ga0105239_10064017 3300010375 Bacteria 4037
209 Ga0105239_11624588 3300010375 Bacteria 748
210 Ga0105246_10298596 3300011119 Bacteria 1299
211 Ga0157371_11160507 3300013102 Unclassified 594
212 Ga0157370_10093578 3300013104 Bacteria 2820
213 Ga0157370_10160687 3300013104 Bacteria 2090
214 Ga0157370_11072555 3300013104 Bacteria 728
215 Ga0157369_10005109 3300013105 Bacteria 15362
216 Ga0157369_10019273 3300013105 Bacteria 7632
217 Ga0157369_10042121 3300013105 Bacteria 4982
218 Ga0157369_10110025 3300013105 Bacteria 2929
219 Ga0157369_10227418 3300013105 Bacteria 1951
220 Ga0157369_11960759 3300013105 Unclassified 594
221 Ga0157374_10374918 3300013296 Bacteria 1417
222 Ga0157378_10106826 3300013297 Bacteria 2561
223 Ga0157378_10826882 3300013297 Bacteria 953
224 Ga0163162_10035528 3300013306 Bacteria 4964
225 Ga0163162_10122937 3300013306 Bacteria 2700
226 Ga0157372_10115907 3300013307 Bacteria 3072
227 Ga0157372_10144268 3300013307 Bacteria 2745
228 Ga0157372_10152888 3300013307 Bacteria 2664
229 Ga0157372_10370554 3300013307 Bacteria 1669
230 Ga0157372_10589120 3300013307 Bacteria 1296
231 Ga0157372_11011921 3300013307 Bacteria 962
232 Ga0157375_10075499 3300013308 Bacteria 3395
233 Ga0157375_10853110 3300013308 Bacteria 1057
234 Ga0163163_10101667 3300014325 Bacteria 2897
235 Ga0163163_10168777 3300014325 Bacteria 2235
236 Ga0163163_10168950 3300014325 Bacteria 2233
237 Ga0163163_10243348 3300014325 Bacteria 1849
238 Ga0163163_10290786 3300014325 Bacteria 1686
239 Ga0163163_10386548 3300014325 Bacteria 1457
240 Ga0157379_10035741 3300014968 Bacteria 4430
241 Ga0157379_10073996 3300014968 Bacteria 3049
242 Ga0157379_10146585 3300014968 Bacteria 2129
243 Ga0157379_10197713 3300014968 Bacteria 1817
244 Ga0157379_10199207 3300014968 Bacteria 1810
245 Ga0157379_10343518 3300014968 Bacteria 1365
246 Ga0157379_10420204 3300014968 Bacteria 1231
247 Ga0157376_10217809 3300014969 Bacteria 1766
248 Ga0157376_10365840 3300014969 Bacteria 1384
249 Ga0182007_10169915 3300015262 Bacteria 749
250 Ga0206356_11619338 3300020070 Bacteria 817
251 Ga0206352_11238856 3300020078 Bacteria 1052
252 Ga0213874_10011423 3300021377 Bacteria 2249
253 Ga0213876_10078398 3300021384 Bacteria 1746
254 Ga0224712_10015484 3300022467 Bacteria 2482
255 Ga0224712_10032284 3300022467 Bacteria 1907
256 Ga0207653_10065927 3300025885 Bacteria 1230
257 Ga0207642_10031174 3300025899 Bacteria 2230
258 Ga0207710_10000406 3300025900 Bacteria 28648
259 Ga0207710_10029999 3300025900 Bacteria 2370
260 Ga0207710_10031041 3300025900 Bacteria 2334
261 Ga0207680_10022659 3300025903 Bacteria 3419
262 Ga0207699_10193023 3300025906 Bacteria 1375
263 Ga0207699_10304816 3300025906 Bacteria 1113
264 Ga0207699_10498691 3300025906 Bacteria 879
265 Ga0207699_11130990 3300025906 Unclassified 580
266 Ga0207705_10510686 3300025909 Bacteria 934
267 Ga0207684_10938549 3300025910 Bacteria 726
268 Ga0207654_10171309 3300025911 Bacteria 1410
269 Ga0207654_10540464 3300025911 Bacteria 827
270 Ga0207707_10000560 3300025912 Bacteria 37696
271 Ga0207707_10010731 3300025912 Bacteria 7960
272 Ga0207707_10087848 3300025912 Bacteria 2716
273 Ga0207707_10088074 3300025912 Bacteria 2712
274 Ga0207707_10089947 3300025912 Bacteria 2683
275 Ga0207707_10230820 3300025912 Bacteria 1610
276 Ga0207707_10304440 3300025912 Bacteria 1378
277 Ga0207707_10380583 3300025912 Bacteria 1213
278 Ga0207695_10021422 3300025913 Bacteria 7373
279 Ga0207695_10030146 3300025913 Bacteria 5976
280 Ga0207695_10037702 3300025913 Bacteria 5214
281 Ga0207695_10075435 3300025913 Bacteria 3431
282 Ga0207695_10150903 3300025913 Bacteria 2263
283 Ga0207695_10210386 3300025913 Bacteria 1856
284 Ga0207695_10392561 3300025913 Bacteria 1272
285 Ga0207695_10522726 3300025913 Bacteria 1068
286 Ga0207695_11123560 3300025913 Unclassified 666
287 Ga0207695_11272557 3300025913 Bacteria 616
288 Ga0207671_10054421 3300025914 Bacteria 2965
289 Ga0207671_10184974 3300025914 Bacteria 1622
290 Ga0207671_10215225 3300025914 Bacteria 1504
291 Ga0207671_10352167 3300025914 Bacteria 1168
292 Ga0207671_10920696 3300025914 Unclassified 691
293 Ga0207693_10000490 3300025915 Bacteria 35741
294 Ga0207693_10179415 3300025915 Bacteria 1666
295 Ga0207663_10075852 3300025916 Bacteria 2183
296 Ga0207663_10079728 3300025916 Bacteria 2139
297 Ga0207663_10101785 3300025916 Bacteria 1931
298 Ga0207663_10234224 3300025916 Bacteria 1343
299 Ga0207660_10001954 3300025917 Bacteria 13746
300 Ga0207660_10007435 3300025917 Bacteria 7088
301 Ga0207660_10055890 3300025917 Bacteria 2822
302 Ga0207660_10172088 3300025917 Bacteria 1677
303 Ga0207660_10240797 3300025917 Bacteria 1425
304 Ga0207657_10192817 3300025919 Bacteria 1643
305 Ga0207652_10038114 3300025921 Bacteria 4072
306 Ga0207652_10050236 3300025921 Bacteria 3572
307 Ga0207652_10175818 3300025921 Bacteria 1923
308 Ga0207652_10455596 3300025921 Bacteria 1153
309 Ga0207652_10735232 3300025921 Bacteria 879
