F473972
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 669 | 414 | 607 | 403 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100005917|Ga0070669_1000059176 |
| Length | 486 |
| Sequence | MNWPYELQIGWRYTRLGIALGVAALIIVLSVMNGFQKEVQGRMLSVISHVEVFDPQGAALADWKATATAARRNPEVIGAAPFVAAQALIGRGDEMRGAIVRGISPNDEATVTDLAAQLKDTTLKRLVPGEWNIVLGVELARSLAVRNGDKVTLVAPGGQVTPAGVVPRLKQFTVVGTFDAGHYEYDSGLVWIHVDDAAKLFRVEGPTGVQLRLKDLNQAREVAARLEQSLGPDLTVRDWTRTNRNWFAAVQVEKRLMFIILTLIVAVAAFNLVSTLVMTVTDKRADIAILRTLGATPGSVMSIFMVQGALAGIIGTFGGVALGLLIAFNVDVIVPFIERLLHVSFLPSSVYLISRMPSDPQSSDIVPIVVISLVLAFLATLYPSWRASRVQPAGAASLIAQRFGRWRRPDPRRDQPAQALHRRQRRVAPRCQGAAGRRPCSATRRDGRDRGRVGFRQEHPAAPARRSRGAEPGQGAQSPSRLHLRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 2 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 3 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 6 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 7 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 8 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 9 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 10 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 11 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 12 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 13 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 14 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 15 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 16 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 17 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 18 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 19 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 20 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 21 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 22 | 2721755523 | Delftia sp. HK171 | Isolate | Unclassified |
| 23 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 24 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 25 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 26 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 27 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 28 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 29 | 2834641062 | Cupriavidus gilardii JZ4 | Isolate | Unclassified |
| 30 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 31 | 2839138175 | Delftia acidovorans B15 | Isolate | Rhizosphere |
| 32 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 33 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 34 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 35 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 36 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 37 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 38 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 39 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 40 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 41 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 42 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 43 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 44 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 45 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 46 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 47 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 48 | 2928058823 | Ralstonia sp. 1138 | Isolate | Unclassified |
| 49 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 50 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 51 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 52 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 53 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 54 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 55 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 56 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 57 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 58 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 59 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 60 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 61 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 62 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 63 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 64 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 65 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 67 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 70 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 71 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 72 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 74 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 75 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 76 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 77 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 78 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 82 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 84 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 97 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 98 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 100 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 109 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 111 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 112 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 113 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 119 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 120 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 121 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 122 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 125 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 128 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 131 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 133 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 134 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 135 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 136 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 137 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 138 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 139 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 140 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 141 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 143 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 144 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 166 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 174 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 175 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 178 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 185 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 234 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 237 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 240 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 244 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 245 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 246 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 247 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 248 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 249 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 250 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 251 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 252 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 253 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 254 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 255 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 256 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 257 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 258 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 259 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 260 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 261 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 262 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 263 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 264 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 265 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 268 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 269 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 271 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 272 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 273 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 280 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 281 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 282 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 283 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 284 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 285 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 286 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 287 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 288 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 289 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 290 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 291 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 292 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 293 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 294 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 295 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 296 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 297 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 298 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 299 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 300 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 301 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 302 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 303 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 304 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 305 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 306 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 307 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 308 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 309 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 310 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 311 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 312 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 313 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 314 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 315 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 316 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 317 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 318 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 351 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 352 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 361 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 362 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 363 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 364 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 365 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 366 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 367 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 379 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 387 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 398 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 399 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 400 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 401 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 402 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 403 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 408 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 409 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 410 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 413 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 414 | 8003400568 | Cupriavidus gilardii USM5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.73 |
| Metatranscriptomes | 0 |
| Isolates | 9.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.82 |
| Nodule | 1.94 |
| Rhizoplane | 2.69 |
| Rhizosphere | 64.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1006822 | 3300002773 | Bacteria | 3032 |
| 2 | JGI25150J39212_1007356 | 3300002774 | Bacteria | 2216 |