310 Ga0207652_11635356 3300025921 Bacteria 548
311 Ga0207681_10779359 3300025923 Bacteria 798
312 Ga0207694_10072163 3300025924 Bacteria 2699
313 Ga0207694_10234536 3300025924 Bacteria 1499
314 Ga0207694_10358987 3300025924 Bacteria 1207
315 Ga0207694_10913621 3300025924 Bacteria 742
316 Ga0207650_10206865 3300025925 Bacteria 1574
317 Ga0207687_10052461 3300025927 Bacteria 2846
318 Ga0207700_10012813 3300025928 Bacteria 5423
319 Ga0207700_10020996 3300025928 Bacteria 4449
320 Ga0207700_10148492 3300025928 Bacteria 1935
321 Ga0207700_10275422 3300025928 Bacteria 1446
322 Ga0207700_10283114 3300025928 Bacteria 1427
323 Ga0207700_10467345 3300025928 Bacteria 1113
324 Ga0207700_10778562 3300025928 Bacteria 855
325 Ga0207700_10801534 3300025928 Unclassified 842
326 Ga0207664_10001080 3300025929 Bacteria 18189
327 Ga0207664_10348927 3300025929 Bacteria 1309
328 Ga0207644_10000879 3300025931 Bacteria 18950
329 Ga0207644_10023943 3300025931 Bacteria 4187
330 Ga0207690_10234748 3300025932 Bacteria 1410
331 Ga0207686_10814976 3300025934 Bacteria 749
332 Ga0207665_10013024 3300025939 Bacteria 5465
333 Ga0207665_10055641 3300025939 Bacteria 2670
334 Ga0207665_10417632 3300025939 Bacteria 1024
335 Ga0207711_10035105 3300025941 Bacteria 4249
336 Ga0207689_10075157 3300025942 Bacteria 2777
337 Ga0207661_10046934 3300025944 Bacteria 3427
338 Ga0207661_10135485 3300025944 Bacteria 2114
339 Ga0207679_10882134 3300025945 Unclassified 818
340 Ga0207679_10906153 3300025945 Bacteria 806
341 Ga0207667_10013743 3300025949 Bacteria 9252
342 Ga0207667_10041639 3300025949 Bacteria 4884
343 Ga0207667_10127768 3300025949 Bacteria 2618
344 Ga0207667_10347565 3300025949 Bacteria 1513
345 Ga0207651_10308876 3300025960 Bacteria 1318
346 Ga0207712_10067572 3300025961 Bacteria 2559
347 Ga0207712_10197261 3300025961 Bacteria 1593
348 Ga0207712_11013680 3300025961 Bacteria 737
349 Ga0207712_11429811 3300025961 Unclassified 619
350 Ga0207640_10095079 3300025981 Bacteria 2074
351 Ga0207640_10793292 3300025981 Bacteria 820
352 Ga0207658_10002301 3300025986 Bacteria 14098
353 Ga0207658_10041550 3300025986 Bacteria 3330
354 Ga0207658_11305775 3300025986 Bacteria 663
355 Ga0207677_10034073 3300026023 Bacteria 3294
356 Ga0207703_10001200 3300026035 Bacteria 24281
357 Ga0207703_10004718 3300026035 Bacteria 11123
358 Ga0207639_10412371 3300026041 Bacteria 1219
359 Ga0207639_10449985 3300026041 Bacteria 1169
360 Ga0207639_10561703 3300026041 Bacteria 1049
361 Ga0207678_10132167 3300026067 Bacteria 2130
362 Ga0207708_11111570 3300026075 Bacteria 689
363 Ga0207702_10039166 3300026078 Bacteria 3971
364 Ga0207702_10122175 3300026078 Bacteria 2332
365 Ga0207702_10336019 3300026078 Bacteria 1442
366 Ga0207702_10420201 3300026078 Bacteria 1293
367 Ga0207641_10000078 3300026088 Bacteria 143842
368 Ga0207641_10235439 3300026088 Bacteria 1704
369 Ga0207641_11168522 3300026088 Bacteria 769
370 Ga0207648_10571273 3300026089 Bacteria 1040
371 Ga0207676_10421689 3300026095 Bacteria 1252
372 Ga0207676_10829734 3300026095 Bacteria 903
373 Ga0207674_10217320 3300026116 Bacteria 1860
374 Ga0207675_100037145 3300026118 Bacteria 4544
375 Ga0207675_100715361 3300026118 Bacteria 1011
376 Ga0207683_10020295 3300026121 Bacteria 5682
377 Ga0207698_10292612 3300026142 Bacteria 1512
378 Ga0207698_10693786 3300026142 Bacteria 1012
379 Ga0207698_11472512 3300026142 Bacteria 696
380 Ga0209179_1000019 3300027512 Bacteria 46022
381 Ga0209974_10325714 3300027876 Unclassified 592
382 Ga0268266_10000944 3300028379 Bacteria 37085
383 Ga0268266_10002450 3300028379 Bacteria 19896
384 Ga0268266_10026244 3300028379 Bacteria 4957
385 Ga0268266_10091500 3300028379 Bacteria 2667
386 Ga0268266_10099733 3300028379 Bacteria 2557
387 Ga0268266_10121014 3300028379 Bacteria 2329
388 Ga0268266_10344423 3300028379 Bacteria 1399
389 Ga0268266_10453850 3300028379 Bacteria 1219
390 Ga0268265_10005388 3300028380 Bacteria 8760
391 Ga0268265_10254903 3300028380 Bacteria 1557
392 Ga0268265_10788083 3300028380 Bacteria 925
393 Ga0268265_11170587 3300028380 Bacteria 765
394 Ga0268264_10000142 3300028381 Bacteria 170046
395 Ga0268264_10119476 3300028381 Bacteria 2321
396 Ga0268264_10620447 3300028381 Bacteria 1067
397 Ga0268264_10994234 3300028381 Bacteria 845
398 Ga0265334_10011060 3300028573 Bacteria 3806
399 Ga0265334_10021856 3300028573 Bacteria 2611
400 Ga0307515_10003654 3300028794 Bacteria 32330
401 Ga0265338_10031565 3300028800 Bacteria 5191
402 Ga0307511_10075520 3300030521 Bacteria 2418
403 Ga0265762_1059650 3300030760 Bacteria 782
404 Ga0265328_10017594 3300031239 Bacteria 2767
405 Ga0265340_10004281 3300031247 Bacteria 8002
406 Ga0265340_10005757 3300031247 Bacteria 6851
407 Ga0265331_10006288 3300031250 Bacteria 7039
408 Ga0265331_10040882 3300031250 Bacteria 2255
409 Ga0265331_10084915 3300031250 Bacteria 1467
410 Ga0265316_10089207 3300031344 Bacteria 2354
411 Ga0307513_10070076 3300031456 Bacteria 3667
412 Ga0307513_10079686 3300031456 Bacteria 3382
413 Ga0307513_10184655 3300031456 Bacteria 1944
414 Ga0307513_10311896 3300031456 Bacteria 1335
415 Ga0307513_10634375 3300031456 Bacteria 776
416 Ga0307513_10985400 3300031456 Unclassified 552
417 Ga0307509_10414836 3300031507 Bacteria 1049
418 Ga0307408_100176769 3300031548 Bacteria 1708
419 Ga0265313_10017177 3300031595 Bacteria 4123
420 Ga0265313_10235116 3300031595 Bacteria 752
421 Ga0316575_10049494 3300031665 Bacteria 1672
422 Ga0265342_10316309 3300031712 Bacteria 819
423 Ga0316576_10141369 3300031727 Bacteria 1812
424 Ga0307516_10547700 3300031730 Bacteria 811
425 Ga0307405_11576002 3300031731 Bacteria 579
426 Ga0307416_101019157 3300032002 Bacteria 931
427 Ga0307507_10511452 3300033179 Bacteria 644
428 Ga0307510_10000001 3300033180 Bacteria 1172244
429 Ga0373952_0008884 3300035092 Bacteria 1912
430 Ga0373936_0003009 3300035113 Bacteria 6300
431 Ga0373956_0185159 3300035119 Bacteria 985
432 Ga0373957_0186952 3300035120 Bacteria 860
433 Ga0373957_0320862 3300035120 Bacteria 659
434 Ga0316574_0080926 3300035398 Bacteria 2062
435 Ga0316574_0314719 3300035398 Bacteria 994
436 Ga0373935_0033277 3300035692 Bacteria 3207
437 Ga0373927_0009292 3300035695 Bacteria 6594
438 Ga0373937_0004877 3300036401 Bacteria 11406
439 Ga0373937_0852440 3300036401 Bacteria 860
440 Ga0316584_0109296 3300036712 Bacteria 2069
441 Ga0373925_0064502 3300037068 Bacteria 2757
442 Ga0373925_0289680 3300037068 Bacteria 1320
443 Ga0373925_1299965 3300037068 Bacteria 597
444 Ga0395900_0141286 3300037418 Bacteria 2466
445 Ga0395900_1262334 3300037418 Bacteria 653
446 Ga0395898_0162506 3300037466 Bacteria 2136
447 Ga0436365_0690579 3300039437 Bacteria 2231
448 Ga0436365_0951707 3300039437 Bacteria 949
449 Ga0436365_1926158 3300039437 Bacteria 965
450 Ga0436360_0124026 3300039438 Bacteria 1266
451 Ga0436360_0188235 3300039438 Bacteria 1844
452 Ga0436360_0346915 3300039438 Bacteria 1080
453 Ga0436360_0417049 3300039438 Bacteria 530
454 Ga0436360_0526856 3300039438 Bacteria 3102
455 Ga0436361_0582572 3300039447 Bacteria 1425
456 Ga0436363_0232598 3300039450 Bacteria 6232
457 Ga0436363_0444330 3300039450 Bacteria 1865
458 Ga0436363_1452626 3300039450 Bacteria 7338
459 Ga0436362_0403837 3300039453 Bacteria 589
460 Ga0436362_0493766 3300039453 Bacteria 1797
461 Ga0451789_0406011 3300041443 Bacteria 1100
462 Ga0451853_3319715 3300041512 Bacteria 798
463 Ga0439435_0033952 3300042436 Bacteria 1400
464 Ga0439444_0006361 3300042437 Bacteria 1783
465 Ga0439460_0012529 3300042461 Bacteria 2203
466 Ga0451577_1823623 3300042876 Bacteria 533
467 Ga0466969_0001000 3300044656 Bacteria 15292
468 Ga0466969_0007147 3300044656 Bacteria 5945
469 Ga0466969_0266274 3300044656 Bacteria 776
470 Ga0466969_0451067 3300044656 Bacteria 585
471 Ga0466972_0037552 3300044658 Bacteria 2368
472 Ga0466966_0001686 3300044684 Bacteria 14259
473 Ga0466966_0062251 3300044684 Bacteria 2353
474 Ga0466966_0077020 3300044684 Bacteria 2082
475 Ga0466961_0007940 3300044693 Bacteria 6761
476 Ga0466963_0614593 3300044694 Unclassified 767
477 Ga0466964_0000201 3300044706 Bacteria 16769
478 Ga0453684_2050681 3300044712 Bacteria 575
479 Ga0466971_0000493 3300044719 Bacteria 15500
480 Ga0466968_0084243 3300044735 Bacteria 1401
481 Ga0466970_0001870 3300044765 Bacteria 10177
482 Ga0466957_0002612 3300044842 Bacteria 9710
483 Ga0466960_0144494 3300044901 Bacteria 1266
484 Ga0466959_0000647 3300045049 Bacteria 20303
485 Ga0466959_0000784 3300045049 Bacteria 18638
486 Ga0466959_0151760 3300045049 Bacteria 1633
487 Ga0466959_0243365 3300045049 Bacteria 1242
488 Ga0466959_0643578 3300045049 Bacteria 712
489 Ga0466958_0070944 3300045836 Bacteria 2133
490 Ga0495651_0143714 3300046462 Bacteria 1727
491 Ga0495580_0016882 3300046472 Bacteria 5472
492 Ga0495580_0025318 3300046472 Bacteria 4337
493 Ga0495580_0339285 3300046472 Bacteria 1019
494 Ga0495606_0336407 3300046507 Bacteria 806
495 Ga0495608_0233568 3300046511 Bacteria 1151
496 Ga0495628_0304880 3300046516 Bacteria 1178
497 Ga0495630_0122811 3300046517 Bacteria 1970
498 Ga0495630_0147932 3300046517 Bacteria 1787
499 Ga0495632_0053465 3300046519 Bacteria 1983
500 Ga0495665_0324262 3300046531 Bacteria 786
501 Ga0495645_0575432 3300046543 Unclassified 695
502 Ga0495668_0811614 3300046616 Bacteria 518
503 Ga0495611_0551280 3300046648 Bacteria 522
504 Ga0495625_0673356 3300046660 Bacteria 614
505 Ga0495657_0256596 3300046675 Bacteria 1051
506 Ga0495599_0111845 3300046678 Bacteria 1701
507 Ga0495599_0301578 3300046678 Bacteria 967
508 Ga0495623_0024829 3300046679 Bacteria 3861
509 Ga0495647_0222119 3300046681 Bacteria 834
510 Ga0495671_0185501 3300046692 Bacteria 1010
511 Ga0495649_0136967 3300046694 Bacteria 1290
512 Ga0495604_0230473 3300047317 Bacteria 1270
513 Ga0495674_0285353 3300047319 Bacteria 1351
514 Ga0495687_038552 3300047443 Bacteria 2120
515 Ga0495684_0450903 3300047471 Bacteria 894