| 3 | JGI25151J46595_10001626 | 3300003187 | Bacteria | 14835 |
| 4 | JGI25151J46595_10002427 | 3300003187 | Bacteria | 11237 |
| 5 | JGI25160J50197_1013023 | 3300003354 | Bacteria | 2854 |
| 6 | Ga0055525_1000031 | 3300003759 | Bacteria | 314909 |
| 7 | Ga0055535_1001453 | 3300003761 | Bacteria | 11990 |
| 8 | Ga0055542_1001330 | 3300003762 | Bacteria | 12922 |
| 9 | Ga0055542_1001423 | 3300003762 | Bacteria | 11998 |
| 10 | Ga0055526_1001897 | 3300003771 | Bacteria | 14503 |
| 11 | Ga0055526_1003910 | 3300003771 | Bacteria | 9196 |
| 12 | Ga0055526_1003992 | 3300003771 | Bacteria | 9078 |
| 13 | Ga0055526_1006280 | 3300003771 | Bacteria | 6501 |
| 14 | Ga0055537_1002046 | 3300003773 | Bacteria | 7117 |
| 15 | Ga0055524_1000125 | 3300003775 | Bacteria | 90042 |
| 16 | Ga0055524_1000360 | 3300003775 | Bacteria | 40907 |
| 17 | Ga0055536_1000889 | 3300003781 | Bacteria | 19456 |
| 18 | Ga0055536_1004343 | 3300003781 | Bacteria | 7290 |
| 19 | Ga0055534_1000386 | 3300003784 | Bacteria | 27590 |
| 20 | Ga0055534_1000986 | 3300003784 | Bacteria | 12568 |
| 21 | Ga0055534_1002111 | 3300003784 | Bacteria | 7136 |
| 22 | Ga0055530_10016267 | 3300003791 | Bacteria | 2385 |
| 23 | Ga0055540_1000011 | 3300003792 | Bacteria | 282927 |
| 24 | Ga0055540_1000393 | 3300003792 | Bacteria | 35911 |
| 25 | Ga0055540_1010338 | 3300003792 | Bacteria | 3116 |
| 26 | Ga0055531_10004809 | 3300003794 | Bacteria | 8064 |
| 27 | Ga0055531_10004871 | 3300003794 | Bacteria | 7998 |
| 28 | Ga0065165_1000967 | 3300005262 | Bacteria | 36011 |
| 29 | Ga0065165_1007030 | 3300005262 | Bacteria | 5669 |
| 30 | Ga0065707_10179379 | 3300005295 | Bacteria | 1428 |
| 31 | Ga0070676_10013767 | 3300005328 | Bacteria | 4435 |
| 32 | Ga0070690_100003369 | 3300005330 | Bacteria | 8723 |
| 33 | Ga0070670_100015056 | 3300005331 | Bacteria | 6637 |
| 34 | Ga0068869_100006668 | 3300005334 | Bacteria | 7334 |
| 35 | Ga0068869_100033907 | 3300005334 | Bacteria | 3607 |
| 36 | Ga0070666_10000930 | 3300005335 | Bacteria | 17786 |
| 37 | Ga0068868_100001477 | 3300005338 | Bacteria | 16207 |
| 38 | Ga0068868_100010982 | 3300005338 | Bacteria | 6579 |
| 39 | Ga0070689_100002360 | 3300005340 | Bacteria | 12298 |
| 40 | Ga0070669_100005917 | 3300005353 | Bacteria | 8825 |
| 41 | Ga0070669_100036437 | 3300005353 | Bacteria | 3564 |
| 42 | Ga0070675_100044883 | 3300005354 | Bacteria | 3615 |
| 43 | Ga0070675_100058026 | 3300005354 | Bacteria | 3192 |
| 44 | Ga0070675_100060990 | 3300005354 | Bacteria | 3114 |
| 45 | Ga0070675_100091473 | 3300005354 | Bacteria | 2549 |
| 46 | Ga0070671_100041655 | 3300005355 | Bacteria | 3817 |
| 47 | Ga0070671_100047484 | 3300005355 | Bacteria | 3570 |
| 48 | Ga0070671_100060329 | 3300005355 | Bacteria | 3158 |
| 49 | Ga0070671_100166738 | 3300005355 | Bacteria | 1862 |
| 50 | Ga0070674_100000568 | 3300005356 | Bacteria | 18602 |
| 51 | Ga0070674_100011792 | 3300005356 | Bacteria | 5335 |
| 52 | Ga0070673_100045204 | 3300005364 | Bacteria | 3414 |
| 53 | Ga0070667_100051456 | 3300005367 | Bacteria | 3473 |
| 54 | Ga0070701_10003296 | 3300005438 | Bacteria | 6363 |
| 55 | Ga0070700_100010066 | 3300005441 | Bacteria | 5206 |
| 56 | Ga0070694_100016546 | 3300005444 | Bacteria | 4643 |
| 57 | Ga0070663_100001074 | 3300005455 | Bacteria | 14958 |
| 58 | Ga0070678_100000637 | 3300005456 | Bacteria | 17165 |
| 59 | Ga0070681_10248211 | 3300005458 | Bacteria | 1693 |
| 60 | Ga0068867_100007834 | 3300005459 | Bacteria | 7550 |
| 61 | Ga0068867_100009496 | 3300005459 | Bacteria | 6861 |
| 62 | Ga0068867_100068184 | 3300005459 | Bacteria | 2654 |
| 63 | Ga0070706_100012975 | 3300005467 | Bacteria | 7710 |
| 64 | Ga0070706_100259610 | 3300005467 | Bacteria | 1622 |
| 65 | Ga0070679_100230249 | 3300005530 | Bacteria | 1813 |
| 66 | Ga0070697_100114875 | 3300005536 | Bacteria | 2247 |
| 67 | Ga0070672_100031460 | 3300005543 | Bacteria | 3994 |
| 68 | Ga0070672_100039019 | 3300005543 | Bacteria | 3634 |
| 69 | Ga0070672_100093361 | 3300005543 | Bacteria | 2430 |
| 70 | Ga0070686_100005616 | 3300005544 | Bacteria | 6948 |
| 71 | Ga0070695_100009100 | 3300005545 | Bacteria | 5903 |
| 72 | Ga0070695_100011804 | 3300005545 | Bacteria | 5229 |
| 73 | Ga0070696_100001380 | 3300005546 | Bacteria | 15883 |
| 74 | Ga0070696_100013721 | 3300005546 | Bacteria | 5440 |
| 75 | Ga0070693_100000208 | 3300005547 | Bacteria | 27286 |
| 76 | Ga0070693_100134238 | 3300005547 | Bacteria | 1551 |
| 77 | Ga0070665_100026163 | 3300005548 | Bacteria | 5875 |
| 78 | Ga0070704_100017542 | 3300005549 | Bacteria | 4554 |
| 79 | Ga0068855_100015728 | 3300005563 | Bacteria | 9102 |
| 80 | Ga0068855_100431198 | 3300005563 | Bacteria | 1441 |
| 81 | Ga0070664_100017715 | 3300005564 | Bacteria | 5852 |
| 82 | Ga0070664_100019354 | 3300005564 | Bacteria | 5602 |
| 83 | Ga0070664_100264621 | 3300005564 | Bacteria | 1548 |
| 84 | Ga0068857_100089073 | 3300005577 | Bacteria | 2761 |
| 85 | Ga0068854_100026600 | 3300005578 | Bacteria | 3978 |
| 86 | Ga0068856_100036287 | 3300005614 | Bacteria | 4834 |
| 87 | Ga0070702_100004253 | 3300005615 | Bacteria | 6526 |
| 88 | Ga0068852_100020418 | 3300005616 | Bacteria | 5269 |
| 89 | Ga0068852_100098873 | 3300005616 | Bacteria | 2629 |
| 90 | Ga0068859_100001613 | 3300005617 | Bacteria | 23052 |
| 91 | Ga0068859_100006943 | 3300005617 | Bacteria | 11498 |
| 92 | Ga0068859_100012344 | 3300005617 | Bacteria | 8594 |
| 93 | Ga0068864_100039622 | 3300005618 | Bacteria | 4027 |
| 94 | Ga0068864_100133915 | 3300005618 | Bacteria | 2230 |
| 95 | Ga0068866_10003990 | 3300005718 | Bacteria | 6057 |
| 96 | Ga0068866_10058733 | 3300005718 | Bacteria | 1988 |
| 97 | Ga0068861_100064370 | 3300005719 | Bacteria | 2821 |
| 98 | Ga0068861_100065877 | 3300005719 | Bacteria | 2791 |
| 99 | Ga0068851_10032784 | 3300005834 | Bacteria | 2585 |
| 100 | Ga0068863_100006228 | 3300005841 | Bacteria | 11714 |
| 101 | Ga0068858_100003477 | 3300005842 | Bacteria | 15611 |
| 102 | Ga0068858_100006859 | 3300005842 | Bacteria | 11068 |
| 103 | Ga0068858_100007536 | 3300005842 | Bacteria | 10520 |
| 104 | Ga0068860_100000968 | 3300005843 | Bacteria | 31798 |
| 105 | Ga0068860_100006430 | 3300005843 | Bacteria | 11799 |
| 106 | Ga0068860_100007870 | 3300005843 | Bacteria | 10641 |
| 107 | Ga0068862_100005951 | 3300005844 | Bacteria | 10158 |
| 108 | Ga0068862_100007738 | 3300005844 | Bacteria | 8886 |
| 109 | Ga0068862_100040990 | 3300005844 | Bacteria | 3938 |
| 110 | Ga0068862_100049190 | 3300005844 | Bacteria | 3601 |
| 111 | Ga0075365_10014106 | 3300006038 | Bacteria | 4800 |
| 112 | Ga0075365_10036673 | 3300006038 | Bacteria | 3178 |
| 113 | Ga0075365_10178564 | 3300006038 | Bacteria | 1484 |
| 114 | Ga0075368_10007889 | 3300006042 | Bacteria | 3776 |
| 115 | Ga0075368_10008999 | 3300006042 | Bacteria | 3582 |
| 116 | Ga0075368_10046739 | 3300006042 | Bacteria | 1713 |
| 117 | Ga0075363_100009910 | 3300006048 | Bacteria | 4499 |
| 118 | Ga0075363_100053231 | 3300006048 | Bacteria | 2162 |
| 119 | Ga0075363_100085214 | 3300006048 | Bacteria | 1733 |
| 120 | Ga0075364_10000943 | 3300006051 | Bacteria | 15334 |
| 121 | Ga0075364_10019781 | 3300006051 | Bacteria | 4229 |
| 122 | Ga0075364_10058818 | 3300006051 | Bacteria | 2519 |
| 123 | Ga0070716_100115045 | 3300006173 | Bacteria | 1674 |
| 124 | Ga0075367_10013104 | 3300006178 | Bacteria | 4444 |
| 125 | Ga0075367_10028385 | 3300006178 | Bacteria | 3192 |
| 126 | Ga0075367_10162304 | 3300006178 | Bacteria | 1390 |
| 127 | Ga0075366_10004350 | 3300006195 | Bacteria | 7594 |
| 128 | Ga0075366_10005284 | 3300006195 | Bacteria | 6996 |
| 129 | Ga0075366_10007203 | 3300006195 | Bacteria | 6129 |
| 130 | Ga0075366_10008365 | 3300006195 | Bacteria | 5748 |
| 131 | Ga0075366_10017479 | 3300006195 | Bacteria | 4127 |
| 132 | Ga0075366_10065013 | 3300006195 | Bacteria | 2169 |
| 133 | Ga0097621_100006336 | 3300006237 | Bacteria | 8397 |
| 134 | Ga0075370_10000276 | 3300006353 | Bacteria | 18492 |
| 135 | Ga0075370_10018144 | 3300006353 | Bacteria | 3813 |
| 136 | Ga0068871_100000860 | 3300006358 | Bacteria | 20244 |
| 137 | Ga0068871_100024514 | 3300006358 | Bacteria | 4680 |
| 138 | Ga0075428_100004699 | 3300006844 | Bacteria | 15119 |
| 139 | Ga0075431_100125543 | 3300006847 | Bacteria | 2648 |
| 140 | Ga0075431_100183686 | 3300006847 | Bacteria | 2145 |
| 141 | Ga0075433_10018417 | 3300006852 | Bacteria | 5804 |
| 142 | Ga0075434_100016509 | 3300006871 | Bacteria | 7098 |
| 143 | Ga0075429_100000786 | 3300006880 | Bacteria | 24972 |
| 144 | Ga0075429_100002300 | 3300006880 | Bacteria | 16033 |
| 145 | Ga0075429_100091766 | 3300006880 | Bacteria | 2649 |
| 146 | Ga0068865_100004558 | 3300006881 | Bacteria | 8360 |
| 147 | Ga0075436_100007561 | 3300006914 | Bacteria | 7423 |
| 148 | Ga0097620_100001613 | 3300006931 | Bacteria | 23052 |
| 149 | Ga0097620_100006944 | 3300006931 | Bacteria | 11498 |
| 150 | Ga0097620_100012344 | 3300006931 | Bacteria | 8594 |
| 151 | Ga0079104_1000055 | 3300006946 | Bacteria | 166522 |
| 152 | Ga0079104_1000910 | 3300006946 | Bacteria | 23895 |
| 153 | Ga0099826_10000004 | 3300006948 | Bacteria | 802669 |
| 154 | Ga0099826_10000821 | 3300006948 | Bacteria | 16703 |
| 155 | Ga0105240_10003836 | 3300009093 | Bacteria | 23255 |
| 156 | Ga0111539_10032268 | 3300009094 | Bacteria | 6361 |
| 157 | Ga0105245_10020049 | 3300009098 | Bacteria | 5861 |
| 158 | Ga0114129_10042609 | 3300009147 | Bacteria | 6390 |
| 159 | Ga0114129_10049253 | 3300009147 | Bacteria | 5920 |
| 160 | Ga0105243_10001150 | 3300009148 | Bacteria | 23986 |
| 161 | Ga0105243_10002743 | 3300009148 | Bacteria | 14641 |
| 162 | Ga0105243_10007469 | 3300009148 | Bacteria | 8400 |
| 163 | Ga0105243_10018250 | 3300009148 | Bacteria | 5312 |
| 164 | Ga0105243_10250372 | 3300009148 | Bacteria | 1581 |
| 165 | Ga0105242_10000304 | 3300009176 | Bacteria | 39272 |
| 166 | Ga0105242_10003088 | 3300009176 | Bacteria | 12997 |
| 167 | Ga0105248_10022695 | 3300009177 | Bacteria | 6964 |
| 168 | Ga0105237_10001634 | 3300009545 | Bacteria | 29121 |
| 169 | Ga0105249_10016514 | 3300009553 | Bacteria | 6548 |
| 170 | Ga0105239_10002435 | 3300010375 | Bacteria | 23714 |
| 171 | Ga0157378_10013173 | 3300013297 | Bacteria | 7235 |
| 172 | Ga0157372_10156911 | 3300013307 | Bacteria | 2629 |
| 173 | Ga0157375_10062266 | 3300013308 | Bacteria | 3707 |
| 174 | Ga0163163_10061335 | 3300014325 | Bacteria | 3725 |
| 175 | Ga0157380_10008226 | 3300014326 | Bacteria | 7432 |
| 176 | Ga0182008_10000287 | 3300014497 | Bacteria | 39636 |
| 177 | Ga0182008_10010682 | 3300014497 | Bacteria | 4908 |
| 178 | Ga0157379_10050576 | 3300014968 | Bacteria | 3711 |
| 179 | Ga0157376_10079429 | 3300014969 | Bacteria | 2812 |
| 180 | Ga0182006_1011726 | 3300015261 | Bacteria | 3849 |
| 181 | Ga0182007_10000736 | 3300015262 | Bacteria | 18545 |
| 182 | Ga0182007_10001789 | 3300015262 | Bacteria | 11233 |
| 183 | Ga0163161_10000088 | 3300017792 | Bacteria | 91403 |
| 184 | Ga0163161_10010411 | 3300017792 | Bacteria | 6439 |
| 185 | Ga0163161_10080858 | 3300017792 | Bacteria | 2392 |
| 186 | Ga0213872_10000004 | 3300021361 | Bacteria | 306230 |
| 187 | Ga0213872_10000006 | 3300021361 | Bacteria | 249845 |
| 188 | Ga0213872_10000132 | 3300021361 | Bacteria | 67609 |
| 189 | Ga0213872_10001699 | 3300021361 | Bacteria | 13851 |
| 190 | Ga0213872_10009186 | 3300021361 | Bacteria | 4751 |
| 191 | Ga0209784_100516 | 3300025224 | Bacteria | 14718 |
| 192 | Ga0209566_101242 | 3300025225 | Bacteria | 8751 |
| 193 | Ga0209674_100179 | 3300025226 | Bacteria | 77366 |
| 194 | Ga0209672_101105 | 3300025228 | Bacteria | 11418 |
| 195 | Ga0209147_100741 | 3300025229 | Bacteria | 16152 |
| 196 | Ga0209563_100044 | 3300025230 | Bacteria | 396812 |
| 197 | Ga0209563_105942 | 3300025230 | Bacteria | 2148 |
| 198 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 199 | Ga0207425_1000169 | 3300025245 | Bacteria | 54781 |
| 200 | Ga0207425_1001454 | 3300025245 | Bacteria | 9892 |
| 201 | Ga0209646_1000022 | 3300025246 | Bacteria | 446621 |
| 202 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 203 | Ga0209148_1000021 | 3300025254 | Bacteria | 714645 |
| 204 | Ga0209759_1006726 | 3300025256 | Bacteria | 3815 |
| 205 | Ga0209129_1000024 | 3300025258 | Bacteria | 417268 |
| 206 | Ga0209129_1000027 | 3300025258 | Bacteria | 409587 |