516 Ga0495686_0069563 3300047472 Bacteria 2170
517 Ga0495602_0061956 3300048088 Bacteria 3248
518 Ga0495602_0534249 3300048088 Bacteria 815
519 Ga0496100_0024121 3300048903 Bacteria 3705
520 Ga0496101_0028257 3300048904 Bacteria 3914
521 Ga0496101_0092120 3300048904 Bacteria 2256
522 Ga0496101_0491943 3300048904 Bacteria 969
523 Ga0496102_0002855 3300048905 Bacteria 14677
524 Ga0496102_0007520 3300048905 Bacteria 9314
525 Ga0496102_0019402 3300048905 Bacteria 5989
526 Ga0496102_0103631 3300048905 Bacteria 2646
527 Ga0496102_0136670 3300048905 Bacteria 2297
528 Ga0496103_0048380 3300048906 Bacteria 2628
529 Ga0496104_0136572 3300048907 Bacteria 2356
530 Ga0496105_0817935 3300048908 Bacteria 707
531 Ga0496105_0954747 3300048908 Bacteria 643
532 Ga0496106_0214212 3300048909 Bacteria 1535
533 Ga0496108_0015543 3300048911 Bacteria 6208
534 Ga0496109_0016256 3300048912 Bacteria 6505
535 Ga0496110_0053351 3300048913 Bacteria 3554
536 Ga0496110_1856420 3300048913 Bacteria 513
537 Ga0496111_0938003 3300048914 Unclassified 622
538 Ga0496112_0020571 3300048915 Bacteria 6257
539 Ga0496112_0560940 3300048915 Bacteria 1076
540 Ga0496114_0250586 3300048917 Bacteria 1558
541 Ga0496115_0052366 3300048918 Bacteria 3274
542 Ga0496115_0496864 3300048918 Bacteria 981
543 Ga0496115_0696077 3300048918 Bacteria 799
544 Ga0496116_0008098 3300048919 Bacteria 9188
545 Ga0496117_0000244 3300048920 Bacteria 102831
546 Ga0496118_0000040 3300048921 Bacteria 304516
547 Ga0496119_0003551 3300048922 Bacteria 16094
548 Ga0496119_0039066 3300048922 Bacteria 3054
549 Ga0496119_0422651 3300048922 Bacteria 632
550 Ga0496120_0000599 3300048923 Bacteria 54598
551 Ga0496120_0008142 3300048923 Bacteria 7687
552 Ga0496121_0001468 3300048924 Bacteria 39712
553 Ga0496121_0023418 3300048924 Bacteria 5947
554 Ga0496124_0055077 3300048927 Bacteria 3363
555 Ga0496125_0000762 3300048928 Bacteria 52740
556 Ga0496125_0011233 3300048928 Bacteria 8976
557 Ga0496125_0017925 3300048928 Bacteria 6732
558 Ga0496125_0662762 3300048928 Bacteria 560
559 Ga0496126_0001892 3300048929 Bacteria 30204
560 Ga0496126_0203281 3300048929 Bacteria 1671
561 Ga0496126_0640697 3300048929 Bacteria 833
562 Ga0495682_0172291 3300049460 Bacteria 770
563 Ga0501032_0137994 3300049569 Bacteria 1607
564 Ga0501033_0174160 3300049570 Bacteria 1545
565 Ga0501033_0359573 3300049570 Bacteria 1019
566 Ga0501036_0047735 3300049572 Bacteria 3625
567 Ga0501036_0195673 3300049572 Bacteria 1701
568 Ga0501036_0359169 3300049572 Bacteria 1216
569 Ga0501036_0919436 3300049572 Bacteria 718
570 Ga0501037_0222149 3300049573 Bacteria 1329
571 Ga0501038_0140371 3300049574 Bacteria 1977
572 Ga0501039_0224291 3300049575 Bacteria 1477
573 Ga0501039_0407749 3300049575 Bacteria 1067
574 Ga0501040_0004538 3300049576 Bacteria 9013
575 Ga0501040_0013971 3300049576 Bacteria 5286
576 Ga0501041_0001879 3300049577 Bacteria 11771
577 Ga0501041_0006503 3300049577 Bacteria 6841
578 Ga0501041_0010013 3300049577 Bacteria 5586
579 Ga0501042_0000824 3300049578 Bacteria 17198
580 Ga0501042_0021355 3300049578 Bacteria 4511
581 Ga0501043_0113689 3300049579 Bacteria 2126
582 Ga0501046_0096865 3300049580 Bacteria 2266
583 Ga0501046_0195798 3300049580 Bacteria 1505
584 Ga0501048_0014816 3300049582 Bacteria 5767
585 Ga0501048_0420160 3300049582 Bacteria 956
586 Ga0501068_0047121 3300049584 Bacteria 2600
587 Ga0501068_0778161 3300049584 Unclassified 627
588 Ga0501069_0698056 3300049585 Bacteria 612
589 Ga0501070_0211933 3300049586 Bacteria 1590
590 Ga0501070_0254213 3300049586 Bacteria 1437
591 Ga0501070_0495465 3300049586 Bacteria 982
592 Ga0501071_0055549 3300049587 Bacteria 2858
593 Ga0501071_0105338 3300049587 Bacteria 2082
594 Ga0501071_0397194 3300049587 Bacteria 1052
595 Ga0501072_0077967 3300049588 Bacteria 2623
596 Ga0501072_0116567 3300049588 Bacteria 2127
597 Ga0501072_0116779 3300049588 Bacteria 2125
598 Ga0501073_0180546 3300049589 Bacteria 1461
599 Ga0501074_0180933 3300049590 Bacteria 1504
600 Ga0501075_0000077 3300049591 Bacteria 44211
601 Ga0501075_0021355 3300049591 Bacteria 4717
602 Ga0501075_0101645 3300049591 Bacteria 2183
603 Ga0501076_0003363 3300049592 Bacteria 11228
604 Ga0501076_0005086 3300049592 Bacteria 9414
605 Ga0501076_0044178 3300049592 Bacteria 3513
606 Ga0501077_0060366 3300049593 Bacteria 2407
607 Ga0501077_0108999 3300049593 Bacteria 1754
608 Ga0501079_0001289 3300049741 Bacteria 17637
609 Ga0501079_0024518 3300049741 Bacteria 4629
610 Ga0501079_0241232 3300049741 Bacteria 1412
611 Ga0501079_0446695 3300049741 Bacteria 1015
612 Ga0501080_0052894 3300049742 Bacteria 3780
613 Ga0501080_0091386 3300049742 Bacteria 2827
614 Ga0501080_0126430 3300049742 Bacteria 2368
615 Ga0501081_0001473 3300049743 Bacteria 14430
616 Ga0501081_0007979 3300049743 Bacteria 6870
617 Ga0501081_0023266 3300049743 Bacteria 4152
618 Ga0501081_0412648 3300049743 Bacteria 1000
619 Ga0501083_0079093 3300049744 Bacteria 2181