| 207 | Ga0209129_1003682 | 3300025258 | Bacteria | 6510 |
| 208 | Ga0209129_1004780 | 3300025258 | Bacteria | 5120 |
| 209 | Ga0209565_1000235 | 3300025263 | Bacteria | 60351 |
| 210 | Ga0209565_1000286 | 3300025263 | Bacteria | 49417 |
| 211 | Ga0209565_1000825 | 3300025263 | Bacteria | 17593 |
| 212 | Ga0209673_1000410 | 3300025273 | Bacteria | 75829 |
| 213 | Ga0209673_1004437 | 3300025273 | Bacteria | 7520 |
| 214 | Ga0209673_1015346 | 3300025273 | Bacteria | 2916 |
| 215 | Ga0209130_1000383 | 3300025284 | Bacteria | 49412 |
| 216 | Ga0209130_1004634 | 3300025284 | Bacteria | 5116 |
| 217 | Ga0209675_1000125 | 3300025291 | Bacteria | 105527 |
| 218 | Ga0209675_1000151 | 3300025291 | Bacteria | 91172 |
| 219 | Ga0209675_1000312 | 3300025291 | Bacteria | 43634 |
| 220 | Ga0209675_1001004 | 3300025291 | Bacteria | 17745 |
| 221 | Ga0209676_1000014 | 3300025292 | Bacteria | 793514 |
| 222 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 223 | Ga0209676_1000275 | 3300025292 | Bacteria | 107485 |
| 224 | Ga0209676_1000780 | 3300025292 | Bacteria | 42574 |
| 225 | Ga0209676_1009775 | 3300025292 | Bacteria | 4088 |
| 226 | Ga0209025_1000289 | 3300025294 | Bacteria | 113555 |
| 227 | Ga0209025_1000379 | 3300025294 | Bacteria | 92457 |
| 228 | Ga0209025_1000423 | 3300025294 | Bacteria | 84180 |
| 229 | Ga0209025_1001571 | 3300025294 | Bacteria | 28912 |
| 230 | Ga0209025_1001709 | 3300025294 | Bacteria | 26726 |
| 231 | Ga0209025_1013208 | 3300025294 | Bacteria | 5212 |
| 232 | Ga0209564_1000139 | 3300025295 | Bacteria | 180328 |
| 233 | Ga0209564_1000209 | 3300025295 | Bacteria | 133651 |
| 234 | Ga0209564_1001235 | 3300025295 | Bacteria | 28797 |
| 235 | Ga0209564_1001259 | 3300025295 | Bacteria | 27998 |
| 236 | Ga0209564_1002311 | 3300025295 | Bacteria | 15479 |
| 237 | Ga0209758_1000049 | 3300025297 | Bacteria | 345104 |
| 238 | Ga0209758_1000052 | 3300025297 | Bacteria | 338962 |
| 239 | Ga0209758_1000146 | 3300025297 | Bacteria | 169246 |
| 240 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 241 | Ga0209050_1000583 | 3300025298 | Bacteria | 59089 |
| 242 | Ga0209050_1000980 | 3300025298 | Bacteria | 36398 |
| 243 | Ga0209050_1029450 | 3300025298 | Bacteria | 1756 |
| 244 | Ga0209256_1000113 | 3300025299 | Bacteria | 175296 |
| 245 | Ga0209256_1000253 | 3300025299 | Bacteria | 94918 |
| 246 | Ga0209256_1000291 | 3300025299 | Bacteria | 88153 |
| 247 | Ga0209256_1000700 | 3300025299 | Bacteria | 44602 |
| 248 | Ga0207426_1000053 | 3300025302 | Bacteria | 384818 |
| 249 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 250 | Ga0209051_1000020 | 3300025303 | Bacteria | 508628 |
| 251 | Ga0209051_1000173 | 3300025303 | Bacteria | 117170 |
| 252 | Ga0209051_1000531 | 3300025303 | Bacteria | 47271 |
| 253 | Ga0209051_1015948 | 3300025303 | Bacteria | 3433 |
| 254 | Ga0209051_1043986 | 3300025303 | Bacteria | 1561 |
| 255 | Ga0209257_1000085 | 3300025304 | Bacteria | 291117 |
| 256 | Ga0209257_1000096 | 3300025304 | Bacteria | 259390 |
| 257 | Ga0209257_1001928 | 3300025304 | Bacteria | 22402 |
| 258 | Ga0209257_1006537 | 3300025304 | Bacteria | 7446 |
| 259 | Ga0209257_1008315 | 3300025304 | Bacteria | 5942 |
| 260 | Ga0207655_1006582 | 3300025728 | Bacteria | 7664 |
| 261 | Ga0207682_10003641 | 3300025893 | Bacteria | 6646 |
| 262 | Ga0207682_10017191 | 3300025893 | Bacteria | 2824 |
| 263 | Ga0207642_10041594 | 3300025899 | Bacteria | 2014 |
| 264 | Ga0207680_10006275 | 3300025903 | Bacteria | 5736 |
| 265 | Ga0207645_10024778 | 3300025907 | Bacteria | 3887 |
| 266 | Ga0207645_10043333 | 3300025907 | Bacteria | 2880 |
| 267 | Ga0207684_10039424 | 3300025910 | Bacteria | 4007 |
| 268 | Ga0207662_10000451 | 3300025918 | Bacteria | 18219 |
| 269 | Ga0207649_10064964 | 3300025920 | Bacteria | 2309 |
| 270 | Ga0207652_10042969 | 3300025921 | Bacteria | 3848 |
| 271 | Ga0207652_10045633 | 3300025921 | Bacteria | 3736 |
| 272 | Ga0207681_10005519 | 3300025923 | Bacteria | 7769 |
| 273 | Ga0207694_10012902 | 3300025924 | Bacteria | 6292 |
| 274 | Ga0207650_10000265 | 3300025925 | Bacteria | 55786 |
| 275 | Ga0207659_10001160 | 3300025926 | Bacteria | 15700 |
| 276 | Ga0207659_10031008 | 3300025926 | Bacteria | 3656 |
| 277 | Ga0207659_10211516 | 3300025926 | Bacteria | 1554 |
| 278 | Ga0207687_10003609 | 3300025927 | Bacteria | 10421 |
| 279 | Ga0207644_10010073 | 3300025931 | Bacteria | 6225 |
| 280 | Ga0207644_10035747 | 3300025931 | Bacteria | 3483 |
| 281 | Ga0207644_10075627 | 3300025931 | Bacteria | 2475 |
| 282 | Ga0207706_10001386 | 3300025933 | Bacteria | 24177 |
| 283 | Ga0207706_10034273 | 3300025933 | Bacteria | 4517 |
| 284 | Ga0207686_10001386 | 3300025934 | Bacteria | 13763 |
| 285 | Ga0207686_10012404 | 3300025934 | Bacteria | 4687 |
| 286 | Ga0207709_10000211 | 3300025935 | Bacteria | 75562 |
| 287 | Ga0207709_10000273 | 3300025935 | Bacteria | 60743 |
| 288 | Ga0207709_10001689 | 3300025935 | Bacteria | 14842 |
| 289 | Ga0207709_10004882 | 3300025935 | Bacteria | 7676 |
| 290 | Ga0207709_10037486 | 3300025935 | Bacteria | 2881 |
| 291 | Ga0207709_10041459 | 3300025935 | Bacteria | 2762 |
| 292 | Ga0207670_10004486 | 3300025936 | Bacteria | 7522 |
| 293 | Ga0207665_10086928 | 3300025939 | Bacteria | 2161 |
| 294 | Ga0207691_10000390 | 3300025940 | Bacteria | 43939 |
| 295 | Ga0207691_10029711 | 3300025940 | Bacteria | 5111 |
| 296 | Ga0207691_10065242 | 3300025940 | Bacteria | 3297 |
| 297 | Ga0207691_10123800 | 3300025940 | Bacteria | 2289 |
| 298 | Ga0207711_10008232 | 3300025941 | Bacteria | 8730 |
| 299 | Ga0207711_10030475 | 3300025941 | Bacteria | 4549 |
| 300 | Ga0207689_10001368 | 3300025942 | Bacteria | 23383 |
| 301 | Ga0207679_10044103 | 3300025945 | Bacteria | 3216 |
| 302 | Ga0207667_10020298 | 3300025949 | Bacteria | 7394 |
| 303 | Ga0207667_10416623 | 3300025949 | Bacteria | 1367 |
| 304 | Ga0207651_10067767 | 3300025960 | Bacteria | 2513 |
| 305 | Ga0207651_10073917 | 3300025960 | Bacteria | 2426 |
| 306 | Ga0207712_10025840 | 3300025961 | Bacteria | 3906 |
| 307 | Ga0207712_10061553 | 3300025961 | Bacteria | 2664 |
| 308 | Ga0207668_10247059 | 3300025972 | Bacteria | 1447 |
| 309 | Ga0207658_10055793 | 3300025986 | Bacteria | 2929 |
| 310 | Ga0207677_10006533 | 3300026023 | Bacteria | 6403 |
| 311 | Ga0207703_10000361 | 3300026035 | Bacteria | 48627 |
| 312 | Ga0207703_10016330 | 3300026035 | Bacteria | 5787 |
| 313 | Ga0207703_10033407 | 3300026035 | Bacteria | 4078 |
| 314 | Ga0207639_10029251 | 3300026041 | Bacteria | 4031 |
| 315 | Ga0207678_10003142 | 3300026067 | Bacteria | 14937 |
| 316 | Ga0207678_10173229 | 3300026067 | Bacteria | 1842 |
| 317 | Ga0207708_10000114 | 3300026075 | Bacteria | 61971 |
| 318 | Ga0207702_10060486 | 3300026078 | Bacteria | 3229 |
| 319 | Ga0207641_10055731 | 3300026088 | Bacteria | 3357 |
| 320 | Ga0207648_10000789 | 3300026089 | Bacteria | 35679 |
| 321 | Ga0207648_10003084 | 3300026089 | Bacteria | 17602 |
| 322 | Ga0207648_10005196 | 3300026089 | Bacteria | 13182 |
| 323 | Ga0207648_10027223 | 3300026089 | Bacteria | 5078 |
| 324 | Ga0207648_10030882 | 3300026089 | Bacteria | 4740 |
| 325 | Ga0207676_10024509 | 3300026095 | Bacteria | 4465 |
| 326 | Ga0207676_10027573 | 3300026095 | Bacteria | 4232 |
| 327 | Ga0207674_10039486 | 3300026116 | Bacteria | 4892 |
| 328 | Ga0207674_10050247 | 3300026116 | Bacteria | 4261 |
| 329 | Ga0207675_100004863 | 3300026118 | Bacteria | 12944 |
| 330 | Ga0207675_100004938 | 3300026118 | Bacteria | 12854 |
| 331 | Ga0207683_10021751 | 3300026121 | Bacteria | 5498 |
| 332 | Ga0207683_10058744 | 3300026121 | Bacteria | 3377 |
| 333 | Ga0207683_10069179 | 3300026121 | Bacteria | 3118 |
| 334 | Ga0207683_10077671 | 3300026121 | Bacteria | 2941 |
| 335 | Ga0207683_10127732 | 3300026121 | Bacteria | 2286 |
| 336 | Ga0207683_10153194 | 3300026121 | Bacteria | 2081 |
| 337 | Ga0207698_10024216 | 3300026142 | Bacteria | 4257 |
| 338 | Ga0207698_10044424 | 3300026142 | Bacteria | 3338 |
| 339 | Ga0209281_1000007 | 3300027111 | Bacteria | 938265 |
| 340 | Ga0209281_1000195 | 3300027111 | Bacteria | 139144 |
| 341 | Ga0209968_1001974 | 3300027526 | Bacteria | 3121 |
| 342 | Ga0209999_1009468 | 3300027543 | Bacteria | 1759 |
| 343 | Ga0209282_1000027 | 3300027666 | Bacteria | 159842 |
| 344 | Ga0209282_1001176 | 3300027666 | Bacteria | 14066 |
| 345 | Ga0209966_1000039 | 3300027695 | Bacteria | 54525 |
| 346 | Ga0209974_10021764 | 3300027876 | Bacteria | 2124 |
| 347 | Ga0207428_10000624 | 3300027907 | Bacteria | 41590 |
| 348 | Ga0268266_10267656 | 3300028379 | Bacteria | 1585 |
| 349 | Ga0268265_10130619 | 3300028380 | Bacteria | 2086 |
| 350 | Ga0268264_10005385 | 3300028381 | Bacteria | 10835 |
| 351 | Ga0268264_10042331 | 3300028381 | Bacteria | 3770 |
| 352 | Ga0268264_10105768 | 3300028381 | Bacteria | 2455 |
| 353 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 354 | Ga0307515_10000090 | 3300028794 | Bacteria | 215043 |
| 355 | Ga0307515_10000132 | 3300028794 | Bacteria | 176547 |
| 356 | Ga0307515_10063613 | 3300028794 | Bacteria | 5177 |
| 357 | Ga0307515_10179585 | 3300028794 | Bacteria | 2072 |
| 358 | Ga0307511_10000248 | 3300030521 | Bacteria | 55337 |
| 359 | Ga0307512_10086046 | 3300030522 | Bacteria | 2223 |
| 360 | Ga0307512_10119946 | 3300030522 | Bacteria | 1695 |
| 361 | Ga0265328_10002207 | 3300031239 | Bacteria | 8773 |
| 362 | Ga0265331_10003815 | 3300031250 | Bacteria | 9557 |
| 363 | Ga0265327_10000328 | 3300031251 | Bacteria | 90489 |
| 364 | Ga0265327_10000341 | 3300031251 | Bacteria | 88581 |
| 365 | Ga0265327_10012542 | 3300031251 | Bacteria | 5706 |
| 366 | Ga0307513_10012051 | 3300031456 | Bacteria | 10693 |
| 367 | Ga0307509_10000031 | 3300031507 | Bacteria | 205072 |
| 368 | Ga0307408_100062988 | 3300031548 | Bacteria | 2712 |
| 369 | Ga0307408_100172309 | 3300031548 | Bacteria | 1729 |
| 370 | Ga0307508_10000007 | 3300031616 | Bacteria | 268359 |
| 371 | Ga0307514_10019551 | 3300031649 | Bacteria | 5540 |
| 372 | Ga0265314_10006635 | 3300031711 | Bacteria | 10171 |
| 373 | Ga0265314_10025632 | 3300031711 | Bacteria | 4444 |
| 374 | Ga0307516_10000398 | 3300031730 | Bacteria | 56825 |
| 375 | Ga0307516_10012557 | 3300031730 | Bacteria | 9118 |
| 376 | Ga0307405_10000483 | 3300031731 | Bacteria | 14957 |
| 377 | Ga0307405_10019331 | 3300031731 | Bacteria | 3780 |
| 378 | Ga0307405_10034202 | 3300031731 | Bacteria | 3022 |
| 379 | Ga0307413_10016227 | 3300031824 | Bacteria | 3840 |
| 380 | Ga0307410_10103386 | 3300031852 | Bacteria | 2046 |
| 381 | Ga0307407_10008666 | 3300031903 | Bacteria | 4684 |
| 382 | Ga0307416_100122804 | 3300032002 | Bacteria | 2319 |
| 383 | Ga0307414_10035226 | 3300032004 | Bacteria | 3329 |
| 384 | Ga0307414_10089455 | 3300032004 | Bacteria | 2282 |
| 385 | Ga0307411_10037345 | 3300032005 | Bacteria | 3053 |
| 386 | Ga0373940_0013014 | 3300035088 | Bacteria | 2003 |
| 387 | Ga0373932_0013913 | 3300035112 | Bacteria | 2012 |
| 388 | Ga0373936_0008562 | 3300035113 | Bacteria | 3851 |
| 389 | Ga0373941_0030681 | 3300035115 | Bacteria | 1595 |
| 390 | Ga0373945_0014220 | 3300035116 | Bacteria | 2662 |
| 391 | Ga0373953_0007230 | 3300035117 | Bacteria | 3709 |
| 392 | Ga0373943_0009478 | 3300035170 | Bacteria | 4363 |
| 393 | Ga0373962_0026958 | 3300035242 | Bacteria | 1551 |
| 394 | Ga0373935_0020327 | 3300035692 | Bacteria | 4055 |
| 395 | Ga0373947_0086584 | 3300035725 | Bacteria | 1947 |
| 396 | Ga0373937_0013036 | 3300036401 | Bacteria | 7322 |
| 397 | Ga0395899_0029996 | 3300037312 | Bacteria | 4092 |
| 398 | Ga0395899_0163687 | 3300037312 | Bacteria | 1570 |
| 399 | Ga0395900_0031313 | 3300037418 | Bacteria | 5464 |
| 400 | Ga0395898_0022575 | 3300037466 | Bacteria | 6372 |
| 401 | Ga0395898_0037496 | 3300037466 | Bacteria | 4807 |
| 402 | Ga0395898_0211872 | 3300037466 | Bacteria | 1848 |
| 403 | Ga0395905_0000025 | 3300037471 | Bacteria | 317571 |
| 404 | Ga0395905_0000460 | 3300037471 | Bacteria | 56900 |
| 405 | Ga0395905_0004785 | 3300037471 | Bacteria | 13982 |
| 406 | Ga0395905_0009246 | 3300037471 | Bacteria | 9647 |
| 407 | Ga0395905_0016841 | 3300037471 | Bacteria | 6945 |
| 408 | Ga0395905_0022801 | 3300037471 | Bacteria | 5919 |
| 409 | Ga0395905_0023364 | 3300037471 | Bacteria | 5843 |
| 410 | Ga0395905_0025632 | 3300037471 | Bacteria | 5560 |