620 Ga0501083_0095812 3300049744 Bacteria 1958
621 Ga0501035_0164624 3300049822 Bacteria 1918
622 Ga0501035_0246796 3300049822 Bacteria 1517
623 Ga0501045_0009739 3300049824 Bacteria 6722
624 Ga0501045_0049229 3300049824 Bacteria 3072
625 Ga0501045_0221881 3300049824 Bacteria 1407
626 Ga0501045_0659056 3300049824 Bacteria 773
627 nmdc:mga0qj67_440320_c1 3300050509 Bacteria 1050
628 nmdc:mga0rr50_15245_c1 3300050513 Bacteria 5068
629 Ga0495601_0207907 3300053077 Bacteria 1279
630 Ga0495601_0402371 3300053077 Bacteria 888
631 Ga0495612_0045570 3300053078 Bacteria 1795
632 Ga0495619_0246891 3300053085 Bacteria 1237
633 Ga0500646_0370550 3300053090 Bacteria 525
634 Ga0500583_0040944 3300053092 Bacteria 2101
635 Ga0500583_0057850 3300053092 Bacteria 1822
636 Ga0500583_0104656 3300053092 Bacteria 1389
637 Ga0500641_0004062 3300053096 Bacteria 5167
638 Ga0500641_0058417 3300053096 Bacteria 1602
639 Ga0500641_0145283 3300053096 Bacteria 1025
640 Ga0500556_0001692 3300053104 Bacteria 8434
641 Ga0500569_082871 3300053109 Bacteria 1028
642 Ga0500614_006175 3300053123 Bacteria 2517
643 Ga0500617_035015 3300053124 Bacteria 2250
644 Ga0500642_0118001 3300053130 Bacteria 1240
645 Ga0500642_0298783 3300053130 Bacteria 727
646 Ga0500652_071632 3300053131 Bacteria 1437
647 Ga0500559_0106418 3300053136 Bacteria 1297
648 Ga0500577_0077009 3300053142 Bacteria 1322
649 Ga0500588_0010776 3300053146 Bacteria 2219
650 Ga0500616_0000130 3300053153 Bacteria 132948
651 Ga0500616_0006229 3300053153 Bacteria 7872
652 Ga0500619_266934 3300053154 Bacteria 560
653 Ga0500630_237297 3300053159 Bacteria 663
654 Ga0500636_0094057 3300053177 Bacteria 1713
655 Ga0500637_0053861 3300053178 Bacteria 2297
656 Ga0500637_0302641 3300053178 Bacteria 871
657 Ga0500611_001094 3300053727 Bacteria 2881
658 Ga0501084_0023006 3300054114 Bacteria 5202
659 Ga0501084_0029639 3300054114 Bacteria 4578
660 Ga0501084_0134270 3300054114 Bacteria 2083
661 Ga0590071_123028 3300059421 Bacteria 663
662 Ga0501082_0001270 3300060353 Bacteria 22170
663 Ga0501082_0012505 3300060353 Bacteria 7291
664 Ga0501082_0066973 3300060353 Bacteria 3092
665 Ga0501082_0227805 3300060353 Bacteria 1622
666 Ga0466962_0000251 3300061719 Bacteria 22568
667 Ga0530510_0001174 3300061734 Bacteria 17418
668 Ga0530510_0088996 3300061734 Bacteria 2251
669 Ga0530510_0470311 3300061734 Bacteria 951
670 Ga0070667_100627950
671 JGI25406J46586_10013552
672 rootH1_10143354
673 rootH2_10216046
674 rootL2_10088425
675 Ga0058863_11431873
676 Ga0065704_10246285
677 Ga0065707_10081719
678 Ga0070658_10506725
679 Ga0070683_100158398
680 Ga0070690_100209384
681 Ga0070670_100120106
682 Ga0070666_10005349
683 Ga0070666_10954754
684 Ga0070680_100010388
685 Ga0070680_100017610
686 Ga0070680_100049692
687 Ga0070680_100052652
688 Ga0070680_100704612
689 Ga0070682_100348589
690 Ga0068868_100051168
691 Ga0070660_100365285
692 Ga0070689_101303010
693 Ga0070661_100691849
694 Ga0070692_11140622
695 Ga0070669_100672659
696 Ga0070671_100114226
697 Ga0070671_100199106
698 Ga0070671_100372176
699 Ga0070671_100449494
700 Ga0070674_100112301
701 Ga0070659_100291479
702 Ga0070667_100037632
703 Ga0070667_100078164
704 Ga0070709_10010617
705 Ga0070709_10030825
706 Ga0070709_10166978
707 Ga0070709_10428240
708 Ga0070709_10904484
709 Ga0070714_100059010
710 Ga0070714_100214842
711 Ga0070714_100405990
712 Ga0070713_100014093
713 Ga0070713_100043569
714 Ga0070713_100081606
715 Ga0070713_100270302
716 Ga0070713_101268789
717 Ga0070713_101400692
718 Ga0070710_10237739
719 Ga0070710_10420069
720 Ga0070710_10427694
721 Ga0070711_100000863
722 Ga0070711_100021128
723 Ga0070711_100260993
724 Ga0070711_100798664
725 Ga0070711_101467461
726 Ga0070705_100516685
727 Ga0070663_100271888
728 Ga0070678_100027473
729 Ga0070662_100214477
730 Ga0070681_10001176
731 Ga0070681_10030784
732 Ga0070681_10032074
733 Ga0070681_10035252
734 Ga0070681_10048386
735 Ga0070681_10100889
736 Ga0070681_10109022
737 Ga0068867_101609341
738 Ga0070685_10578911
739 Ga0070685_11408227
740 Ga0070706_101082096
741 Ga0070706_101625585
742 Ga0070698_100269352
743 Ga0070699_100053614
744 Ga0070699_100056432
745 Ga0070679_100001010
746 Ga0070679_100063699
747 Ga0070679_100076024
748 Ga0070679_100089262
749 Ga0070679_100093745
750 Ga0070679_100155054
751 Ga0070679_101117402
752 Ga0070684_100082605
753 Ga0070684_100789398
754 Ga0068853_102288129
755 Ga0070672_100194587
756 Ga0070686_100012385
757 Ga0070696_100244816
758 Ga0070696_100666080
759 Ga0070693_100091455
760 Ga0070665_100001170
761 Ga0070665_100004552
762 Ga0070665_100030339
763 Ga0070665_100033649
764 Ga0070665_100036498
765 Ga0070665_100118131
766 Ga0068855_100000938
767 Ga0068855_100003091
768 Ga0068855_100052235
769 Ga0068855_100059546
770 Ga0068855_100148848
771 Ga0068855_100531456
772 Ga0068855_100692818
773 Ga0070664_100335541
774 Ga0070664_101032104
775 Ga0070664_101619584
776 Ga0068854_100467227