| 411 | Ga0395905_0040137 | 3300037471 | Bacteria | 4390 |
| 412 | Ga0395905_0122647 | 3300037471 | Bacteria | 2443 |
| 413 | Ga0395905_0174150 | 3300037471 | Bacteria | 2020 |
| 414 | Ga0395905_0234720 | 3300037471 | Bacteria | 1714 |
| 415 | Ga0395905_0270118 | 3300037471 | Bacteria | 1586 |
| 416 | Ga0395905_0323256 | 3300037471 | Bacteria | 1433 |
| 417 | Ga0395901_0091140 | 3300038443 | Bacteria | 3190 |
| 418 | Ga0395901_0134674 | 3300038443 | Bacteria | 2596 |
| 419 | Ga0436361_0215868 | 3300039447 | Bacteria | 46672 |
| 420 | Ga0436361_0337087 | 3300039447 | Bacteria | 12820 |
| 421 | Ga0436361_0371412 | 3300039447 | Bacteria | 22181 |
| 422 | Ga0436361_0609661 | 3300039447 | Bacteria | 30960 |
| 423 | Ga0436361_1206467 | 3300039447 | Bacteria | 80244 |
| 424 | Ga0439436_0000259 | 3300041404 | Bacteria | 12713 |
| 425 | Ga0439438_018437 | 3300041405 | Bacteria | 1989 |
| 426 | Ga0439447_018078 | 3300041407 | Bacteria | 1908 |
| 427 | Ga0439466_0001510 | 3300041411 | Bacteria | 9089 |
| 428 | Ga0439466_0011362 | 3300041411 | Bacteria | 3295 |
| 429 | Ga0439465_0054402 | 3300041413 | Bacteria | 1317 |
| 430 | Ga0451789_0365025 | 3300041443 | Bacteria | 2662 |
| 431 | Ga0451800_0572189 | 3300041459 | Bacteria | 2789 |
| 432 | Ga0439431_0016410 | 3300041997 | Bacteria | 1733 |
| 433 | Ga0439433_0002854 | 3300041999 | Bacteria | 3691 |
| 434 | Ga0439442_020008 | 3300042002 | Bacteria | 1387 |
| 435 | Ga0439449_0000530 | 3300042007 | Bacteria | 14217 |
| 436 | Ga0439449_0013872 | 3300042007 | Bacteria | 3030 |
| 437 | Ga0439449_0021363 | 3300042007 | Bacteria | 2424 |
| 438 | Ga0439452_006298 | 3300042010 | Bacteria | 3725 |
| 439 | Ga0439452_006480 | 3300042010 | Bacteria | 3666 |
| 440 | Ga0439462_0000404 | 3300042015 | Bacteria | 8339 |
| 441 | Ga0450911_000366 | 3300042115 | Bacteria | 15046 |
| 442 | Ga0450919_000679 | 3300042121 | Bacteria | 4280 |
| 443 | Ga0450923_000865 | 3300042125 | Bacteria | 3700 |
| 444 | Ga0450888_006183 | 3300042126 | Bacteria | 1296 |
| 445 | Ga0450890_005770 | 3300042127 | Bacteria | 1592 |
| 446 | Ga0450908_001881 | 3300042184 | Bacteria | 4109 |
| 447 | Ga0439434_0003522 | 3300042435 | Bacteria | 4570 |
| 448 | Ga0439434_0020281 | 3300042435 | Bacteria | 1995 |
| 449 | Ga0439464_0006437 | 3300042439 | Bacteria | 3058 |
| 450 | Ga0450918_000036 | 3300042531 | Bacteria | 26790 |
| 451 | Ga0451577_0005895 | 3300042876 | Bacteria | 12379 |
| 452 | Ga0451577_0022122 | 3300042876 | Bacteria | 5807 |
| 453 | Ga0451577_0060099 | 3300042876 | Bacteria | 3388 |
| 454 | Ga0451577_0172188 | 3300042876 | Bacteria | 1951 |
| 455 | Ga0466969_0009596 | 3300044656 | Bacteria | 5128 |
| 456 | Ga0466972_0001197 | 3300044658 | Bacteria | 12476 |
| 457 | Ga0453683_0008042 | 3300044673 | Bacteria | 7101 |
| 458 | Ga0466965_0018707 | 3300044683 | Bacteria | 3324 |
| 459 | Ga0466965_0032924 | 3300044683 | Bacteria | 2532 |
| 460 | Ga0466966_0097031 | 3300044684 | Bacteria | 1825 |
| 461 | Ga0466961_0002008 | 3300044693 | Bacteria | 12655 |
| 462 | Ga0466961_0100650 | 3300044693 | Bacteria | 1820 |
| 463 | Ga0466964_0001102 | 3300044706 | Bacteria | 9053 |
| 464 | Ga0453684_0296871 | 3300044712 | Bacteria | 1838 |
| 465 | Ga0466971_0027410 | 3300044719 | Bacteria | 2552 |
| 466 | Ga0466968_0015723 | 3300044735 | Bacteria | 3005 |
| 467 | Ga0466968_0020759 | 3300044735 | Bacteria | 2654 |
| 468 | Ga0466968_0051879 | 3300044735 | Bacteria | 1754 |
| 469 | Ga0466970_0011713 | 3300044765 | Bacteria | 4473 |
| 470 | Ga0466959_0002786 | 3300045049 | Bacteria | 11253 |
| 471 | Ga0466959_0017291 | 3300045049 | Bacteria | 5284 |
| 472 | Ga0451576_0000220 | 3300045051 | Bacteria | 141261 |
| 473 | Ga0451576_0024152 | 3300045051 | Bacteria | 6568 |
| 474 | Ga0451576_0340532 | 3300045051 | Bacteria | 1570 |
| 475 | Ga0466958_0092531 | 3300045836 | Bacteria | 1872 |
| 476 | Ga0466967_0032384 | 3300045976 | Bacteria | 4413 |
| 477 | Ga0466967_0156104 | 3300045976 | Bacteria | 2138 |
| 478 | Ga0495603_0021192 | 3300046455 | Bacteria | 3935 |
| 479 | Ga0495590_0010806 | 3300046457 | Bacteria | 3421 |
| 480 | Ga0495650_0000976 | 3300046471 | Bacteria | 32712 |
| 481 | Ga0495580_0010221 | 3300046472 | Bacteria | 7321 |
| 482 | Ga0495582_0020920 | 3300046473 | Bacteria | 3583 |
| 483 | Ga0495605_0000836 | 3300046474 | Bacteria | 21626 |
| 484 | Ga0495639_0016505 | 3300046475 | Bacteria | 3206 |
| 485 | Ga0495584_0027555 | 3300046491 | Bacteria | 2879 |
| 486 | Ga0495596_0000574 | 3300046500 | Bacteria | 22937 |
| 487 | Ga0495607_0010311 | 3300046501 | Bacteria | 6287 |
| 488 | Ga0495610_0003801 | 3300046512 | Bacteria | 11510 |
| 489 | Ga0495610_0006772 | 3300046512 | Bacteria | 7777 |
| 490 | Ga0495616_0000675 | 3300046513 | Bacteria | 25262 |
| 491 | Ga0495632_0008077 | 3300046519 | Bacteria | 6520 |
| 492 | Ga0495637_0003132 | 3300046520 | Bacteria | 8830 |
| 493 | Ga0495643_0053068 | 3300046522 | Bacteria | 2175 |
| 494 | Ga0495663_0011992 | 3300046525 | Bacteria | 2415 |
| 495 | Ga0495654_0015291 | 3300046530 | Bacteria | 4076 |
| 496 | Ga0495586_0053035 | 3300046535 | Bacteria | 2196 |
| 497 | Ga0495598_0014000 | 3300046537 | Bacteria | 1999 |
| 498 | Ga0495621_0001659 | 3300046539 | Bacteria | 5834 |
| 499 | Ga0495633_0002787 | 3300046558 | Bacteria | 12083 |
| 500 | Ga0495656_0000137 | 3300046615 | Bacteria | 27177 |
| 501 | Ga0495656_0008462 | 3300046615 | Bacteria | 3673 |
| 502 | Ga0495625_0000611 | 3300046660 | Bacteria | 51780 |
| 503 | Ga0495625_0003235 | 3300046660 | Bacteria | 16485 |
| 504 | Ga0495625_0012515 | 3300046660 | Bacteria | 6871 |
| 505 | Ga0495588_0011820 | 3300046674 | Bacteria | 4108 |
| 506 | Ga0495588_0022354 | 3300046674 | Bacteria | 3125 |
| 507 | Ga0495647_0000629 | 3300046681 | Bacteria | 10406 |
| 508 | Ga0495658_0005679 | 3300046683 | Bacteria | 6130 |
| 509 | Ga0495658_0140989 | 3300046683 | Bacteria | 1474 |
| 510 | Ga0495671_0000883 | 3300046692 | Bacteria | 21393 |
| 511 | Ga0495671_0009593 | 3300046692 | Bacteria | 5404 |
| 512 | Ga0495649_0027103 | 3300046694 | Bacteria | 3180 |
| 513 | Ga0495649_0028621 | 3300046694 | Bacteria | 3088 |
| 514 | Ga0495660_0044493 | 3300046810 | Bacteria | 2442 |
| 515 | Ga0495687_000500 | 3300047443 | Bacteria | 47248 |
| 516 | Ga0495687_001392 | 3300047443 | Bacteria | 22323 |
| 517 | Ga0495687_005890 | 3300047443 | Bacteria | 7667 |
| 518 | Ga0495686_0134405 | 3300047472 | Bacteria | 1464 |
| 519 | Ga0495615_0000614 | 3300048090 | Bacteria | 5010 |
| 520 | Ga0496102_0014103 | 3300048905 | Bacteria | 6943 |
| 521 | Ga0496102_0018292 | 3300048905 | Bacteria | 6156 |
| 522 | Ga0496102_0044454 | 3300048905 | Bacteria | 4031 |
| 523 | Ga0496103_0005180 | 3300048906 | Bacteria | 7844 |
| 524 | Ga0496104_0003649 | 3300048907 | Bacteria | 13294 |
| 525 | Ga0496105_0003155 | 3300048908 | Bacteria | 12138 |
| 526 | Ga0496105_0319802 | 3300048908 | Bacteria | 1244 |
| 527 | Ga0496108_0013424 | 3300048911 | Bacteria | 6682 |
| 528 | Ga0496108_0035283 | 3300048911 | Bacteria | 4157 |
| 529 | Ga0496109_0246606 | 3300048912 | Bacteria | 1682 |
| 530 | Ga0496112_0108319 | 3300048915 | Bacteria | 2748 |
| 531 | Ga0496113_0014605 | 3300048916 | Bacteria | 5364 |
| 532 | Ga0496114_0036006 | 3300048917 | Bacteria | 4090 |
| 533 | Ga0496116_0003117 | 3300048919 | Bacteria | 16661 |
| 534 | Ga0496116_0011195 | 3300048919 | Bacteria | 7454 |
| 535 | Ga0496118_0007164 | 3300048921 | Bacteria | 11929 |
| 536 | Ga0496121_0018162 | 3300048924 | Bacteria | 7110 |
| 537 | Ga0496121_0018310 | 3300048924 | Bacteria | 7072 |
| 538 | Ga0496122_0000063 | 3300048925 | Bacteria | 241378 |
| 539 | Ga0496122_0009675 | 3300048925 | Bacteria | 10086 |
| 540 | Ga0496123_0000045 | 3300048926 | Bacteria | 249294 |
| 541 | Ga0496124_0000036 | 3300048927 | Bacteria | 318032 |
| 542 | Ga0496124_0020425 | 3300048927 | Bacteria | 6119 |
| 543 | Ga0496124_0025363 | 3300048927 | Bacteria | 5370 |
| 544 | Ga0496125_0007863 | 3300048928 | Bacteria | 11268 |
| 545 | Ga0496125_0128776 | 3300048928 | Bacteria | 1787 |
| 546 | Ga0496126_0006539 | 3300048929 | Bacteria | 12975 |
| 547 | Ga0501036_0098347 | 3300049572 | Bacteria | 2474 |
| 548 | Ga0501037_0187924 | 3300049573 | Bacteria | 1464 |
| 549 | Ga0501039_0115705 | 3300049575 | Bacteria | 2099 |
| 550 | Ga0501039_0152263 | 3300049575 | Bacteria | 1817 |
| 551 | Ga0501042_0215238 | 3300049578 | Bacteria | 1386 |
| 552 | Ga0501046_0000008 | 3300049580 | Bacteria | 351167 |
| 553 | Ga0501047_0000003 | 3300049581 | Bacteria | 508375 |
| 554 | Ga0501048_0000759 | 3300049582 | Bacteria | 23664 |
| 555 | Ga0501068_0057214 | 3300049584 | Bacteria | 2364 |
| 556 | Ga0501071_0007694 | 3300049587 | Bacteria | 7099 |
| 557 | Ga0501072_0067174 | 3300049588 | Bacteria | 2829 |
| 558 | Ga0501072_0097805 | 3300049588 | Bacteria | 2333 |
| 559 | Ga0501075_0022897 | 3300049591 | Bacteria | 4569 |
| 560 | Ga0501075_0090428 | 3300049591 | Bacteria | 2322 |
| 561 | Ga0501198_000014 | 3300049649 | Bacteria | 106940 |
| 562 | Ga0501222_000008 | 3300049662 | Bacteria | 120904 |
| 563 | Ga0501081_0093588 | 3300049743 | Bacteria | 2116 |
| 564 | nmdc:mga00v17_162367_c1 | 3300050491 | Bacteria | 1439 |
| 565 | nmdc:mga00v17_7516_c1 | 3300050491 | Bacteria | 5816 |
| 566 | nmdc:mga0yw44_179129_c1 | 3300050492 | Bacteria | 1394 |
| 567 | nmdc:mga0k408_10378_c1 | 3300050493 | Bacteria | 5038 |
| 568 | nmdc:mga0k408_1923_c1 | 3300050493 | Bacteria | 11126 |
| 569 | nmdc:mga0k408_674_c1 | 3300050493 | Bacteria | 18724 |
| 570 | nmdc:mga06z11_24680_c1 | 3300050494 | Bacteria | 2840 |
| 571 | nmdc:mga04h51_17493_c1 | 3300050495 | Bacteria | 2098 |
| 572 | nmdc:mga07m45_1847_c1 | 3300050496 | Bacteria | 9784 |
| 573 | nmdc:mga07m45_64432_c1 | 3300050496 | Bacteria | 2080 |
| 574 | nmdc:mga07m45_67_c1 | 3300050496 | Bacteria | 40608 |
| 575 | nmdc:mga05p37_2159_c1 | 3300050507 | Bacteria | 22932 |
| 576 | nmdc:mga09592_116384_c1 | 3300050508 | Bacteria | 2294 |
| 577 | nmdc:mga09592_1272_c1 | 3300050508 | Bacteria | 20245 |
| 578 | nmdc:mga09592_4981_c1 | 3300050508 | Bacteria | 10766 |
| 579 | nmdc:mga0qj67_95144_c1 | 3300050509 | Bacteria | 2397 |
| 580 | nmdc:mga06r32_102221_c1 | 3300050510 | Bacteria | 2813 |
| 581 | nmdc:mga08y16_24628_c1 | 3300050511 | Bacteria | 6352 |
| 582 | nmdc:mga08y16_6286_c1 | 3300050511 | Bacteria | 12456 |
| 583 | nmdc:mga0n895_78702_c1 | 3300050512 | Bacteria | 3282 |
| 584 | nmdc:mga0rr50_23609_c1 | 3300050513 | Bacteria | 4244 |
| 585 | nmdc:mga0rr50_6074_c1 | 3300050513 | Bacteria | 7300 |
| 586 | nmdc:mga08x19_104198_c1 | 3300050514 | Bacteria | 1885 |
| 587 | nmdc:mga08x19_8685_c1 | 3300050514 | Bacteria | 6058 |
| 588 | nmdc:mga0a205_4256_c1 | 3300050515 | Bacteria | 12848 |
| 589 | Ga0500610_0009084 | 3300053079 | Bacteria | 4376 |
| 590 | Ga0500578_0000213 | 3300053086 | Bacteria | 71211 |
| 591 | Ga0500646_0002996 | 3300053090 | Bacteria | 4335 |
| 592 | Ga0500583_0014783 | 3300053092 | Bacteria | 3068 |
| 593 | Ga0500651_0155656 | 3300053093 | Bacteria | 1370 |
| 594 | Ga0500593_000422 | 3300053117 | Bacteria | 16701 |
| 595 | Ga0500593_000462 | 3300053117 | Bacteria | 16125 |
| 596 | Ga0500607_001465 | 3300053121 | Bacteria | 21347 |
| 597 | Ga0500652_000839 | 3300053131 | Bacteria | 10178 |
| 598 | Ga0500658_0018122 | 3300053134 | Bacteria | 2636 |
| 599 | Ga0500568_0016337 | 3300053139 | Bacteria | 3302 |
| 600 | Ga0500590_008920 | 3300053148 | Bacteria | 5025 |
| 601 | Ga0500619_000072 | 3300053154 | Bacteria | 29312 |
| 602 | Ga0500622_0003145 | 3300053156 | Bacteria | 11307 |
| 603 | Ga0500634_0032937 | 3300053161 | Bacteria | 2824 |
| 604 | Ga0501084_0077948 | 3300054114 | Bacteria | 2778 |
| 605 | Ga0501082_0147747 | 3300060353 | Bacteria | 2041 |
| 606 | Ga0466962_0006241 | 3300061719 | Bacteria | 5725 |
| 607 | Ga0466962_0012492 | 3300061719 | Bacteria | 4082 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041413 | Ga0439465_0054402 | Ga0439465_0054402_218_1291 | 357 |
| 2 | 3300042126 | Ga0450888_006183 | Ga0450888_006183_206_1279 | 357 |
| 3 | 3300048908 | Ga0496105_0319802 | Ga0496105_0319802_158_1231 | 357 |
| 4 | 3300049578 | Ga0501042_0215238 | Ga0501042_0215238_34_1257 | 359 |
| 5 | 3300006038 | Ga0075365_10036673 | Ga0075365_100366732 | 370 |
| 6 | 3300006042 | Ga0075368_10007889 | Ga0075368_100078893 | 370 |
| 7 | 3300006048 | Ga0075363_100009910 | Ga0075363_1000099104 | 370 |