777 Ga0068854_100498623
778 Ga0068856_100008903
779 Ga0068856_100019165
780 Ga0068856_100114476
781 Ga0068856_100512237
782 Ga0068856_101309319
783 Ga0068852_100210901
784 Ga0068859_100000879
785 Ga0068859_100047348
786 Ga0068859_100187719
787 Ga0068859_100230287
788 Ga0068859_101091788
789 Ga0068864_100192324
790 Ga0068864_100836777
791 Ga0068864_101715570
792 Ga0068866_10048712
793 Ga0068861_100023309
794 Ga0068863_100061262
795 Ga0068863_100726409
796 Ga0068863_101301480
797 Ga0068863_101485546
798 Ga0068858_100000605
799 Ga0068858_100002827
800 Ga0068858_100023461
801 Ga0068858_100024226
802 Ga0068858_100401712
803 Ga0068858_101002819
804 Ga0068860_100001307
805 Ga0068860_100016246
806 Ga0068860_100022285
807 Ga0068860_102217438
808 Ga0068862_100067243
809 Ga0068862_100428416
810 Ga0068862_100709226
811 Ga0068862_100733630
812 Ga0081455_10000043
813 Ga0081539_10000046
814 Ga0070717_10003444
815 Ga0070717_11074172
816 Ga0070715_10006734
817 Ga0070716_100040483
818 Ga0070716_100209630
819 Ga0070712_100010853
820 Ga0070712_100135538
821 Ga0070712_100160603
822 Ga0097621_100012516
823 Ga0097621_100641328
824 Ga0097621_101947016
825 Ga0075428_100019755
826 Ga0075431_101073498
827 Ga0075434_100298537
828 Ga0068865_100069115
829 Ga0068865_101260030
830 Ga0097620_100000879
831 Ga0097620_100047348
832 Ga0097620_100187726
833 Ga0097620_100230301
834 Ga0097620_101091805
835 Ga0075435_100092840
836 Ga0099795_10000008
837 Ga0105240_10003890
838 Ga0105240_10010497
839 Ga0105240_10012720
840 Ga0105240_10032513
841 Ga0105240_10058205
842 Ga0105240_10100434
843 Ga0105240_10166088
844 Ga0105240_10247773
845 Ga0105240_10349987
846 Ga0105240_10919035
847 Ga0111539_10506580
848 Ga0105245_10029049
849 Ga0105245_10955161
850 Ga0105247_10001482
851 Ga0105247_10007060
852 Ga0105247_10173970
853 Ga0105241_10390501
854 Ga0105242_10002115
855 Ga0105242_11640759
856 Ga0105248_10024570
857 Ga0105248_10087140
858 Ga0105248_10195389
859 Ga0105237_10058308
860 Ga0105237_10081666
861 Ga0105237_10153339
862 Ga0105237_10204961
863 Ga0105237_10281769
864 Ga0105237_10461678
865 Ga0105238_10012968
866 Ga0105238_10034479
867 Ga0105238_10100433
868 Ga0105238_10277315
869 Ga0105238_10760886
870 Ga0105238_11014486
871 Ga0105238_11159589
872 Ga0105238_11301960
873 Ga0105249_10034981
874 Ga0105249_10067185
875 Ga0099796_10000012
876 Ga0099796_10062828
877 Ga0105239_10064017
878 Ga0105239_11624588
879 Ga0105246_10298596
880 Ga0157371_11160507
881 Ga0157370_10093578
882 Ga0157370_10160687
883 Ga0157370_11072555
884 Ga0157369_10005109
885 Ga0157369_10019273
886 Ga0157369_10042121
887 Ga0157369_10110025
888 Ga0157369_10227418
889 Ga0157369_11960759
890 Ga0157374_10374918
891 Ga0157378_10106826
892 Ga0157378_10826882
893 Ga0163162_10035528
894 Ga0163162_10122937
895 Ga0157372_10115907
896 Ga0157372_10144268
897 Ga0157372_10152888
898 Ga0157372_10370554
899 Ga0157372_10589120
900 Ga0157372_11011921
901 Ga0157375_10075499
902 Ga0157375_10853110
903 Ga0163163_10101667
904 Ga0163163_10168777
905 Ga0163163_10168950
906 Ga0163163_10243348
907 Ga0163163_10290786
908 Ga0163163_10386548
909 Ga0157379_10035741
910 Ga0157379_10073996
911 Ga0157379_10146585
912 Ga0157379_10197713
913 Ga0157379_10199207
914 Ga0157379_10343518
915 Ga0157379_10420204
916 Ga0157376_10217809
917 Ga0157376_10365840
918 Ga0182007_10169915
919 Ga0206356_11619338
920 Ga0206352_11238856
921 Ga0213874_10011423
922 Ga0213876_10078398
923 Ga0224712_10015484
924 Ga0224712_10032284
925 Ga0207653_10065927
926 Ga0207642_10031174
927 Ga0207710_10000406
928 Ga0207710_10029999
929 Ga0207710_10031041
930 Ga0207680_10022659
931 Ga0207699_10193023
932 Ga0207699_10304816
933 Ga0207699_10498691
934 Ga0207699_11130990
935 Ga0207705_10510686
936 Ga0207684_10938549
937 Ga0207654_10171309
938 Ga0207654_10540464
939 Ga0207707_10000560
940 Ga0207707_10010731
941 Ga0207707_10087848
942 Ga0207707_10088074
943 Ga0207707_10089947
944 Ga0207707_10230820
945 Ga0207707_10304440
946 Ga0207707_10380583
947 Ga0207695_10021422
948 Ga0207695_10030146
949 Ga0207695_10037702
950 Ga0207695_10075435
951 Ga0207695_10150903
952 Ga0207695_10210386
953 Ga0207695_10392561
954 Ga0207695_10522726
955 Ga0207695_11123560
956 Ga0207695_11272557
957 Ga0207671_10054421
958 Ga0207671_10184974
959 Ga0207671_10215225
960 Ga0207671_10352167
961 Ga0207671_10920696
962 Ga0207693_10000490
963 Ga0207693_10179415
964 Ga0207663_10075852
965 Ga0207663_10079728
966 Ga0207663_10101785
967 Ga0207663_10234224
968 Ga0207660_10001954
969 Ga0207660_10007435
970 Ga0207660_10055890
971 Ga0207660_10172088
972 Ga0207660_10240797
973 Ga0207657_10192817
974 Ga0207652_10038114
975 Ga0207652_10050236
976 Ga0207652_10175818
977 Ga0207652_10455596
978 Ga0207652_10735232
979 Ga0207652_11635356
980 Ga0207681_10779359
981 Ga0207694_10072163
982 Ga0207694_10234536
983 Ga0207694_10358987
984 Ga0207694_10913621
985 Ga0207650_10206865
986 Ga0207687_10052461
987 Ga0207700_10012813
988 Ga0207700_10020996
989 Ga0207700_10148492
990 Ga0207700_10275422
991 Ga0207700_10283114
992 Ga0207700_10467345
993 Ga0207700_10778562
994 Ga0207700_10801534
995 Ga0207664_10001080
996 Ga0207664_10348927
997 Ga0207644_10000879
998 Ga0207644_10023943
999 Ga0207690_10234748
1000 Ga0207686_10814976
1001 Ga0207665_10013024
1002 Ga0207665_10055641
1003 Ga0207665_10417632
1004 Ga0207711_10035105
1005 Ga0207689_10075157
1006 Ga0207661_10046934
1007 Ga0207661_10135485
1008 Ga0207679_10882134
1009 Ga0207679_10906153
1010 Ga0207667_10013743
1011 Ga0207667_10041639
1012 Ga0207667_10127768
1013 Ga0207667_10347565
1014 Ga0207651_10308876
1015 Ga0207712_10067572
1016 Ga0207712_10197261
1017 Ga0207712_11013680
1018 Ga0207712_11429811
1019 Ga0207640_10095079
1020 Ga0207640_10793292
1021 Ga0207658_10002301
1022 Ga0207658_10041550
1023 Ga0207658_11305775
1024 Ga0207677_10034073
1025 Ga0207703_10001200
1026 Ga0207703_10004718
1027 Ga0207639_10412371
1028 Ga0207639_10449985
1029 Ga0207639_10561703
1030 Ga0207678_10132167
1031 Ga0207708_11111570
1032 Ga0207702_10039166
1033 Ga0207702_10122175
1034 Ga0207702_10336019
1035 Ga0207702_10420201
1036 Ga0207641_10000078
1037 Ga0207641_10235439
1038 Ga0207641_11168522
1039 Ga0207648_10571273
1040 Ga0207676_10421689
1041 Ga0207676_10829734
1042 Ga0207674_10217320
1043 Ga0207675_100037145
1044 Ga0207675_100715361
1045 Ga0207683_10020295
1046 Ga0207698_10292612
1047 Ga0207698_10693786
1048 Ga0207698_11472512
1049 Ga0209179_1000019
1050 Ga0209974_10325714
1051 Ga0268266_10000944
1052 Ga0268266_10002450
1053 Ga0268266_10026244
1054 Ga0268266_10091500
1055 Ga0268266_10099733
1056 Ga0268266_10121014
1057 Ga0268266_10344423
1058 Ga0268266_10453850
1059 Ga0268265_10005388
1060 Ga0268265_10254903
1061 Ga0268265_10788083
1062 Ga0268265_11170587
1063 Ga0268264_10000142
1064 Ga0268264_10119476
1065 Ga0268264_10620447
1066 Ga0268264_10994234
1067 Ga0265334_10011060
1068 Ga0265334_10021856
1069 Ga0307515_10003654
1070 Ga0265338_10031565
1071 Ga0307511_10075520
1072 Ga0265762_1059650
1073 Ga0265328_10017594
1074 Ga0265340_10004281
1075 Ga0265340_10005757
1076 Ga0265331_10006288
1077 Ga0265331_10040882
1078 Ga0265331_10084915
1079 Ga0265316_10089207
1080 Ga0307513_10070076
1081 Ga0307513_10079686
1082 Ga0307513_10184655
1083 Ga0307513_10311896
1084 Ga0307513_10634375
1085 Ga0307513_10985400
1086 Ga0307509_10414836
1087 Ga0307408_100176769
1088 Ga0265313_10017177
1089 Ga0265313_10235116
1090 Ga0316575_10049494
1091 Ga0265342_10316309
1092 Ga0316576_10141369
1093 Ga0307516_10547700
1094 Ga0307405_11576002
1095 Ga0307416_101019157
1096 Ga0307507_10511452
1097 Ga0307510_10000001
1098 Ga0373952_0008884
1099 Ga0373936_0003009
1100 Ga0373956_0185159
1101 Ga0373957_0186952
1102 Ga0373957_0320862
1103 Ga0316574_0080926
1104 Ga0316574_0314719
1105 Ga0373935_0033277
1106 Ga0373927_0009292
1107 Ga0373937_0004877
1108 Ga0373937_0852440
1109 Ga0316584_0109296
1110 Ga0373925_0064502
1111 Ga0373925_0289680
1112 Ga0373925_1299965
1113 Ga0395900_0141286
1114 Ga0395900_1262334
1115 Ga0395898_0162506
1116 Ga0436365_0690579
1117 Ga0436365_0951707
1118 Ga0436365_1926158
1119 Ga0436360_0124026
1120 Ga0436360_0188235
1121 Ga0436360_0346915
1122 Ga0436360_0417049
1123 Ga0436360_0526856
1124 Ga0436361_0582572
1125 Ga0436363_0232598
1126 Ga0436363_0444330
1127 Ga0436363_1452626
1128 Ga0436362_0403837
1129 Ga0436362_0493766
1130 Ga0451789_0406011
1131 Ga0451853_3319715
1132 Ga0439435_0033952
1133 Ga0439444_0006361
1134 Ga0439460_0012529
1135 Ga0451577_1823623
1136 Ga0466969_0001000
1137 Ga0466969_0007147
1138 Ga0466969_0266274
1139 Ga0466969_0451067
1140 Ga0466972_0037552
1141 Ga0466966_0001686
1142 Ga0466966_0062251
1143 Ga0466966_0077020
1144 Ga0466961_0007940
1145 Ga0466963_0614593
1146 Ga0466964_0000201
1147 Ga0453684_2050681
1148 Ga0466971_0000493
1149 Ga0466968_0084243
1150 Ga0466970_0001870
1151 Ga0466957_0002612
1152 Ga0466960_0144494
1153 Ga0466959_0000647
1154 Ga0466959_0000784
1155 Ga0466959_0151760
1156 Ga0466959_0243365
1157 Ga0466959_0643578
1158 Ga0466958_0070944
1159 Ga0495651_0143714
1160 Ga0495580_0016882
1161 Ga0495580_0025318
1162 Ga0495580_0339285
1163 Ga0495606_0336407
1164 Ga0495608_0233568
1165 Ga0495628_0304880
1166 Ga0495630_0122811
1167 Ga0495630_0147932
1168 Ga0495632_0053465
1169 Ga0495665_0324262
1170 Ga0495645_0575432
1171 Ga0495668_0811614
1172 Ga0495611_0551280
1173 Ga0495625_0673356
1174 Ga0495657_0256596
1175 Ga0495599_0111845
1176 Ga0495599_0301578
1177 Ga0495623_0024829
1178 Ga0495647_0222119
1179 Ga0495671_0185501
1180 Ga0495649_0136967
1181 Ga0495604_0230473
1182 Ga0495674_0285353
1183 Ga0495687_038552
1184 Ga0495684_0450903
1185 Ga0495686_0069563
1186 Ga0495602_0061956
1187 Ga0495602_0534249
1188 Ga0496100_0024121
1189 Ga0496101_0028257
1190 Ga0496101_0092120
1191 Ga0496101_0491943
1192 Ga0496102_0002855
1193 Ga0496102_0007520
1194 Ga0496102_0019402
1195 Ga0496102_0103631