| 8 | 3300006051 | Ga0075364_10058818 | Ga0075364_100588182 | 370 |
| 9 | 3300006178 | Ga0075367_10013104 | Ga0075367_100131042 | 370 |
| 10 | 3300006195 | Ga0075366_10017479 | Ga0075366_100174794 | 370 |
| 11 | 3300050491 | nmdc:mga00v17_162367_c1 | nmdc:mga00v17_162367_c1_23_1276 | 370 |
| 12 | 3300050495 | nmdc:mga04h51_17493_c1 | nmdc:mga04h51_17493_c1_164_1417 | 370 |
| 13 | 3300005548 | Ga0070665_100026163 | Ga0070665_1000261637 | 371 |
| 14 | 3300028379 | Ga0268266_10267656 | Ga0268266_102676561 | 371 |
| 15 | 3300006178 | Ga0075367_10162304 | Ga0075367_101623041 | 372 |
| 16 | 3300027907 | Ga0207428_10000624 | Ga0207428_100006249 | 373 |
| 17 | 3300035115 | Ga0373941_0030681 | Ga0373941_0030681_58_1281 | 373 |
| 18 | 3300048927 | Ga0496124_0000036 | Ga0496124_0000036_251168_252448 | 373 |
| 19 | 3300005330 | Ga0070690_100003369 | Ga0070690_1000033698 | 374 |
| 20 | 3300005334 | Ga0068869_100006668 | Ga0068869_1000066684 | 374 |
| 21 | 3300005338 | Ga0068868_100010982 | Ga0068868_1000109828 | 374 |
| 22 | 3300005340 | Ga0070689_100002360 | Ga0070689_1000023609 | 374 |
| 23 | 3300005364 | Ga0070673_100045204 | Ga0070673_1000452042 | 374 |
| 24 | 3300005438 | Ga0070701_10003296 | Ga0070701_100032962 | 374 |
| 25 | 3300005441 | Ga0070700_100010066 | Ga0070700_1000100664 | 374 |
| 26 | 3300005444 | Ga0070694_100016546 | Ga0070694_1000165464 | 374 |
| 27 | 3300005458 | Ga0070681_10248211 | Ga0070681_102482112 | 374 |
| 28 | 3300005459 | Ga0068867_100009496 | Ga0068867_1000094968 | 374 |
| 29 | 3300005544 | Ga0070686_100005616 | Ga0070686_1000056162 | 374 |
| 30 | 3300005545 | Ga0070695_100009100 | Ga0070695_1000091005 | 374 |
| 31 | 3300005546 | Ga0070696_100001380 | Ga0070696_10000138016 | 374 |
| 32 | 3300005547 | Ga0070693_100000208 | Ga0070693_10000020813 | 374 |
| 33 | 3300005547 | Ga0070693_100134238 | Ga0070693_1001342381 | 374 |
| 34 | 3300005549 | Ga0070704_100017542 | Ga0070704_1000175421 | 374 |
| 35 | 3300005563 | Ga0068855_100015728 | Ga0068855_10001572810 | 374 |
| 36 | 3300005614 | Ga0068856_100036287 | Ga0068856_1000362874 | 374 |
| 37 | 3300005615 | Ga0070702_100004253 | Ga0070702_1000042538 | 374 |
| 38 | 3300005617 | Ga0068859_100006943 | Ga0068859_1000069435 | 374 |
| 39 | 3300005718 | Ga0068866_10003990 | Ga0068866_100039905 | 374 |
| 40 | 3300005719 | Ga0068861_100065877 | Ga0068861_1000658772 | 374 |
| 41 | 3300005842 | Ga0068858_100003477 | Ga0068858_1000034773 | 374 |
| 42 | 3300005843 | Ga0068860_100006430 | Ga0068860_1000064305 | 374 |
| 43 | 3300005844 | Ga0068862_100007738 | Ga0068862_1000077388 | 374 |
| 44 | 3300006237 | Ga0097621_100006336 | Ga0097621_1000063369 | 374 |
| 45 | 3300006358 | Ga0068871_100000860 | Ga0068871_1000008607 | 374 |
| 46 | 3300006844 | Ga0075428_100004699 | Ga0075428_10000469911 | 374 |
| 47 | 3300006852 | Ga0075433_10018417 | Ga0075433_100184175 | 374 |
| 48 | 3300006871 | Ga0075434_100016509 | Ga0075434_1000165097 | 374 |
| 49 | 3300006880 | Ga0075429_100000786 | Ga0075429_10000078620 | 374 |
| 50 | 3300006881 | Ga0068865_100004558 | Ga0068865_1000045583 | 374 |
| 51 | 3300006914 | Ga0075436_100007561 | Ga0075436_1000075615 | 374 |
| 52 | 3300006931 | Ga0097620_100006944 | Ga0097620_1000069448 | 374 |
| 53 | 3300009094 | Ga0111539_10032268 | Ga0111539_100322688 | 374 |
| 54 | 3300009098 | Ga0105245_10020049 | Ga0105245_100200497 | 374 |
| 55 | 3300009148 | Ga0105243_10002743 | Ga0105243_100027432 | 374 |
| 56 | 3300009176 | Ga0105242_10003088 | Ga0105242_1000308814 | 374 |
| 57 | 3300009553 | Ga0105249_10016514 | Ga0105249_100165148 | 374 |
| 58 | 3300013297 | Ga0157378_10013173 | Ga0157378_100131739 | 374 |
| 59 | 3300025918 | Ga0207662_10000451 | Ga0207662_100004513 | 374 |
| 60 | 3300025921 | Ga0207652_10042969 | Ga0207652_100429695 | 374 |
| 61 | 3300025927 | Ga0207687_10003609 | Ga0207687_1000360913 | 374 |
| 62 | 3300025934 | Ga0207686_10012404 | Ga0207686_100124044 | 374 |
| 63 | 3300025935 | Ga0207709_10001689 | Ga0207709_100016892 | 374 |
| 64 | 3300025936 | Ga0207670_10004486 | Ga0207670_100044863 | 374 |
| 65 | 3300025942 | Ga0207689_10001368 | Ga0207689_1000136815 | 374 |
| 66 | 3300025949 | Ga0207667_10020298 | Ga0207667_100202982 | 374 |
| 67 | 3300025960 | Ga0207651_10067767 | Ga0207651_100677673 | 374 |
| 68 | 3300025961 | Ga0207712_10025840 | Ga0207712_100258404 | 374 |
| 69 | 3300026023 | Ga0207677_10006533 | Ga0207677_100065338 | 374 |
| 70 | 3300026035 | Ga0207703_10016330 | Ga0207703_100163303 | 374 |
| 71 | 3300026075 | Ga0207708_10000114 | Ga0207708_1000011428 | 374 |
| 72 | 3300026078 | Ga0207702_10060486 | Ga0207702_100604863 | 374 |
| 73 | 3300026088 | Ga0207641_10055731 | Ga0207641_100557312 | 374 |
| 74 | 3300026089 | Ga0207648_10003084 | Ga0207648_1000308417 | 374 |
| 75 | 3300026118 | Ga0207675_100004938 | Ga0207675_1000049383 | 374 |
| 76 | 3300028380 | Ga0268265_10130619 | Ga0268265_101306192 | 374 |
| 77 | 3300028381 | Ga0268264_10005385 | Ga0268264_100053852 | 374 |
| 78 | 3300028381 | Ga0268264_10105768 | Ga0268264_101057682 | 374 |
| 79 | 3300035088 | Ga0373940_0013014 | Ga0373940_0013014_471_1694 | 374 |
| 80 | 3300035112 | Ga0373932_0013913 | Ga0373932_0013913_608_1831 | 374 |
| 81 | 3300045051 | Ga0451576_0000220 | Ga0451576_0000220_42430_43653 | 374 |
| 82 | 3300050511 | nmdc:mga08y16_24628_c1 | nmdc:mga08y16_24628_c1_4528_5751 | 374 |
| 83 | 3300050512 | nmdc:mga0n895_78702_c1 | nmdc:mga0n895_78702_c1_672_1895 | 374 |
| 84 | 3300050513 | nmdc:mga0rr50_6074_c1 | nmdc:mga0rr50_6074_c1_2797_4020 | 374 |
| 85 | 3300050514 | nmdc:mga08x19_8685_c1 | nmdc:mga08x19_8685_c1_1930_3153 | 374 |
| 86 | 3300050515 | nmdc:mga0a205_4256_c1 | nmdc:mga0a205_4256_c1_11298_12521 | 374 |
| 87 | 3300032004 | Ga0307414_10089455 | Ga0307414_100894552 | 375 |
| 88 | 3300005467 | Ga0070706_100012975 | Ga0070706_1000129752 | 376 |
| 89 | 3300006195 | Ga0075366_10008365 | Ga0075366_100083653 | 376 |
| 90 | 3300025910 | Ga0207684_10039424 | Ga0207684_100394243 | 376 |
| 91 | 3300049588 | Ga0501072_0067174 | Ga0501072_0067174_1089_2312 | 376 |
| 92 | 3300035113 | Ga0373936_0008562 | Ga0373936_0008562_2072_3310 | 378 |
| 93 | 3300035116 | Ga0373945_0014220 | Ga0373945_0014220_1354_2592 | 378 |
| 94 | 3300035170 | Ga0373943_0009478 | Ga0373943_0009478_2932_4170 | 378 |
| 95 | 3300035692 | Ga0373935_0020327 | Ga0373935_0020327_766_2004 | 378 |
| 96 | 3300035725 | Ga0373947_0086584 | Ga0373947_0086584_235_1473 | 378 |
| 97 | 3300046455 | Ga0495603_0021192 | Ga0495603_0021192_2394_3632 | 378 |
| 98 | 3300046472 | Ga0495580_0010221 | Ga0495580_0010221_5904_7142 | 378 |
| 99 | 3300046473 | Ga0495582_0020920 | Ga0495582_0020920_156_1394 | 378 |
| 100 | 3300046535 | Ga0495586_0053035 | Ga0495586_0053035_60_1298 | 378 |
| 101 | 3300046674 | Ga0495588_0011820 | Ga0495588_0011820_2618_3856 | 378 |
| 102 | 3300046681 | Ga0495647_0000629 | Ga0495647_0000629_1638_2876 | 378 |
| 103 | 3300046683 | Ga0495658_0005679 | Ga0495658_0005679_3272_4510 | 378 |
| 104 | 3300047472 | Ga0495686_0134405 | Ga0495686_0134405_28_1287 | 378 |
| 105 | 3300006042 | Ga0075368_10046739 | Ga0075368_100467392 | 379 |
| 106 | 3300006847 | Ga0075431_100125543 | Ga0075431_1001255432 | 380 |
| 107 | 3300050510 | nmdc:mga06r32_102221_c1 | nmdc:mga06r32_102221_c1_277_1518 | 380 |
| 108 | 3300050511 | nmdc:mga08y16_6286_c1 | nmdc:mga08y16_6286_c1_7294_8568 | 380 |
| 109 | 3300009147 | Ga0114129_10042609 | Ga0114129_100426092 | 381 |
| 110 | 3300035242 | Ga0373962_0026958 | Ga0373962_0026958_234_1508 | 381 |
| 111 | 3300050507 | nmdc:mga05p37_2159_c1 | nmdc:mga05p37_2159_c1_6038_7312 | 381 |
| 112 | 3300050508 | nmdc:mga09592_1272_c1 | nmdc:mga09592_1272_c1_16361_17635 | 381 |
| 113 | 3300053092 | Ga0500583_0014783 | Ga0500583_0014783_89_1345 | 381 |
| 114 | 3300003792 | Ga0055540_1010338 | Ga0055540_10103383 | 382 |
| 115 | 3300003794 | Ga0055531_10004871 | Ga0055531_100048712 | 382 |
| 116 | 3300021361 | Ga0213872_10009186 | Ga0213872_100091864 | 382 |
| 117 | 3300025303 | Ga0209051_1000173 | Ga0209051_100017332 | 382 |
| 118 | 3300025304 | Ga0209257_1000096 | Ga0209257_100009641 | 382 |
| 119 | 3300025921 | Ga0207652_10045633 | Ga0207652_100456332 | 382 |
| 120 | 3300039447 | Ga0436361_0371412 | Ga0436361_0371412_14588_15841 | 382 |
| 121 | 3300037471 | Ga0395905_0234720 | Ga0395905_0234720_355_1608 | 383 |
| 122 | 3300037471 | Ga0395905_0270118 | Ga0395905_0270118_418_1572 | 384 |
| 123 | 3300005617 | Ga0068859_100012344 | Ga0068859_1000123442 | 385 |
| 124 | 3300005842 | Ga0068858_100006859 | Ga0068858_1000068596 | 385 |
| 125 | 3300005843 | Ga0068860_100007870 | Ga0068860_10000787015 | 385 |
| 126 | 3300006038 | Ga0075365_10014106 | Ga0075365_100141063 | 385 |
| 127 | 3300006931 | Ga0097620_100012344 | Ga0097620_1000123449 | 385 |
| 128 | 3300014326 | Ga0157380_10008226 | Ga0157380_100082269 | 385 |
| 129 | 3300021361 | Ga0213872_10000006 | Ga0213872_10000006223 | 385 |
| 130 | 3300021361 | Ga0213872_10001699 | Ga0213872_100016998 | 385 |
| 131 | 3300026035 | Ga0207703_10033407 | Ga0207703_100334073 | 385 |
| 132 | 3300039447 | Ga0436361_0215868 | Ga0436361_0215868_6848_8104 | 385 |
| 133 | 3300039447 | Ga0436361_0337087 | Ga0436361_0337087_6529_7785 | 385 |
| 134 | 3300006948 | Ga0099826_10000821 | Ga0099826_1000082110 | 386 |
| 135 | 3300025297 | Ga0209758_1000146 | Ga0209758_100014611 | 386 |
| 136 | 3300027666 | Ga0209282_1001176 | Ga0209282_100117611 | 386 |
| 137 | 3300053093 | Ga0500651_0155656 | Ga0500651_0155656_86_1342 | 386 |
| 138 | 3300042015 | Ga0439462_0000404 | Ga0439462_0000404_581_1834 | 387 |
| 139 | 3300042876 | Ga0451577_0060099 | Ga0451577_0060099_703_1956 | 387 |
| 140 | 3300044673 | Ga0453683_0008042 | Ga0453683_0008042_297_1550 | 387 |
| 141 | 3300044712 | Ga0453684_0296871 | Ga0453684_0296871_188_1441 | 387 |
| 142 | 3300045051 | Ga0451576_0024152 | Ga0451576_0024152_1078_2331 | 387 |
| 143 | 3300042439 | Ga0439464_0006437 | Ga0439464_0006437_1200_2453 | 388 |
| 144 | 3300005355 | Ga0070671_100047484 | Ga0070671_1000474842 | 390 |
| 145 | 3300006847 | Ga0075431_100183686 | Ga0075431_1001836863 | 390 |
| 146 | 3300006880 | Ga0075429_100091766 | Ga0075429_1000917662 | 390 |
| 147 | 3300009147 | Ga0114129_10049253 | Ga0114129_100492532 | 390 |
| 148 | 3300025931 | Ga0207644_10010073 | Ga0207644_100100733 | 390 |
| 149 | 3300025961 | Ga0207712_10061553 | Ga0207712_100615531 | 390 |
| 150 | 3300037312 | Ga0395899_0029996 | Ga0395899_0029996_1905_3158 | 390 |
| 151 | 3300037466 | Ga0395898_0037496 | Ga0395898_0037496_3040_4293 | 390 |
| 152 | 3300037471 | Ga0395905_0323256 | Ga0395905_0323256_161_1417 | 390 |
| 153 | 3300038443 | Ga0395901_0091140 | Ga0395901_0091140_175_1428 | 390 |
| 154 | 3300044658 | Ga0466972_0001197 | Ga0466972_0001197_10956_12212 | 390 |
| 155 | 3300048911 | Ga0496108_0013424 | Ga0496108_0013424_3675_4931 | 390 |
| 156 | 3300048912 | Ga0496109_0246606 | Ga0496109_0246606_303_1559 | 390 |
| 157 | 3300050508 | nmdc:mga09592_116384_c1 | nmdc:mga09592_116384_c1_746_1987 | 390 |
| 158 | 3300025931 | Ga0207644_10075627 | Ga0207644_100756272 | 391 |
| 159 | 3300031250 | Ga0265331_10003815 | Ga0265331_1000381510 | 391 |
| 160 | 3300031251 | Ga0265327_10000328 | Ga0265327_1000032811 | 391 |
| 161 | 3300035117 | Ga0373953_0007230 | Ga0373953_0007230_1625_2863 | 391 |
| 162 | 3300036401 | Ga0373937_0013036 | Ga0373937_0013036_22_1260 | 391 |
| 163 | 3300042127 | Ga0450890_005770 | Ga0450890_005770_97_1350 | 391 |
| 164 | 3300046519 | Ga0495632_0008077 | Ga0495632_0008077_4427_5653 | 391 |
| 165 | 3300049580 | Ga0501046_0000008 | Ga0501046_0000008_66983_68239 | 391 |
| 166 | 3300049581 | Ga0501047_0000003 | Ga0501047_0000003_90165_91421 | 391 |
| 167 | 3300049582 | Ga0501048_0000759 | Ga0501048_0000759_19210_20466 | 391 |
| 168 | 3300003759 | Ga0055525_1000031 | Ga0055525_1000031276 | 392 |
| 169 | 3300005295 | Ga0065707_10179379 | Ga0065707_101793791 | 392 |
| 170 | 3300006353 | Ga0075370_10018144 | Ga0075370_100181442 | 392 |
| 171 | 3300025230 | Ga0209563_100044 | Ga0209563_100044345 | 392 |
| 172 | 3300037471 | Ga0395905_0009246 | Ga0395905_0009246_594_1853 | 392 |
| 173 | 3300046522 | Ga0495643_0053068 | Ga0495643_0053068_213_1484 | 392 |
| 174 | 3300046694 | Ga0495649_0027103 | Ga0495649_0027103_620_1891 | 392 |
| 175 | 3300046810 | Ga0495660_0044493 | Ga0495660_0044493_1069_2340 | 392 |
| 176 | 3300047443 | Ga0495687_000500 | Ga0495687_000500_17460_18731 | 392 |
| 177 | 3300047443 | Ga0495687_001392 | Ga0495687_001392_9972_11243 | 392 |
| 178 | 3300047443 | Ga0495687_005890 | Ga0495687_005890_5373_6644 | 392 |
| 179 | 3300006353 | Ga0075370_10000276 | Ga0075370_1000027613 | 393 |
| 180 | 3300026142 | Ga0207698_10044424 | Ga0207698_100444243 | 393 |
| 181 | 3300049572 | Ga0501036_0098347 | Ga0501036_0098347_680_1921 | 393 |
| 182 | 3300049575 | Ga0501039_0115705 | Ga0501039_0115705_272_1513 | 393 |
| 183 | 3300049584 | Ga0501068_0057214 | Ga0501068_0057214_556_1797 | 393 |
| 184 | 3300049587 | Ga0501071_0007694 | Ga0501071_0007694_2162_3403 | 393 |
| 185 | 3300049588 | Ga0501072_0097805 | Ga0501072_0097805_497_1738 | 393 |
| 186 | 3300049591 | Ga0501075_0022897 | Ga0501075_0022897_1534_2775 | 393 |
| 187 | 3300049743 | Ga0501081_0093588 | Ga0501081_0093588_717_1958 | 393 |
| 188 | 3300050496 | nmdc:mga07m45_67_c1 | nmdc:mga07m45_67_c1_14996_16267 | 393 |
| 189 | 3300054114 | Ga0501084_0077948 | Ga0501084_0077948_871_2112 | 393 |
| 190 | 3300060353 | Ga0501082_0147747 | Ga0501082_0147747_618_1859 | 393 |
| 191 | 3300003187 | JGI25151J46595_10001626 | JGI25151J46595_100016264 | 394 |
| 192 | 3300005844 | Ga0068862_100040990 | Ga0068862_1000409902 | 394 |
| 193 | 3300009093 | Ga0105240_10003836 | Ga0105240_1000383613 | 394 |
| 194 | 3300009545 | Ga0105237_10001634 | Ga0105237_1000163411 | 394 |
| 195 | 3300010375 | Ga0105239_10002435 | Ga0105239_100024357 | 394 |
| 196 | 3300021361 | Ga0213872_10000132 | Ga0213872_1000013253 | 394 |
| 197 | 3300025924 | Ga0207694_10012902 | Ga0207694_100129022 | 394 |
| 198 | 3300025935 | Ga0207709_10041459 | Ga0207709_100414592 | 394 |
| 199 | 3300026041 | Ga0207639_10029251 | Ga0207639_100292513 | 394 |
| 200 | 3300039447 | Ga0436361_1206467 | Ga0436361_1206467_8581_9840 | 394 |
| 201 | 3300046471 | Ga0495650_0000976 | Ga0495650_0000976_13466_14737 | 394 |
| 202 | 3300048928 | Ga0496125_0128776 | Ga0496125_0128776_114_1370 | 394 |
| 203 | 3300003354 | JGI25160J50197_1013023 | JGI25160J50197_10130232 | 395 |
| 204 | 3300003761 | Ga0055535_1001453 | Ga0055535_10014532 | 395 |
| 205 | 3300003762 | Ga0055542_1001330 | Ga0055542_100133011 | 395 |
| 206 | 3300003762 | Ga0055542_1001423 | Ga0055542_10014236 | 395 |
| 207 | 3300003771 | Ga0055526_1003910 | Ga0055526_10039101 | 395 |
| 208 | 3300003771 | Ga0055526_1003992 | Ga0055526_10039925 | 395 |
| 209 | 3300003771 | Ga0055526_1006280 | Ga0055526_10062805 | 395 |
| 210 | 3300003773 | Ga0055537_1002046 | Ga0055537_10020463 | 395 |
| 211 | 3300003775 | Ga0055524_1000360 | Ga0055524_100036029 | 395 |
| 212 | 3300003781 | Ga0055536_1000889 | Ga0055536_10008898 | 395 |
| 213 | 3300003781 | Ga0055536_1004343 | Ga0055536_10043433 | 395 |
| 214 | 3300003784 | Ga0055534_1000386 | Ga0055534_100038616 | 395 |
| 215 | 3300003784 | Ga0055534_1002111 | Ga0055534_10021114 | 395 |
| 216 | 3300003792 | Ga0055540_1000393 | Ga0055540_100039310 | 395 |
| 217 | 3300005262 | Ga0065165_1007030 | Ga0065165_10070305 | 395 |
| 218 | 3300005564 | Ga0070664_100019354 | Ga0070664_1000193542 | 395 |
| 219 | 3300005834 | Ga0068851_10032784 | Ga0068851_100327841 | 395 |
| 220 | 3300006048 | Ga0075363_100085214 | Ga0075363_1000852141 | 395 |
| 221 | 3300006051 | Ga0075364_10019781 | Ga0075364_100197813 | 395 |
| 222 | 3300006195 | Ga0075366_10004350 | Ga0075366_100043508 | 395 |
| 223 | 3300006946 | Ga0079104_1000910 | Ga0079104_100091016 | 395 |
| 224 | 3300009148 | Ga0105243_10001150 | Ga0105243_100011505 | 395 |
| 225 | 3300009148 | Ga0105243_10018250 | Ga0105243_100182502 | 395 |
| 226 | 3300013307 | Ga0157372_10156911 | Ga0157372_101569112 | 395 |
| 227 | 3300014497 | Ga0182008_10000287 | Ga0182008_1000028720 | 395 |
| 228 | 3300015261 | Ga0182006_1011726 | Ga0182006_10117262 | 395 |
| 229 | 3300015262 | Ga0182007_10000736 | Ga0182007_100007369 | 395 |
| 230 | 3300025224 | Ga0209784_100516 | Ga0209784_10051610 | 395 |
| 231 | 3300025225 | Ga0209566_101242 | Ga0209566_1012425 | 395 |
| 232 | 3300025226 | Ga0209674_100179 | Ga0209674_10017954 | 395 |
| 233 | 3300025228 | Ga0209672_101105 | Ga0209672_1011059 | 395 |
| 234 | 3300025229 | Ga0209147_100741 | Ga0209147_1007413 | 395 |
| 235 | 3300025230 | Ga0209563_105942 | Ga0209563_1059422 | 395 |
| 236 | 3300025242 | Ga0209258_100009 | Ga0209258_100009950 | 395 |
| 237 | 3300025245 | Ga0207425_1000169 | Ga0207425_100016946 | 395 |
| 238 | 3300025246 | Ga0209646_1000022 | Ga0209646_1000022311 | 395 |
| 239 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007950 | 395 |
| 240 | 3300025254 | Ga0209148_1000021 | Ga0209148_1000021502 | 395 |
| 241 | 3300025256 | Ga0209759_1006726 | Ga0209759_10067262 | 395 |
| 242 | 3300025258 | Ga0209129_1000024 | Ga0209129_1000024127 | 395 |
| 243 | 3300025258 | Ga0209129_1003682 | Ga0209129_10036825 | 395 |
| 244 | 3300025258 | Ga0209129_1004780 | Ga0209129_10047803 | 395 |
| 245 | 3300025263 | Ga0209565_1000235 | Ga0209565_100023521 | 395 |
| 246 | 3300025263 | Ga0209565_1000286 | Ga0209565_10002867 | 395 |
| 247 | 3300025263 | Ga0209565_1000825 | Ga0209565_10008253 | 395 |
| 248 | 3300025273 | Ga0209673_1000410 | Ga0209673_100041039 | 395 |
| 249 | 3300025284 | Ga0209130_1000383 | Ga0209130_10003837 | 395 |
| 250 | 3300025291 | Ga0209675_1000125 | Ga0209675_100012529 | 395 |
| 251 | 3300025291 | Ga0209675_1000151 | Ga0209675_100015148 | 395 |
| 252 | 3300025291 | Ga0209675_1000312 | Ga0209675_100031229 | 395 |
| 253 | 3300025292 | Ga0209676_1000014 | Ga0209676_100001465 | 395 |
| 254 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028230 | 395 |
| 255 | 3300025292 | Ga0209676_1000275 | Ga0209676_10002757 | 395 |
| 256 | 3300025292 | Ga0209676_1000780 | Ga0209676_100078042 | 395 |
| 257 | 3300025294 | Ga0209025_1000379 | Ga0209025_100037916 | 395 |
| 258 | 3300025294 | Ga0209025_1001571 | Ga0209025_100157112 | 395 |
| 259 | 3300025294 | Ga0209025_1001709 | Ga0209025_100170911 | 395 |
| 260 | 3300025294 | Ga0209025_1013208 | Ga0209025_10132084 | 395 |
| 261 | 3300025295 | Ga0209564_1000209 | Ga0209564_100020945 | 395 |
| 262 | 3300025295 | Ga0209564_1001235 | Ga0209564_100123513 | 395 |
| 263 | 3300025295 | Ga0209564_1001259 | Ga0209564_100125916 | 395 |
| 264 | 3300025295 | Ga0209564_1002311 | Ga0209564_10023118 | 395 |
| 265 | 3300025297 | Ga0209758_1000049 | Ga0209758_100004946 | 395 |
| 266 | 3300025298 | Ga0209050_1000002 | Ga0209050_100000213 | 395 |
| 267 | 3300025298 | Ga0209050_1029450 | Ga0209050_10294501 | 395 |
| 268 | 3300025299 | Ga0209256_1000253 | Ga0209256_100025328 | 395 |
| 269 | 3300025299 | Ga0209256_1000291 | Ga0209256_100029110 | 395 |
| 270 | 3300025299 | Ga0209256_1000700 | Ga0209256_10007009 | 395 |
| 271 | 3300025302 | Ga0207426_1000053 | Ga0207426_100005382 | 395 |
| 272 | 3300025303 | Ga0209051_1000015 | Ga0209051_1000015159 | 395 |
| 273 | 3300025303 | Ga0209051_1000531 | Ga0209051_100053132 | 395 |
| 274 | 3300025303 | Ga0209051_1015948 | Ga0209051_10159483 | 395 |
| 275 | 3300025304 | Ga0209257_1001928 | Ga0209257_10019285 | 395 |
| 276 | 3300025304 | Ga0209257_1006537 | Ga0209257_10065375 | 395 |
| 277 | 3300025728 | Ga0207655_1006582 | Ga0207655_10065822 | 395 |
| 278 | 3300025933 | Ga0207706_10034273 | Ga0207706_100342735 | 395 |
| 279 | 3300025935 | Ga0207709_10000211 | Ga0207709_1000021170 | 395 |
| 280 | 3300025935 | Ga0207709_10004882 | Ga0207709_100048822 | 395 |
| 281 | 3300026067 | Ga0207678_10173229 | Ga0207678_101732292 | 395 |
| 282 | 3300026116 | Ga0207674_10039486 | Ga0207674_100394862 | 395 |
| 283 | 3300027111 | Ga0209281_1000195 | Ga0209281_100019552 | 395 |
| 284 | 3300031731 | Ga0307405_10019331 | Ga0307405_100193312 | 395 |
| 285 | 3300041411 | Ga0439466_0011362 | Ga0439466_0011362_335_1591 | 395 |
| 286 | 3300042125 | Ga0450923_000865 | Ga0450923_000865_2208_3464 | 395 |
| 287 | 3300042184 | Ga0450908_001881 | Ga0450908_001881_1768_3024 | 395 |
| 288 | 3300042435 | Ga0439434_0020281 | Ga0439434_0020281_371_1627 | 395 |
| 289 | 3300042876 | Ga0451577_0005895 | Ga0451577_0005895_8905_10173 | 395 |
| 290 | 3300044656 | Ga0466969_0009596 | Ga0466969_0009596_733_2022 | 395 |
| 291 | 3300044683 | Ga0466965_0032924 | Ga0466965_0032924_370_1620 | 395 |
| 292 | 3300044684 | Ga0466966_0097031 | Ga0466966_0097031_329_1618 | 395 |
| 293 | 3300044693 | Ga0466961_0002008 | Ga0466961_0002008_9675_10925 | 395 |
| 294 | 3300044706 | Ga0466964_0001102 | Ga0466964_0001102_6729_7979 | 395 |
| 295 | 3300044735 | Ga0466968_0020759 | Ga0466968_0020759_1207_2457 | 395 |
| 296 | 3300045049 | Ga0466959_0002786 | Ga0466959_0002786_1728_2978 | 395 |
| 297 | 3300045049 | Ga0466959_0017291 | Ga0466959_0017291_178_1467 | 395 |
| 298 | 3300045976 | Ga0466967_0032384 | Ga0466967_0032384_1434_2684 | 395 |
| 299 | 3300046513 | Ga0495616_0000675 | Ga0495616_0000675_14945_16201 | 395 |
| 300 | 3300046660 | Ga0495625_0000611 | Ga0495625_0000611_43021_44277 | 395 |
| 301 | 3300048905 | Ga0496102_0014103 | Ga0496102_0014103_1318_2583 | 395 |
| 302 | 3300048919 | Ga0496116_0011195 | Ga0496116_0011195_786_2042 | 395 |
| 303 | 3300048921 | Ga0496118_0007164 | Ga0496118_0007164_1528_2784 | 395 |
| 304 | 3300050491 | nmdc:mga00v17_7516_c1 | nmdc:mga00v17_7516_c1_751_2007 | 395 |
| 305 | 3300050493 | nmdc:mga0k408_1923_c1 | nmdc:mga0k408_1923_c1_5971_7227 | 395 |
| 306 | 3300050496 | nmdc:mga07m45_1847_c1 | nmdc:mga07m45_1847_c1_6229_7485 | 395 |
| 307 | 3300053086 | Ga0500578_0000213 | Ga0500578_0000213_19427_20665 | 395 |
| 308 | 3300061719 | Ga0466962_0006241 | Ga0466962_0006241_4425_5675 | 395 |
| 309 | iso_pu_bacteria | 2513237150 | 2513952918 | 395 |
| 310 | iso_pu_bacteria | 2513237165 | 2514042433 | 395 |
| 311 | iso_pu_bacteria | 2834641062 | 2834641808 | 395 |
| 312 | iso_pu_bacteria | 2885266251 | 2885266863 | 395 |
| 313 | iso_pu_bacteria | 2928058823 | 2928062821 | 395 |
| 314 | iso_pu_bacteria | 644736347 | 644747467 | 395 |
| 315 | iso_pu_bacteria | 8003400568 | 8003404648 | 395 |
| 316 | 3300006948 | Ga0099826_10000004 | Ga0099826_10000004469 | 396 |
| 317 | 3300025294 | Ga0209025_1000423 | Ga0209025_100042355 | 396 |
| 318 | 3300027666 | Ga0209282_1000027 | Ga0209282_100002720 | 396 |
| 319 | 3300037471 | Ga0395905_0022801 | Ga0395905_0022801_3049_4305 | 396 |
| 320 | 3300042007 | Ga0439449_0013872 | Ga0439449_0013872_705_1961 | 396 |
| 321 | 3300042876 | Ga0451577_0022122 | Ga0451577_0022122_397_1662 | 396 |
| 322 | 3300045051 | Ga0451576_0340532 | Ga0451576_0340532_161_1417 | 396 |
| 323 | 3300046474 | Ga0495605_0000836 | Ga0495605_0000836_9190_10479 | 396 |
| 324 | 3300046491 | Ga0495584_0027555 | Ga0495584_0027555_1139_2428 | 396 |
| 325 | 3300046500 | Ga0495596_0000574 | Ga0495596_0000574_6090_7379 | 396 |
| 326 | 3300046501 | Ga0495607_0010311 | Ga0495607_0010311_1645_2934 | 396 |
| 327 | 3300046512 | Ga0495610_0003801 | Ga0495610_0003801_7816_9105 | 396 |
| 328 | 3300046692 | Ga0495671_0000883 | Ga0495671_0000883_15425_16714 | 396 |
| 329 | 3300046694 | Ga0495649_0028621 | Ga0495649_0028621_1519_2808 | 396 |
| 330 | 3300048905 | Ga0496102_0044454 | Ga0496102_0044454_180_1436 | 396 |
| 331 | 3300048919 | Ga0496116_0003117 | Ga0496116_0003117_1375_2664 | 396 |
| 332 | 3300048924 | Ga0496121_0018310 | Ga0496121_0018310_186_1475 | 396 |
| 333 | 3300049575 | Ga0501039_0152263 | Ga0501039_0152263_261_1517 | 396 |
| 334 | 3300049591 | Ga0501075_0090428 | Ga0501075_0090428_796_2052 | 396 |
| 335 | 3300053117 | Ga0500593_000462 | Ga0500593_000462_12849_14105 | 396 |
| 336 | iso_pu_bacteria | 2839138175 | 2839142578 | 396 |
| 337 | 3300005536 | Ga0070697_100114875 | Ga0070697_1001148752 | 397 |
| 338 | 3300005545 | Ga0070695_100011804 | Ga0070695_1000118043 | 397 |
| 339 | 3300005546 | Ga0070696_100013721 | Ga0070696_1000137213 | 397 |
| 340 | 3300006173 | Ga0070716_100115045 | Ga0070716_1001150452 | 397 |
| 341 | 3300025933 | Ga0207706_10001386 | Ga0207706_1000138612 | 397 |
| 342 | 3300025939 | Ga0207665_10086928 | Ga0207665_100869282 | 397 |
| 343 | 3300031507 | Ga0307509_10000031 | Ga0307509_10000031126 | 397 |
| 344 | 3300032002 | Ga0307416_100122804 | Ga0307416_1001228042 | 397 |
| 345 | 3300037471 | Ga0395905_0004785 | Ga0395905_0004785_4415_5668 | 397 |
| 346 | 3300050513 | nmdc:mga0rr50_23609_c1 | nmdc:mga0rr50_23609_c1_587_1828 | 397 |