1196 Ga0496102_0136670
1197 Ga0496103_0048380
1198 Ga0496104_0136572
1199 Ga0496105_0817935
1200 Ga0496105_0954747
1201 Ga0496106_0214212
1202 Ga0496108_0015543
1203 Ga0496109_0016256
1204 Ga0496110_0053351
1205 Ga0496110_1856420
1206 Ga0496111_0938003
1207 Ga0496112_0020571
1208 Ga0496112_0560940
1209 Ga0496114_0250586
1210 Ga0496115_0052366
1211 Ga0496115_0496864
1212 Ga0496115_0696077
1213 Ga0496116_0008098
1214 Ga0496117_0000244
1215 Ga0496118_0000040
1216 Ga0496119_0003551
1217 Ga0496119_0039066
1218 Ga0496119_0422651
1219 Ga0496120_0000599
1220 Ga0496120_0008142
1221 Ga0496121_0001468
1222 Ga0496121_0023418
1223 Ga0496124_0055077
1224 Ga0496125_0000762
1225 Ga0496125_0011233
1226 Ga0496125_0017925
1227 Ga0496125_0662762
1228 Ga0496126_0001892
1229 Ga0496126_0203281
1230 Ga0496126_0640697
1231 Ga0495682_0172291
1232 Ga0501032_0137994
1233 Ga0501033_0174160
1234 Ga0501033_0359573
1235 Ga0501036_0047735
1236 Ga0501036_0195673
1237 Ga0501036_0359169
1238 Ga0501036_0919436
1239 Ga0501037_0222149
1240 Ga0501038_0140371
1241 Ga0501039_0224291
1242 Ga0501039_0407749
1243 Ga0501040_0004538
1244 Ga0501040_0013971
1245 Ga0501041_0001879
1246 Ga0501041_0006503
1247 Ga0501041_0010013
1248 Ga0501042_0000824
1249 Ga0501042_0021355
1250 Ga0501043_0113689
1251 Ga0501046_0096865
1252 Ga0501046_0195798
1253 Ga0501048_0014816
1254 Ga0501048_0420160
1255 Ga0501068_0047121
1256 Ga0501068_0778161
1257 Ga0501069_0698056
1258 Ga0501070_0211933
1259 Ga0501070_0254213
1260 Ga0501070_0495465
1261 Ga0501071_0055549
1262 Ga0501071_0105338
1263 Ga0501071_0397194
1264 Ga0501072_0077967
1265 Ga0501072_0116567
1266 Ga0501072_0116779
1267 Ga0501073_0180546
1268 Ga0501074_0180933
1269 Ga0501075_0000077
1270 Ga0501075_0021355
1271 Ga0501075_0101645
1272 Ga0501076_0003363
1273 Ga0501076_0005086
1274 Ga0501076_0044178
1275 Ga0501077_0060366
1276 Ga0501077_0108999
1277 Ga0501079_0001289
1278 Ga0501079_0024518
1279 Ga0501079_0241232
1280 Ga0501079_0446695
1281 Ga0501080_0052894
1282 Ga0501080_0091386
1283 Ga0501080_0126430
1284 Ga0501081_0001473
1285 Ga0501081_0007979
1286 Ga0501081_0023266
1287 Ga0501081_0412648
1288 Ga0501083_0079093
1289 Ga0501083_0095812
1290 Ga0501035_0164624
1291 Ga0501035_0246796
1292 Ga0501045_0009739
1293 Ga0501045_0049229
1294 Ga0501045_0221881
1295 Ga0501045_0659056
1296 nmdc:mga0qj67_440320_c1
1297 nmdc:mga0rr50_15245_c1
1298 Ga0495601_0207907
1299 Ga0495601_0402371
1300 Ga0495612_0045570
1301 Ga0495619_0246891
1302 Ga0500646_0370550
1303 Ga0500583_0040944
1304 Ga0500583_0057850
1305 Ga0500583_0104656
1306 Ga0500641_0004062
1307 Ga0500641_0058417
1308 Ga0500641_0145283
1309 Ga0500556_0001692
1310 Ga0500569_082871
1311 Ga0500614_006175
1312 Ga0500617_035015
1313 Ga0500642_0118001
1314 Ga0500642_0298783
1315 Ga0500652_071632
1316 Ga0500559_0106418
1317 Ga0500577_0077009
1318 Ga0500588_0010776
1319 Ga0500616_0000130
1320 Ga0500616_0006229
1321 Ga0500619_266934
1322 Ga0500630_237297
1323 Ga0500636_0094057
1324 Ga0500637_0053861
1325 Ga0500637_0302641
1326 Ga0500611_001094
1327 Ga0501084_0023006
1328 Ga0501084_0029639
1329 Ga0501084_0134270
1330 Ga0590071_123028
1331 Ga0501082_0001270
1332 Ga0501082_0012505
1333 Ga0501082_0066973
1334 Ga0501082_0227805
1335 Ga0466962_0000251
1336 Ga0530510_0001174
1337 Ga0530510_0088996
1338 Ga0530510_0470311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01592

NifU_N

NifU-like N terminal domain

6

136

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jzw-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9567 2 136
6jzv-assembly4.cif.gz_D crystal structure of sufu from bacillus subtilis 0.9539 2 138
6jzw-assembly2.cif.gz_B crystal structure of sufu from bacillus subtilis with cys persulfurated 0.947 2 136
2qq4-assembly2.cif.gz_D crystal structure of iron-sulfur cluster biosynthesis protein iscu (ttha1736) from thermus thermophilus hb8 0.9461 1 137
6jzw-assembly3.cif.gz_C crystal structure of sufu from bacillus subtilis with cys persulfurated 0.9336 2 139
ID Description Score Start End Superfamily
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9551 1 137 3.90.1010.10
af_O53156_2_157_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9514 3 140 3.90.1010.10
2qq4B00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9416 1 137 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.9105 2 136 3.90.1010.10
5xt5C00 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.8976 2 136 3.90.1010.10
ID Description Score Start End GO Terms
AF-A0A1Q4FJJ7-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9736 6 139 GO:0005506
GO:0016226
GO:0051536
AF-A0A8A9AVD4-F1-model_v4 deleted 0.9735 9 140
AF-A0A6N6Z0K4-F1-model_v4 Nitrogen fixation protein NifU 0.9697 2 139 GO:0005506
GO:0016226
GO:0051536
AF-A0A5J6SVW0-F1-model_v4 deleted 0.9688 4 140
AF-A0A7W1A575-F1-model_v4 SUF system NifU family Fe-S cluster assembly protein 0.9672 11 138 GO:0005506
GO:0016226
GO:0051536

Map