| 347 | 3300050514 | nmdc:mga08x19_104198_c1 | nmdc:mga08x19_104198_c1_262_1503 | 397 |
| 348 | iso_pu_bacteria | 2513020051 | 2513231245 | 397 |
| 349 | iso_pu_bacteria | 2585428057 | 2587724856 | 397 |
| 350 | iso_pu_bacteria | 2585428058 | 2587736737 | 397 |
| 351 | iso_pu_bacteria | 2588253510 | 2588295347 | 397 |
| 352 | iso_pu_bacteria | 2599185214 | 2599620533 | 397 |
| 353 | iso_pu_bacteria | 2599185226 | 2599673831 | 397 |
| 354 | iso_pu_bacteria | 2599185227 | 2599678852 | 397 |
| 355 | iso_pu_bacteria | 2599185229 | 2599690043 | 397 |
| 356 | iso_pu_bacteria | 2643221585 | 2643936437 | 397 |
| 357 | iso_pu_bacteria | 2643221592 | 2643970219 | 397 |
| 358 | iso_pu_bacteria | 2643221625 | 2644142383 | 397 |
| 359 | iso_pu_bacteria | 2643221628 | 2644162209 | 397 |
| 360 | iso_pu_bacteria | 2643221644 | 2644246997 | 397 |
| 361 | iso_pu_bacteria | 2643221648 | 2644275151 | 397 |
| 362 | iso_pu_bacteria | 2643221656 | 2644317793 | 397 |
| 363 | iso_pu_bacteria | 2643221658 | 2644324344 | 397 |
| 364 | iso_pu_bacteria | 2643221660 | 2644338178 | 397 |
| 365 | iso_pu_bacteria | 2643221672 | 2644396188 | 397 |
| 366 | iso_pu_bacteria | 2643221683 | 2644464816 | 397 |
| 367 | iso_pu_bacteria | 2738541277 | 2738720427 | 397 |
| 368 | iso_pu_bacteria | 2738541307 | 2738880356 | 397 |
| 369 | iso_pu_bacteria | 2738543013 | 2739248012 | 397 |
| 370 | iso_pu_bacteria | 2738543019 | 2739279626 | 397 |
| 371 | iso_pu_bacteria | 2818991446 | 2819601109 | 397 |
| 372 | iso_pu_bacteria | 2831265667 | 2831271578 | 397 |
| 373 | iso_pu_bacteria | 2838054893 | 2838055480 | 397 |
| 374 | iso_pu_bacteria | 2842677519 | 2842682098 | 397 |
| 375 | iso_pu_bacteria | 2842733646 | 2842734163 | 397 |
| 376 | iso_pu_bacteria | 2842747753 | 2842749577 | 397 |
| 377 | iso_pu_bacteria | 2885192300 | 2885193138 | 397 |
| 378 | iso_pu_bacteria | 2885198086 | 2885200986 | 397 |
| 379 | iso_pu_bacteria | 2885211737 | 2885214231 | 397 |
| 380 | iso_pu_bacteria | 2899924645 | 2899927544 | 397 |
| 381 | iso_pu_bacteria | 2904449895 | 2904450723 | 397 |
| 382 | iso_pu_bacteria | 2904456579 | 2904459777 | 397 |
| 383 | iso_pu_bacteria | 2904479285 | 2904483518 | 397 |
| 384 | iso_pu_bacteria | 2904541872 | 2904547917 | 397 |
| 385 | iso_pu_bacteria | 2919462493 | 2919462747 | 397 |
| 386 | iso_pu_bacteria | 2928037797 | 2928042543 | 397 |
| 387 | iso_pu_bacteria | 2928044640 | 2928049030 | 397 |
| 388 | iso_pu_bacteria | 2928051484 | 2928051581 | 397 |
| 389 | iso_pu_bacteria | 2928064002 | 2928070803 | 397 |
| 390 | iso_pu_bacteria | 2928070936 | 2928073212 | 397 |
| 391 | iso_pu_bacteria | 2928084124 | 2928086972 | 397 |
| 392 | iso_pu_bacteria | 2928115317 | 2928115480 | 397 |
| 393 | iso_pu_bacteria | 2929160207 | 2929161702 | 397 |
| 394 | iso_pu_bacteria | 2929520902 | 2929521441 | 397 |
| 395 | iso_pu_bacteria | 2932422444 | 2932425338 | 397 |
| 396 | iso_pu_bacteria | 2945909444 | 2945913906 | 397 |
| 397 | iso_pu_bacteria | 2945945610 | 2945949453 | 397 |
| 398 | iso_pu_bacteria | 2945972063 | 2945973500 | 397 |
| 399 | iso_pu_bacteria | 2945984333 | 2945990696 | 397 |
| 400 | iso_pu_bacteria | 2954767861 | 2954770893 | 397 |
| 401 | 3300030521 | Ga0307511_10000248 | Ga0307511_1000024827 | 398 |
| 402 | 3300031852 | Ga0307410_10103386 | Ga0307410_101033862 | 398 |
| 403 | 3300042007 | Ga0439449_0021363 | Ga0439449_0021363_167_1420 | 398 |
| 404 | 3300005328 | Ga0070676_10013767 | Ga0070676_100137673 | 399 |
| 405 | 3300005331 | Ga0070670_100015056 | Ga0070670_1000150565 | 399 |
| 406 | 3300005334 | Ga0068869_100033907 | Ga0068869_1000339075 | 399 |
| 407 | 3300005353 | Ga0070669_100005917 | Ga0070669_1000059176 | 399 |
| 408 | 3300005354 | Ga0070675_100058026 | Ga0070675_1000580263 | 399 |
| 409 | 3300005355 | Ga0070671_100166738 | Ga0070671_1001667382 | 399 |
| 410 | 3300005356 | Ga0070674_100000568 | Ga0070674_10000056811 | 399 |
| 411 | 3300005356 | Ga0070674_100011792 | Ga0070674_1000117927 | 399 |
| 412 | 3300005459 | Ga0068867_100007834 | Ga0068867_1000078344 | 399 |
| 413 | 3300005543 | Ga0070672_100039019 | Ga0070672_1000390193 | 399 |
| 414 | 3300005564 | Ga0070664_100264621 | Ga0070664_1002646211 | 399 |
| 415 | 3300005578 | Ga0068854_100026600 | Ga0068854_1000266003 | 399 |
| 416 | 3300005616 | Ga0068852_100098873 | Ga0068852_1000988732 | 399 |
| 417 | 3300005719 | Ga0068861_100064370 | Ga0068861_1000643702 | 399 |
| 418 | 3300005843 | Ga0068860_100000968 | Ga0068860_1000009689 | 399 |
| 419 | 3300005844 | Ga0068862_100005951 | Ga0068862_1000059514 | 399 |
| 420 | 3300006195 | Ga0075366_10007203 | Ga0075366_100072033 | 399 |
| 421 | 3300006358 | Ga0068871_100024514 | Ga0068871_1000245142 | 399 |
| 422 | 3300006880 | Ga0075429_100002300 | Ga0075429_1000023006 | 399 |
| 423 | 3300014969 | Ga0157376_10079429 | Ga0157376_100794292 | 399 |
| 424 | 3300017792 | Ga0163161_10010411 | Ga0163161_100104113 | 399 |
| 425 | 3300025893 | Ga0207682_10003641 | Ga0207682_100036417 | 399 |
| 426 | 3300025899 | Ga0207642_10041594 | Ga0207642_100415942 | 399 |
| 427 | 3300025907 | Ga0207645_10024778 | Ga0207645_100247784 | 399 |
| 428 | 3300025907 | Ga0207645_10043333 | Ga0207645_100433331 | 399 |
| 429 | 3300025923 | Ga0207681_10005519 | Ga0207681_100055196 | 399 |
| 430 | 3300025925 | Ga0207650_10000265 | Ga0207650_100002658 | 399 |
| 431 | 3300025926 | Ga0207659_10001160 | Ga0207659_100011604 | 399 |
| 432 | 3300025935 | Ga0207709_10037486 | Ga0207709_100374862 | 399 |
| 433 | 3300025940 | Ga0207691_10000390 | Ga0207691_1000039067 | 399 |
| 434 | 3300025940 | Ga0207691_10029711 | Ga0207691_100297113 | 399 |
| 435 | 3300026089 | Ga0207648_10000789 | Ga0207648_1000078918 | 399 |
| 436 | 3300026089 | Ga0207648_10005196 | Ga0207648_100051964 | 399 |
| 437 | 3300026089 | Ga0207648_10027223 | Ga0207648_100272232 | 399 |
| 438 | 3300026118 | Ga0207675_100004863 | Ga0207675_10000486313 | 399 |
| 439 | 3300026121 | Ga0207683_10058744 | Ga0207683_100587443 | 399 |
| 440 | 3300028381 | Ga0268264_10042331 | Ga0268264_100423313 | 399 |
| 441 | 3300031548 | Ga0307408_100172309 | Ga0307408_1001723092 | 399 |
| 442 | 3300031731 | Ga0307405_10000483 | Ga0307405_1000048313 | 399 |
| 443 | 3300031824 | Ga0307413_10016227 | Ga0307413_100162273 | 399 |
| 444 | 3300031903 | Ga0307407_10008666 | Ga0307407_100086662 | 399 |
| 445 | 3300032004 | Ga0307414_10035226 | Ga0307414_100352264 | 399 |
| 446 | 3300032005 | Ga0307411_10037345 | Ga0307411_100373452 | 399 |
| 447 | 3300041997 | Ga0439431_0016410 | Ga0439431_0016410_14_1270 | 399 |
| 448 | 3300042876 | Ga0451577_0172188 | Ga0451577_0172188_632_1888 | 399 |
| 449 | 3300044683 | Ga0466965_0018707 | Ga0466965_0018707_176_1432 | 399 |
| 450 | 3300044693 | Ga0466961_0100650 | Ga0466961_0100650_496_1752 | 399 |
| 451 | 3300044719 | Ga0466971_0027410 | Ga0466971_0027410_779_2035 | 399 |
| 452 | 3300044735 | Ga0466968_0051879 | Ga0466968_0051879_217_1473 | 399 |
| 453 | 3300044765 | Ga0466970_0011713 | Ga0466970_0011713_1186_2442 | 399 |
| 454 | 3300045836 | Ga0466958_0092531 | Ga0466958_0092531_374_1630 | 399 |
| 455 | 3300046457 | Ga0495590_0010806 | Ga0495590_0010806_1125_2483 | 399 |
| 456 | 3300049649 | Ga0501198_000014 | Ga0501198_000014_28824_30080 | 399 |
| 457 | 3300049662 | Ga0501222_000008 | Ga0501222_000008_74404_75660 | 399 |
| 458 | 3300050493 | nmdc:mga0k408_10378_c1 | nmdc:mga0k408_10378_c1_838_2094 | 399 |
| 459 | 3300050508 | nmdc:mga09592_4981_c1 | nmdc:mga09592_4981_c1_4211_5467 | 399 |
| 460 | 3300050509 | nmdc:mga0qj67_95144_c1 | nmdc:mga0qj67_95144_c1_1083_2339 | 399 |
| 461 | 3300061719 | Ga0466962_0012492 | Ga0466962_0012492_829_2085 | 399 |
| 462 | 3300005530 | Ga0070679_100230249 | Ga0070679_1002302492 | 400 |
| 463 | 3300006051 | Ga0075364_10000943 | Ga0075364_100009433 | 400 |
| 464 | 3300006195 | Ga0075366_10065013 | Ga0075366_100650132 | 400 |
| 465 | 3300006946 | Ga0079104_1000055 | Ga0079104_1000055122 | 400 |
| 466 | 3300009148 | Ga0105243_10007469 | Ga0105243_100074695 | 400 |
| 467 | 3300009176 | Ga0105242_10000304 | Ga0105242_1000030431 | 400 |
| 468 | 3300025273 | Ga0209673_1015346 | Ga0209673_10153463 | 400 |
| 469 | 3300025920 | Ga0207649_10064964 | Ga0207649_100649642 | 400 |
| 470 | 3300025934 | Ga0207686_10001386 | Ga0207686_100013863 | 400 |
| 471 | 3300025935 | Ga0207709_10000273 | Ga0207709_1000027326 | 400 |
| 472 | 3300027111 | Ga0209281_1000007 | Ga0209281_1000007707 | 400 |
| 473 | 3300028794 | Ga0307515_10000132 | Ga0307515_1000013273 | 400 |
| 474 | 3300031239 | Ga0265328_10002207 | Ga0265328_100022075 | 400 |
| 475 | 3300031251 | Ga0265327_10000341 | Ga0265327_1000034137 | 400 |
| 476 | 3300031456 | Ga0307513_10012051 | Ga0307513_100120519 | 400 |
| 477 | 3300031548 | Ga0307408_100062988 | Ga0307408_1000629883 | 400 |
| 478 | 3300031711 | Ga0265314_10006635 | Ga0265314_100066354 | 400 |
| 479 | 3300031711 | Ga0265314_10025632 | Ga0265314_100256324 | 400 |
| 480 | 3300037312 | Ga0395899_0163687 | Ga0395899_0163687_46_1335 | 400 |
| 481 | 3300037418 | Ga0395900_0031313 | Ga0395900_0031313_2786_4075 | 400 |
| 482 | 3300037466 | Ga0395898_0022575 | Ga0395898_0022575_1611_2900 | 400 |
| 483 | 3300037466 | Ga0395898_0211872 | Ga0395898_0211872_371_1633 | 400 |
| 484 | 3300037471 | Ga0395905_0000025 | Ga0395905_0000025_200792_202045 | 400 |
| 485 | 3300037471 | Ga0395905_0000460 | Ga0395905_0000460_30681_31970 | 400 |
| 486 | 3300037471 | Ga0395905_0016841 | Ga0395905_0016841_4424_5677 | 400 |
| 487 | 3300037471 | Ga0395905_0023364 | Ga0395905_0023364_1877_3166 | 400 |
| 488 | 3300037471 | Ga0395905_0025632 | Ga0395905_0025632_4061_5350 | 400 |
| 489 | 3300037471 | Ga0395905_0040137 | Ga0395905_0040137_1883_3172 | 400 |
| 490 | 3300037471 | Ga0395905_0122647 | Ga0395905_0122647_539_1828 | 400 |
| 491 | 3300037471 | Ga0395905_0174150 | Ga0395905_0174150_583_1836 | 400 |
| 492 | 3300038443 | Ga0395901_0134674 | Ga0395901_0134674_1198_2487 | 400 |
| 493 | 3300044735 | Ga0466968_0015723 | Ga0466968_0015723_1513_2826 | 400 |
| 494 | 3300045976 | Ga0466967_0156104 | Ga0466967_0156104_561_1814 | 400 |
| 495 | 3300048925 | Ga0496122_0009675 | Ga0496122_0009675_2181_3434 | 400 |
| 496 | 3300048929 | Ga0496126_0006539 | Ga0496126_0006539_5090_6343 | 400 |
| 497 | 3300049573 | Ga0501037_0187924 | Ga0501037_0187924_74_1327 | 400 |
| 498 | iso_pu_bacteria | 2721755523 | 2722882066 | 400 |
| 499 | 3300002773 | JGI25152J39213_1006822 | JGI25152J39213_10068223 | 401 |
| 500 | 3300002774 | JGI25150J39212_1007356 | JGI25150J39212_10073562 | 401 |
| 501 | 3300003187 | JGI25151J46595_10002427 | JGI25151J46595_100024276 | 401 |
| 502 | 3300003771 | Ga0055526_1001897 | Ga0055526_100189712 | 401 |
| 503 | 3300003775 | Ga0055524_1000125 | Ga0055524_100012528 | 401 |
| 504 | 3300003784 | Ga0055534_1000986 | Ga0055534_100098613 | 401 |
| 505 | 3300003791 | Ga0055530_10016267 | Ga0055530_100162672 | 401 |
| 506 | 3300003792 | Ga0055540_1000011 | Ga0055540_100001153 | 401 |
| 507 | 3300003794 | Ga0055531_10004809 | Ga0055531_100048097 | 401 |
| 508 | 3300005262 | Ga0065165_1000967 | Ga0065165_100096714 | 401 |
| 509 | 3300005335 | Ga0070666_10000930 | Ga0070666_1000093031 | 401 |
| 510 | 3300005338 | Ga0068868_100001477 | Ga0068868_1000014772 | 401 |
| 511 | 3300005353 | Ga0070669_100036437 | Ga0070669_1000364372 | 401 |
| 512 | 3300005354 | Ga0070675_100044883 | Ga0070675_1000448832 | 401 |
| 513 | 3300005354 | Ga0070675_100060990 | Ga0070675_1000609902 | 401 |
| 514 | 3300005354 | Ga0070675_100091473 | Ga0070675_1000914732 | 401 |
| 515 | 3300005355 | Ga0070671_100041655 | Ga0070671_1000416552 | 401 |
| 516 | 3300005355 | Ga0070671_100060329 | Ga0070671_1000603292 | 401 |
| 517 | 3300005367 | Ga0070667_100051456 | Ga0070667_1000514562 | 401 |
| 518 | 3300005455 | Ga0070663_100001074 | Ga0070663_10000107415 | 401 |
| 519 | 3300005456 | Ga0070678_100000637 | Ga0070678_10000063723 | 401 |
| 520 | 3300005459 | Ga0068867_100068184 | Ga0068867_1000681843 | 401 |
| 521 | 3300005467 | Ga0070706_100259610 | Ga0070706_1002596101 | 401 |
| 522 | 3300005543 | Ga0070672_100031460 | Ga0070672_1000314603 | 401 |
| 523 | 3300005543 | Ga0070672_100093361 | Ga0070672_1000933612 | 401 |
| 524 | 3300005563 | Ga0068855_100431198 | Ga0068855_1004311981 | 401 |
| 525 | 3300005564 | Ga0070664_100017715 | Ga0070664_1000177153 | 401 |
| 526 | 3300005577 | Ga0068857_100089073 | Ga0068857_1000890732 | 401 |
| 527 | 3300005616 | Ga0068852_100020418 | Ga0068852_1000204184 | 401 |
| 528 | 3300005617 | Ga0068859_100001613 | Ga0068859_10000161336 | 401 |
| 529 | 3300005618 | Ga0068864_100039622 | Ga0068864_1000396222 | 401 |
| 530 | 3300005618 | Ga0068864_100133915 | Ga0068864_1001339152 | 401 |
| 531 | 3300005718 | Ga0068866_10058733 | Ga0068866_100587332 | 401 |
| 532 | 3300005841 | Ga0068863_100006228 | Ga0068863_1000062284 | 401 |
| 533 | 3300005842 | Ga0068858_100007536 | Ga0068858_10000753612 | 401 |
| 534 | 3300005844 | Ga0068862_100049190 | Ga0068862_1000491905 | 401 |
| 535 | 3300006038 | Ga0075365_10178564 | Ga0075365_101785641 | 401 |
| 536 | 3300006042 | Ga0075368_10008999 | Ga0075368_100089993 | 401 |
| 537 | 3300006048 | Ga0075363_100053231 | Ga0075363_1000532311 | 401 |
| 538 | 3300006178 | Ga0075367_10028385 | Ga0075367_100283852 | 401 |
| 539 | 3300006195 | Ga0075366_10005284 | Ga0075366_100052847 | 401 |
| 540 | 3300006931 | Ga0097620_100001613 | Ga0097620_1000016135 | 401 |
| 541 | 3300009148 | Ga0105243_10250372 | Ga0105243_102503722 | 401 |
| 542 | 3300009177 | Ga0105248_10022695 | Ga0105248_100226955 | 401 |
| 543 | 3300013308 | Ga0157375_10062266 | Ga0157375_100622664 | 401 |
| 544 | 3300014325 | Ga0163163_10061335 | Ga0163163_100613352 | 401 |
| 545 | 3300014497 | Ga0182008_10010682 | Ga0182008_100106823 | 401 |
| 546 | 3300014968 | Ga0157379_10050576 | Ga0157379_100505763 | 401 |
| 547 | 3300015262 | Ga0182007_10001789 | Ga0182007_100017893 | 401 |
| 548 | 3300017792 | Ga0163161_10000088 | Ga0163161_1000008836 | 401 |
| 549 | 3300017792 | Ga0163161_10080858 | Ga0163161_100808581 | 401 |
| 550 | 3300021361 | Ga0213872_10000004 | Ga0213872_100000049 | 401 |
| 551 | 3300025245 | Ga0207425_1001454 | Ga0207425_10014548 | 401 |
| 552 | 3300025258 | Ga0209129_1000027 | Ga0209129_100002734 | 401 |
| 553 | 3300025273 | Ga0209673_1004437 | Ga0209673_10044373 | 401 |
| 554 | 3300025284 | Ga0209130_1004634 | Ga0209130_10046342 | 401 |
| 555 | 3300025291 | Ga0209675_1001004 | Ga0209675_10010049 | 401 |
| 556 | 3300025292 | Ga0209676_1009775 | Ga0209676_10097753 | 401 |
| 557 | 3300025294 | Ga0209025_1000289 | Ga0209025_100028985 | 401 |
| 558 | 3300025295 | Ga0209564_1000139 | Ga0209564_100013925 | 401 |
| 559 | 3300025297 | Ga0209758_1000052 | Ga0209758_100005286 | 401 |
| 560 | 3300025298 | Ga0209050_1000583 | Ga0209050_10005832 | 401 |
| 561 | 3300025298 | Ga0209050_1000980 | Ga0209050_10009804 | 401 |
| 562 | 3300025299 | Ga0209256_1000113 | Ga0209256_100011370 | 401 |
| 563 | 3300025303 | Ga0209051_1000020 | Ga0209051_100002052 | 401 |
| 564 | 3300025303 | Ga0209051_1043986 | Ga0209051_10439862 | 401 |
| 565 | 3300025304 | Ga0209257_1000085 | Ga0209257_100008552 | 401 |
| 566 | 3300025304 | Ga0209257_1008315 | Ga0209257_10083153 | 401 |
| 567 | 3300025893 | Ga0207682_10017191 | Ga0207682_100171912 | 401 |
| 568 | 3300025903 | Ga0207680_10006275 | Ga0207680_100062752 | 401 |
| 569 | 3300025926 | Ga0207659_10031008 | Ga0207659_100310082 | 401 |
| 570 | 3300025926 | Ga0207659_10211516 | Ga0207659_102115162 | 401 |
| 571 | 3300025931 | Ga0207644_10035747 | Ga0207644_100357472 | 401 |
| 572 | 3300025940 | Ga0207691_10065242 | Ga0207691_100652425 | 401 |
| 573 | 3300025940 | Ga0207691_10123800 | Ga0207691_101238003 | 401 |
| 574 | 3300025941 | Ga0207711_10008232 | Ga0207711_100082326 | 401 |
| 575 | 3300025941 | Ga0207711_10030475 | Ga0207711_100304753 | 401 |
| 576 | 3300025945 | Ga0207679_10044103 | Ga0207679_100441032 | 401 |
| 577 | 3300025949 | Ga0207667_10416623 | Ga0207667_104166231 | 401 |
| 578 | 3300025960 | Ga0207651_10073917 | Ga0207651_100739173 | 401 |
| 579 | 3300025972 | Ga0207668_10247059 | Ga0207668_102470592 | 401 |
| 580 | 3300025986 | Ga0207658_10055793 | Ga0207658_100557932 | 401 |
| 581 | 3300026035 | Ga0207703_10000361 | Ga0207703_1000036186 | 401 |
| 582 | 3300026067 | Ga0207678_10003142 | Ga0207678_1000314214 | 401 |
| 583 | 3300026089 | Ga0207648_10030882 | Ga0207648_100308822 | 401 |
| 584 | 3300026095 | Ga0207676_10024509 | Ga0207676_100245095 | 401 |
| 585 | 3300026095 | Ga0207676_10027573 | Ga0207676_100275732 | 401 |
| 586 | 3300026116 | Ga0207674_10050247 | Ga0207674_100502472 | 401 |
| 587 | 3300026121 | Ga0207683_10021751 | Ga0207683_100217514 | 401 |
| 588 | 3300026121 | Ga0207683_10069179 | Ga0207683_100691792 | 401 |
| 589 | 3300026121 | Ga0207683_10077671 | Ga0207683_100776712 | 401 |
| 590 | 3300026121 | Ga0207683_10127732 | Ga0207683_101277322 | 401 |
| 591 | 3300026121 | Ga0207683_10153194 | Ga0207683_101531942 | 401 |
| 592 | 3300026142 | Ga0207698_10024216 | Ga0207698_100242162 | 401 |
| 593 | 3300027526 | Ga0209968_1001974 | Ga0209968_10019742 | 401 |
| 594 | 3300027543 | Ga0209999_1009468 | Ga0209999_10094682 | 401 |
| 595 | 3300027695 | Ga0209966_1000039 | Ga0209966_100003939 | 401 |
| 596 | 3300027876 | Ga0209974_10021764 | Ga0209974_100217642 | 401 |
| 597 | 3300028794 | Ga0307515_10000040 | Ga0307515_10000040234 | 401 |
| 598 | 3300028794 | Ga0307515_10000090 | Ga0307515_10000090129 | 401 |
| 599 | 3300028794 | Ga0307515_10063613 | Ga0307515_100636132 | 401 |
| 600 | 3300028794 | Ga0307515_10179585 | Ga0307515_101795851 | 401 |
| 601 | 3300030522 | Ga0307512_10086046 | Ga0307512_100860462 | 401 |
| 602 | 3300030522 | Ga0307512_10119946 | Ga0307512_101199462 | 401 |
| 603 | 3300031251 | Ga0265327_10012542 | Ga0265327_100125423 | 401 |
| 604 | 3300031616 | Ga0307508_10000007 | Ga0307508_1000000712 | 401 |
| 605 | 3300031649 | Ga0307514_10019551 | Ga0307514_100195512 | 401 |
| 606 | 3300031730 | Ga0307516_10000398 | Ga0307516_1000039837 | 401 |
| 607 | 3300031730 | Ga0307516_10012557 | Ga0307516_100125577 | 401 |
| 608 | 3300031731 | Ga0307405_10034202 | Ga0307405_100342023 | 401 |
| 609 | 3300039447 | Ga0436361_0609661 | Ga0436361_0609661_8819_10078 | 401 |
| 610 | 3300041404 | Ga0439436_0000259 | Ga0439436_0000259_1442_2698 | 401 |
| 611 | 3300041405 | Ga0439438_018437 | Ga0439438_018437_32_1288 | 401 |
| 612 | 3300041407 | Ga0439447_018078 | Ga0439447_018078_600_1856 | 401 |
| 613 | 3300041411 | Ga0439466_0001510 | Ga0439466_0001510_6128_7384 | 401 |
| 614 | 3300041443 | Ga0451789_0365025 | Ga0451789_0365025_308_1564 | 401 |
| 615 | 3300041459 | Ga0451800_0572189 | Ga0451800_0572189_198_1454 | 401 |
| 616 | 3300041999 | Ga0439433_0002854 | Ga0439433_0002854_1925_3181 | 401 |
| 617 | 3300042002 | Ga0439442_020008 | Ga0439442_020008_77_1333 | 401 |
| 618 | 3300042007 | Ga0439449_0000530 | Ga0439449_0000530_526_1782 | 401 |
| 619 | 3300042010 | Ga0439452_006298 | Ga0439452_006298_299_1555 | 401 |
| 620 | 3300042010 | Ga0439452_006480 | Ga0439452_006480_717_1973 | 401 |
| 621 | 3300042115 | Ga0450911_000366 | Ga0450911_000366_11645_12901 | 401 |
| 622 | 3300042121 | Ga0450919_000679 | Ga0450919_000679_1179_2435 | 401 |
| 623 | 3300042435 | Ga0439434_0003522 | Ga0439434_0003522_1652_2908 | 401 |
| 624 | 3300042531 | Ga0450918_000036 | Ga0450918_000036_18579_19835 | 401 |
| 625 | 3300046475 | Ga0495639_0016505 | Ga0495639_0016505_1203_2459 | 401 |
| 626 | 3300046512 | Ga0495610_0006772 | Ga0495610_0006772_1151_2407 | 401 |
| 627 | 3300046520 | Ga0495637_0003132 | Ga0495637_0003132_4772_6028 | 401 |
| 628 | 3300046525 | Ga0495663_0011992 | Ga0495663_0011992_213_1469 | 401 |
| 629 | 3300046530 | Ga0495654_0015291 | Ga0495654_0015291_1444_2700 | 401 |
| 630 | 3300046537 | Ga0495598_0014000 | Ga0495598_0014000_81_1337 | 401 |
| 631 | 3300046539 | Ga0495621_0001659 | Ga0495621_0001659_1021_2277 | 401 |
| 632 | 3300046558 | Ga0495633_0002787 | Ga0495633_0002787_4325_5581 | 401 |
| 633 | 3300046615 | Ga0495656_0000137 | Ga0495656_0000137_9999_11255 | 401 |
| 634 | 3300046615 | Ga0495656_0008462 | Ga0495656_0008462_754_2043 | 401 |
| 635 | 3300046660 | Ga0495625_0003235 | Ga0495625_0003235_9465_10721 | 401 |
| 636 | 3300046660 | Ga0495625_0012515 | Ga0495625_0012515_4571_5842 | 401 |
| 637 | 3300046674 | Ga0495588_0022354 | Ga0495588_0022354_336_1592 | 401 |
| 638 | 3300046683 | Ga0495658_0140989 | Ga0495658_0140989_165_1421 | 401 |
| 639 | 3300046692 | Ga0495671_0009593 | Ga0495671_0009593_3686_4942 | 401 |
| 640 | 3300048090 | Ga0495615_0000614 | Ga0495615_0000614_637_1893 | 401 |
| 641 | 3300048905 | Ga0496102_0018292 | Ga0496102_0018292_934_2190 | 401 |
| 642 | 3300048906 | Ga0496103_0005180 | Ga0496103_0005180_3145_4401 | 401 |
| 643 | 3300048907 | Ga0496104_0003649 | Ga0496104_0003649_4454_5710 | 401 |
| 644 | 3300048908 | Ga0496105_0003155 | Ga0496105_0003155_753_2009 | 401 |
| 645 | 3300048911 | Ga0496108_0035283 | Ga0496108_0035283_997_2253 | 401 |
| 646 | 3300048915 | Ga0496112_0108319 | Ga0496112_0108319_882_2138 | 401 |
| 647 | 3300048916 | Ga0496113_0014605 | Ga0496113_0014605_252_1508 | 401 |
| 648 | 3300048917 | Ga0496114_0036006 | Ga0496114_0036006_1697_2953 | 401 |
| 649 | 3300048924 | Ga0496121_0018162 | Ga0496121_0018162_4131_5387 | 401 |
| 650 | 3300048925 | Ga0496122_0000063 | Ga0496122_0000063_149903_151159 | 401 |
| 651 | 3300048926 | Ga0496123_0000045 | Ga0496123_0000045_200328_201584 | 401 |
| 652 | 3300048927 | Ga0496124_0020425 | Ga0496124_0020425_4847_6103 | 401 |
| 653 | 3300048927 | Ga0496124_0025363 | Ga0496124_0025363_23_1279 | 401 |
| 654 | 3300048928 | Ga0496125_0007863 | Ga0496125_0007863_7037_8293 | 401 |
| 655 | 3300050492 | nmdc:mga0yw44_179129_c1 | nmdc:mga0yw44_179129_c1_43_1299 | 401 |
| 656 | 3300050493 | nmdc:mga0k408_674_c1 | nmdc:mga0k408_674_c1_10146_11402 | 401 |
| 657 | 3300050494 | nmdc:mga06z11_24680_c1 | nmdc:mga06z11_24680_c1_1484_2740 | 401 |
| 658 | 3300050496 | nmdc:mga07m45_64432_c1 | nmdc:mga07m45_64432_c1_794_2050 | 401 |
| 659 | 3300053079 | Ga0500610_0009084 | Ga0500610_0009084_33_1289 | 401 |
| 660 | 3300053090 | Ga0500646_0002996 | Ga0500646_0002996_2389_3645 | 401 |
| 661 | 3300053117 | Ga0500593_000422 | Ga0500593_000422_14079_15335 | 401 |
| 662 | 3300053121 | Ga0500607_001465 | Ga0500607_001465_1937_3193 | 401 |
| 663 | 3300053131 | Ga0500652_000839 | Ga0500652_000839_5132_6388 | 401 |
| 664 | 3300053134 | Ga0500658_0018122 | Ga0500658_0018122_94_1350 | 401 |
| 665 | 3300053139 | Ga0500568_0016337 | Ga0500568_0016337_816_2072 | 401 |
| 666 | 3300053148 | Ga0500590_008920 | Ga0500590_008920_2443_3699 | 401 |
| 667 | 3300053154 | Ga0500619_000072 | Ga0500619_000072_27734_28990 | 401 |
| 668 | 3300053156 | Ga0500622_0003145 | Ga0500622_0003145_5702_6958 | 401 |
| 669 | 3300053161 | Ga0500634_0032937 | Ga0500634_0032937_110_1366 | 401 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5udf-assembly1.cif.gz_B | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.9049 | 39 | 242 |
| 5udf-assembly1.cif.gz_D | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8895 | 39 | 242 |
| 5udf-assembly1.cif.gz_C | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8839 | 39 | 242 |
| 5udf-assembly1.cif.gz_B | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8744 | 39 | 242 |
| 5udf-assembly1.cif.gz_D | structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii | 0.8729 | 39 | 242 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AG90_2_103_3.30.70.1530 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 | 0.7689 | 209 | 239 | 3.30.70.1530 |
| af_Q7LL14_1_93_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.6363 | 206 | 240 | 3.30.70.330 |
| af_P36629_411_516_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.6338 | 206 | 241 | 3.30.70.330 |
| af_Q9Y3B4_14_93_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.6308 | 206 | 241 | 3.30.70.330 |
| af_A0A1D8PGR8_607_716_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.6227 | 201 | 241 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5GK49-F1-model_v4 | FtsX-like permease family protein | 0.8811 | 266 | 401 |
GO:0044874
GO:0098797 |
| AF-A0A3N5GK49-F1-model_v4 | FtsX-like permease family protein | 0.8695 | 266 | 401 |
GO:0044874
GO:0098797 |
| AF-A0A7X0JU13-F1-model_v4 | Lipoprotein-releasing system permease protein | 0.8649 | 1 | 401 |
GO:0042953
GO:0044874 GO:0098797 |
| AF-A0A7X0JU13-F1-model_v4 | Lipoprotein-releasing system permease protein | 0.857 | 1 | 401 |
GO:0042953
GO:0044874 GO:0098797 |
| AF-A0A0B8NV53-F1-model_v4 | Lipoprotein releasing system transmembrane protein lolE | 0.8555 | 75 | 181 |
GO:0044874
GO:0098797 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar