F473972

General Info

Members Datasets Scaffolds Average Seq Length
669 414 607 403

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100005917|Ga0070669_1000059176
Length 486
Sequence MNWPYELQIGWRYTRLGIALGVAALIIVLSVMNGFQKEVQGRMLSVISHVEVFDPQGAALADWKATATAARRNPEVIGAAPFVAAQALIGRGDEMRGAIVRGISPNDEATVTDLAAQLKDTTLKRLVPGEWNIVLGVELARSLAVRNGDKVTLVAPGGQVTPAGVVPRLKQFTVVGTFDAGHYEYDSGLVWIHVDDAAKLFRVEGPTGVQLRLKDLNQAREVAARLEQSLGPDLTVRDWTRTNRNWFAAVQVEKRLMFIILTLIVAVAAFNLVSTLVMTVTDKRADIAILRTLGATPGSVMSIFMVQGALAGIIGTFGGVALGLLIAFNVDVIVPFIERLLHVSFLPSSVYLISRMPSDPQSSDIVPIVVISLVLAFLATLYPSWRASRVQPAGAASLIAQRFGRWRRPDPRRDQPAQALHRRQRRVAPRCQGAAGRRPCSATRRDGRDRGRVGFRQEHPAAPARRSRGAEPGQGAQSPSRLHLRG

Samples

Sample ID Description Type Environment
1 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
2 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
6 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
7 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
8 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
9 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
10 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
11 2643221585 Pelomonas sp. Root662 Isolate Unclassified
12 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
13 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
16 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
17 2643221656 Pelomonas sp. Root405 Isolate Unclassified
18 2643221658 Variovorax sp. Root411 Isolate Unclassified
19 2643221660 Methylibium sp. Root1272 Isolate Unclassified
20 2643221672 Variovorax sp. Root434 Isolate Unclassified
21 2643221683 Variovorax sp. Root473 Isolate Unclassified
22 2721755523 Delftia sp. HK171 Isolate Unclassified
23 2738541277 Variovorax sp. GV051 Isolate Unclassified
24 2738541307 Variovorax sp. GV008 Isolate Unclassified
25 2738543013 Variovorax sp. BT01 Isolate Unclassified
26 2738543019 Variovorax sp. GV040 Isolate Unclassified
27 2818991446 Variovorax sp. 1180 Isolate Unclassified
28 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
29 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
30 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
31 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
32 2842677519 Variovorax sp. R-72495 Isolate Unclassified
33 2842733646 Variovorax sp. R-72446 Isolate Unclassified
34 2842747753 Variovorax sp. R-72060 Isolate Unclassified
35 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
36 2885198086 Variovorax sp. 679 Isolate Unclassified
37 2885211737 Variovorax sp. 553 Isolate Unclassified
38 2885266251 Ralstonia sp. SET104 Isolate Nodule
39 2899924645 Variovorax sp. 369 Isolate Unclassified
40 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
41 2904456579 Variovorax sp. 2002 Isolate Unclassified
42 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
43 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
44 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
45 2928037797 Variovorax sp. 1126 Isolate Unclassified
46 2928044640 Variovorax sp. 1128 Isolate Unclassified
47 2928051484 Variovorax sp. 1133 Isolate Unclassified
48 2928058823 Ralstonia sp. 1138 Isolate Unclassified
49 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
50 2928070936 Variovorax gossypii 1167 Isolate Unclassified
51 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
52 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
53 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
54 2929520902 Variovorax beijingensis 502 Isolate Unclassified
55 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
56 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
57 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
58 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
59 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
60 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
61 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
62 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
63 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
64 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
65 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
66 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
67 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
68 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
69 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
70 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
73 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
74 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
75 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
76 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
77 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
78 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
79 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
82 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
85 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
86 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
87 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
88 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
89 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
90 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
91 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
96 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
97 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
98 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
99 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
100 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
119 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
120 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
121 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
128 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
131 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
133 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
134 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
135 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
136 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
137 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
138 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
139 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
140 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
141 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
143 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
144 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
145 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
147 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
148 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
163 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
166 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
170 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
174 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
175 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
177 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
178 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
186 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
189 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
234 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
237 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
240 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
244 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
245 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
246 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
247 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
248 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
249 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
250 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
251 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
252 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
253 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
254 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
255 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
256 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
257 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
258 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
259 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
260 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
261 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
262 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
263 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
264 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
267 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
268 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
269 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
270 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
271 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
272 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
280 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
281 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
282 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
283 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
284 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
285 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
286 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
287 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
288 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
289 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
290 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
291 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
292 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
293 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
294 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
295 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
296 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
297 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
298 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
299 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
300 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
301 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
302 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
303 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
304 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
305 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
306 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
307 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
308 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
309 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
312 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
313 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
314 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
315 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
316 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
317 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
318 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
319 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
320 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
321 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
322 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
323 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
324 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
325 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
329 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
330 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
331 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
332 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
333 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
334 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
335 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
336 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
337 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
338 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
339 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
340 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
341 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
342 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
343 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
346 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
347 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
350 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
351 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
352 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
355 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
368 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
376 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
377 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
378 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
379 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
382 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
383 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
384 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
385 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
386 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
387 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
388 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
389 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
390 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
391 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
392 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
395 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
396 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
397 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
398 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
399 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
400 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
401 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
402 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
403 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
406 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
407 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
408 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
409 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
410 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
411 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
412 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
413 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
414 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.73
Metatranscriptomes 0
Isolates 9.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.82
Nodule 1.94
Rhizoplane 2.69
Rhizosphere 64.13
Stem 0
Stem Tuber 0
Unclassified 9.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1006822 3300002773 Bacteria 3032
2 JGI25150J39212_1007356 3300002774 Bacteria 2216
3 JGI25151J46595_10001626 3300003187 Bacteria 14835
4 JGI25151J46595_10002427 3300003187 Bacteria 11237
5 JGI25160J50197_1013023 3300003354 Bacteria 2854
6 Ga0055525_1000031 3300003759 Bacteria 314909
7 Ga0055535_1001453 3300003761 Bacteria 11990
8 Ga0055542_1001330 3300003762 Bacteria 12922
9 Ga0055542_1001423 3300003762 Bacteria 11998
10 Ga0055526_1001897 3300003771 Bacteria 14503
11 Ga0055526_1003910 3300003771 Bacteria 9196
12 Ga0055526_1003992 3300003771 Bacteria 9078
13 Ga0055526_1006280 3300003771 Bacteria 6501
14 Ga0055537_1002046 3300003773 Bacteria 7117
15 Ga0055524_1000125 3300003775 Bacteria 90042
16 Ga0055524_1000360 3300003775 Bacteria 40907
17 Ga0055536_1000889 3300003781 Bacteria 19456
18 Ga0055536_1004343 3300003781 Bacteria 7290
19 Ga0055534_1000386 3300003784 Bacteria 27590
20 Ga0055534_1000986 3300003784 Bacteria 12568
21 Ga0055534_1002111 3300003784 Bacteria 7136
22 Ga0055530_10016267 3300003791 Bacteria 2385
23 Ga0055540_1000011 3300003792 Bacteria 282927
24 Ga0055540_1000393 3300003792 Bacteria 35911
25 Ga0055540_1010338 3300003792 Bacteria 3116
26 Ga0055531_10004809 3300003794 Bacteria 8064
27 Ga0055531_10004871 3300003794 Bacteria 7998
28 Ga0065165_1000967 3300005262 Bacteria 36011
29 Ga0065165_1007030 3300005262 Bacteria 5669
30 Ga0065707_10179379 3300005295 Bacteria 1428
31 Ga0070676_10013767 3300005328 Bacteria 4435
32 Ga0070690_100003369 3300005330 Bacteria 8723
33 Ga0070670_100015056 3300005331 Bacteria 6637
34 Ga0068869_100006668 3300005334 Bacteria 7334
35 Ga0068869_100033907 3300005334 Bacteria 3607
36 Ga0070666_10000930 3300005335 Bacteria 17786
37 Ga0068868_100001477 3300005338 Bacteria 16207
38 Ga0068868_100010982 3300005338 Bacteria 6579
39 Ga0070689_100002360 3300005340 Bacteria 12298
40 Ga0070669_100005917 3300005353 Bacteria 8825
41 Ga0070669_100036437 3300005353 Bacteria 3564
42 Ga0070675_100044883 3300005354 Bacteria 3615
43 Ga0070675_100058026 3300005354 Bacteria 3192
44 Ga0070675_100060990 3300005354 Bacteria 3114
45 Ga0070675_100091473 3300005354 Bacteria 2549
46 Ga0070671_100041655 3300005355 Bacteria 3817
47 Ga0070671_100047484 3300005355 Bacteria 3570
48 Ga0070671_100060329 3300005355 Bacteria 3158
49 Ga0070671_100166738 3300005355 Bacteria 1862
50 Ga0070674_100000568 3300005356 Bacteria 18602
51 Ga0070674_100011792 3300005356 Bacteria 5335
52 Ga0070673_100045204 3300005364 Bacteria 3414
53 Ga0070667_100051456 3300005367 Bacteria 3473
54 Ga0070701_10003296 3300005438 Bacteria 6363
55 Ga0070700_100010066 3300005441 Bacteria 5206
56 Ga0070694_100016546 3300005444 Bacteria 4643
57 Ga0070663_100001074 3300005455 Bacteria 14958
58 Ga0070678_100000637 3300005456 Bacteria 17165
59 Ga0070681_10248211 3300005458 Bacteria 1693
60 Ga0068867_100007834 3300005459 Bacteria 7550
61 Ga0068867_100009496 3300005459 Bacteria 6861
62 Ga0068867_100068184 3300005459 Bacteria 2654
63 Ga0070706_100012975 3300005467 Bacteria 7710
64 Ga0070706_100259610 3300005467 Bacteria 1622
65 Ga0070679_100230249 3300005530 Bacteria 1813
66 Ga0070697_100114875 3300005536 Bacteria 2247
67 Ga0070672_100031460 3300005543 Bacteria 3994
68 Ga0070672_100039019 3300005543 Bacteria 3634
69 Ga0070672_100093361 3300005543 Bacteria 2430
70 Ga0070686_100005616 3300005544 Bacteria 6948
71 Ga0070695_100009100 3300005545 Bacteria 5903
72 Ga0070695_100011804 3300005545 Bacteria 5229
73 Ga0070696_100001380 3300005546 Bacteria 15883
74 Ga0070696_100013721 3300005546 Bacteria 5440
75 Ga0070693_100000208 3300005547 Bacteria 27286
76 Ga0070693_100134238 3300005547 Bacteria 1551
77 Ga0070665_100026163 3300005548 Bacteria 5875
78 Ga0070704_100017542 3300005549 Bacteria 4554
79 Ga0068855_100015728 3300005563 Bacteria 9102
80 Ga0068855_100431198 3300005563 Bacteria 1441
81 Ga0070664_100017715 3300005564 Bacteria 5852
82 Ga0070664_100019354 3300005564 Bacteria 5602
83 Ga0070664_100264621 3300005564 Bacteria 1548
84 Ga0068857_100089073 3300005577 Bacteria 2761
85 Ga0068854_100026600 3300005578 Bacteria 3978
86 Ga0068856_100036287 3300005614 Bacteria 4834
87 Ga0070702_100004253 3300005615 Bacteria 6526
88 Ga0068852_100020418 3300005616 Bacteria 5269
89 Ga0068852_100098873 3300005616 Bacteria 2629
90 Ga0068859_100001613 3300005617 Bacteria 23052
91 Ga0068859_100006943 3300005617 Bacteria 11498
92 Ga0068859_100012344 3300005617 Bacteria 8594
93 Ga0068864_100039622 3300005618 Bacteria 4027
94 Ga0068864_100133915 3300005618 Bacteria 2230
95 Ga0068866_10003990 3300005718 Bacteria 6057
96 Ga0068866_10058733 3300005718 Bacteria 1988
97 Ga0068861_100064370 3300005719 Bacteria 2821
98 Ga0068861_100065877 3300005719 Bacteria 2791
99 Ga0068851_10032784 3300005834 Bacteria 2585
100 Ga0068863_100006228 3300005841 Bacteria 11714
101 Ga0068858_100003477 3300005842 Bacteria 15611
102 Ga0068858_100006859 3300005842 Bacteria 11068
103 Ga0068858_100007536 3300005842 Bacteria 10520
104 Ga0068860_100000968 3300005843 Bacteria 31798
105 Ga0068860_100006430 3300005843 Bacteria 11799
106 Ga0068860_100007870 3300005843 Bacteria 10641
107 Ga0068862_100005951 3300005844 Bacteria 10158
108 Ga0068862_100007738 3300005844 Bacteria 8886
109 Ga0068862_100040990 3300005844 Bacteria 3938
110 Ga0068862_100049190 3300005844 Bacteria 3601
111 Ga0075365_10014106 3300006038 Bacteria 4800
112 Ga0075365_10036673 3300006038 Bacteria 3178
113 Ga0075365_10178564 3300006038 Bacteria 1484
114 Ga0075368_10007889 3300006042 Bacteria 3776
115 Ga0075368_10008999 3300006042 Bacteria 3582
116 Ga0075368_10046739 3300006042 Bacteria 1713
117 Ga0075363_100009910 3300006048 Bacteria 4499
118 Ga0075363_100053231 3300006048 Bacteria 2162
119 Ga0075363_100085214 3300006048 Bacteria 1733
120 Ga0075364_10000943 3300006051 Bacteria 15334
121 Ga0075364_10019781 3300006051 Bacteria 4229
122 Ga0075364_10058818 3300006051 Bacteria 2519
123 Ga0070716_100115045 3300006173 Bacteria 1674
124 Ga0075367_10013104 3300006178 Bacteria 4444
125 Ga0075367_10028385 3300006178 Bacteria 3192
126 Ga0075367_10162304 3300006178 Bacteria 1390
127 Ga0075366_10004350 3300006195 Bacteria 7594
128 Ga0075366_10005284 3300006195 Bacteria 6996
129 Ga0075366_10007203 3300006195 Bacteria 6129
130 Ga0075366_10008365 3300006195 Bacteria 5748
131 Ga0075366_10017479 3300006195 Bacteria 4127
132 Ga0075366_10065013 3300006195 Bacteria 2169
133 Ga0097621_100006336 3300006237 Bacteria 8397
134 Ga0075370_10000276 3300006353 Bacteria 18492
135 Ga0075370_10018144 3300006353 Bacteria 3813
136 Ga0068871_100000860 3300006358 Bacteria 20244
137 Ga0068871_100024514 3300006358 Bacteria 4680
138 Ga0075428_100004699 3300006844 Bacteria 15119
139 Ga0075431_100125543 3300006847 Bacteria 2648
140 Ga0075431_100183686 3300006847 Bacteria 2145
141 Ga0075433_10018417 3300006852 Bacteria 5804
142 Ga0075434_100016509 3300006871 Bacteria 7098
143 Ga0075429_100000786 3300006880 Bacteria 24972
144 Ga0075429_100002300 3300006880 Bacteria 16033
145 Ga0075429_100091766 3300006880 Bacteria 2649
146 Ga0068865_100004558 3300006881 Bacteria 8360
147 Ga0075436_100007561 3300006914 Bacteria 7423
148 Ga0097620_100001613 3300006931 Bacteria 23052
149 Ga0097620_100006944 3300006931 Bacteria 11498
150 Ga0097620_100012344 3300006931 Bacteria 8594
151 Ga0079104_1000055 3300006946 Bacteria 166522
152 Ga0079104_1000910 3300006946 Bacteria 23895
153 Ga0099826_10000004 3300006948 Bacteria 802669
154 Ga0099826_10000821 3300006948 Bacteria 16703
155 Ga0105240_10003836 3300009093 Bacteria 23255
156 Ga0111539_10032268 3300009094 Bacteria 6361
157 Ga0105245_10020049 3300009098 Bacteria 5861
158 Ga0114129_10042609 3300009147 Bacteria 6390
159 Ga0114129_10049253 3300009147 Bacteria 5920
160 Ga0105243_10001150 3300009148 Bacteria 23986
161 Ga0105243_10002743 3300009148 Bacteria 14641
162 Ga0105243_10007469 3300009148 Bacteria 8400
163 Ga0105243_10018250 3300009148 Bacteria 5312
164 Ga0105243_10250372 3300009148 Bacteria 1581
165 Ga0105242_10000304 3300009176 Bacteria 39272
166 Ga0105242_10003088 3300009176 Bacteria 12997
167 Ga0105248_10022695 3300009177 Bacteria 6964
168 Ga0105237_10001634 3300009545 Bacteria 29121
169 Ga0105249_10016514 3300009553 Bacteria 6548
170 Ga0105239_10002435 3300010375 Bacteria 23714
171 Ga0157378_10013173 3300013297 Bacteria 7235
172 Ga0157372_10156911 3300013307 Bacteria 2629
173 Ga0157375_10062266 3300013308 Bacteria 3707
174 Ga0163163_10061335 3300014325 Bacteria 3725
175 Ga0157380_10008226 3300014326 Bacteria 7432
176 Ga0182008_10000287 3300014497 Bacteria 39636
177 Ga0182008_10010682 3300014497 Bacteria 4908
178 Ga0157379_10050576 3300014968 Bacteria 3711
179 Ga0157376_10079429 3300014969 Bacteria 2812
180 Ga0182006_1011726 3300015261 Bacteria 3849
181 Ga0182007_10000736 3300015262 Bacteria 18545
182 Ga0182007_10001789 3300015262 Bacteria 11233
183 Ga0163161_10000088 3300017792 Bacteria 91403
184 Ga0163161_10010411 3300017792 Bacteria 6439
185 Ga0163161_10080858 3300017792 Bacteria 2392
186 Ga0213872_10000004 3300021361 Bacteria 306230
187 Ga0213872_10000006 3300021361 Bacteria 249845
188 Ga0213872_10000132 3300021361 Bacteria 67609
189 Ga0213872_10001699 3300021361 Bacteria 13851
190 Ga0213872_10009186 3300021361 Bacteria 4751
191 Ga0209784_100516 3300025224 Bacteria 14718
192 Ga0209566_101242 3300025225 Bacteria 8751
193 Ga0209674_100179 3300025226 Bacteria 77366
194 Ga0209672_101105 3300025228 Bacteria 11418
195 Ga0209147_100741 3300025229 Bacteria 16152
196 Ga0209563_100044 3300025230 Bacteria 396812
197 Ga0209563_105942 3300025230 Bacteria 2148
198 Ga0209258_100009 3300025242 Bacteria 996276
199 Ga0207425_1000169 3300025245 Bacteria 54781
200 Ga0207425_1001454 3300025245 Bacteria 9892
201 Ga0209646_1000022 3300025246 Bacteria 446621
202 Ga0209148_1000007 3300025254 Bacteria 1592273
203 Ga0209148_1000021 3300025254 Bacteria 714645
204 Ga0209759_1006726 3300025256 Bacteria 3815
205 Ga0209129_1000024 3300025258 Bacteria 417268
206 Ga0209129_1000027 3300025258 Bacteria 409587
207 Ga0209129_1003682 3300025258 Bacteria 6510
208 Ga0209129_1004780 3300025258 Bacteria 5120
209 Ga0209565_1000235 3300025263 Bacteria 60351
210 Ga0209565_1000286 3300025263 Bacteria 49417
211 Ga0209565_1000825 3300025263 Bacteria 17593
212 Ga0209673_1000410 3300025273 Bacteria 75829
213 Ga0209673_1004437 3300025273 Bacteria 7520
214 Ga0209673_1015346 3300025273 Bacteria 2916
215 Ga0209130_1000383 3300025284 Bacteria 49412
216 Ga0209130_1004634 3300025284 Bacteria 5116
217 Ga0209675_1000125 3300025291 Bacteria 105527
218 Ga0209675_1000151 3300025291 Bacteria 91172
219 Ga0209675_1000312 3300025291 Bacteria 43634
220 Ga0209675_1001004 3300025291 Bacteria 17745
221 Ga0209676_1000014 3300025292 Bacteria 793514
222 Ga0209676_1000028 3300025292 Bacteria 559745
223 Ga0209676_1000275 3300025292 Bacteria 107485
224 Ga0209676_1000780 3300025292 Bacteria 42574
225 Ga0209676_1009775 3300025292 Bacteria 4088
226 Ga0209025_1000289 3300025294 Bacteria 113555
227 Ga0209025_1000379 3300025294 Bacteria 92457
228 Ga0209025_1000423 3300025294 Bacteria 84180
229 Ga0209025_1001571 3300025294 Bacteria 28912
230 Ga0209025_1001709 3300025294 Bacteria 26726
231 Ga0209025_1013208 3300025294 Bacteria 5212
232 Ga0209564_1000139 3300025295 Bacteria 180328
233 Ga0209564_1000209 3300025295 Bacteria 133651
234 Ga0209564_1001235 3300025295 Bacteria 28797
235 Ga0209564_1001259 3300025295 Bacteria 27998
236 Ga0209564_1002311 3300025295 Bacteria 15479
237 Ga0209758_1000049 3300025297 Bacteria 345104
238 Ga0209758_1000052 3300025297 Bacteria 338962
239 Ga0209758_1000146 3300025297 Bacteria 169246
240 Ga0209050_1000002 3300025298 Bacteria 1792849
241 Ga0209050_1000583 3300025298 Bacteria 59089
242 Ga0209050_1000980 3300025298 Bacteria 36398
243 Ga0209050_1029450 3300025298 Bacteria 1756
244 Ga0209256_1000113 3300025299 Bacteria 175296
245 Ga0209256_1000253 3300025299 Bacteria 94918
246 Ga0209256_1000291 3300025299 Bacteria 88153
247 Ga0209256_1000700 3300025299 Bacteria 44602
248 Ga0207426_1000053 3300025302 Bacteria 384818
249 Ga0209051_1000015 3300025303 Bacteria 546798
250 Ga0209051_1000020 3300025303 Bacteria 508628
251 Ga0209051_1000173 3300025303 Bacteria 117170
252 Ga0209051_1000531 3300025303 Bacteria 47271
253 Ga0209051_1015948 3300025303 Bacteria 3433
254 Ga0209051_1043986 3300025303 Bacteria 1561
255 Ga0209257_1000085 3300025304 Bacteria 291117
256 Ga0209257_1000096 3300025304 Bacteria 259390
257 Ga0209257_1001928 3300025304 Bacteria 22402
258 Ga0209257_1006537 3300025304 Bacteria 7446
259 Ga0209257_1008315 3300025304 Bacteria 5942
260 Ga0207655_1006582 3300025728 Bacteria 7664
261 Ga0207682_10003641 3300025893 Bacteria 6646
262 Ga0207682_10017191 3300025893 Bacteria 2824
263 Ga0207642_10041594 3300025899 Bacteria 2014
264 Ga0207680_10006275 3300025903 Bacteria 5736
265 Ga0207645_10024778 3300025907 Bacteria 3887
266 Ga0207645_10043333 3300025907 Bacteria 2880
267 Ga0207684_10039424 3300025910 Bacteria 4007
268 Ga0207662_10000451 3300025918 Bacteria 18219
269 Ga0207649_10064964 3300025920 Bacteria 2309
270 Ga0207652_10042969 3300025921 Bacteria 3848
271 Ga0207652_10045633 3300025921 Bacteria 3736
272 Ga0207681_10005519 3300025923 Bacteria 7769
273 Ga0207694_10012902 3300025924 Bacteria 6292
274 Ga0207650_10000265 3300025925 Bacteria 55786
275 Ga0207659_10001160 3300025926 Bacteria 15700
276 Ga0207659_10031008 3300025926 Bacteria 3656
277 Ga0207659_10211516 3300025926 Bacteria 1554
278 Ga0207687_10003609 3300025927 Bacteria 10421
279 Ga0207644_10010073 3300025931 Bacteria 6225
280 Ga0207644_10035747 3300025931 Bacteria 3483
281 Ga0207644_10075627 3300025931 Bacteria 2475
282 Ga0207706_10001386 3300025933 Bacteria 24177
283 Ga0207706_10034273 3300025933 Bacteria 4517
284 Ga0207686_10001386 3300025934 Bacteria 13763
285 Ga0207686_10012404 3300025934 Bacteria 4687
286 Ga0207709_10000211 3300025935 Bacteria 75562
287 Ga0207709_10000273 3300025935 Bacteria 60743
288 Ga0207709_10001689 3300025935 Bacteria 14842
289 Ga0207709_10004882 3300025935 Bacteria 7676
290 Ga0207709_10037486 3300025935 Bacteria 2881
291 Ga0207709_10041459 3300025935 Bacteria 2762
292 Ga0207670_10004486 3300025936 Bacteria 7522
293 Ga0207665_10086928 3300025939 Bacteria 2161
294 Ga0207691_10000390 3300025940 Bacteria 43939
295 Ga0207691_10029711 3300025940 Bacteria 5111
296 Ga0207691_10065242 3300025940 Bacteria 3297
297 Ga0207691_10123800 3300025940 Bacteria 2289
298 Ga0207711_10008232 3300025941 Bacteria 8730
299 Ga0207711_10030475 3300025941 Bacteria 4549
300 Ga0207689_10001368 3300025942 Bacteria 23383
301 Ga0207679_10044103 3300025945 Bacteria 3216
302 Ga0207667_10020298 3300025949 Bacteria 7394
303 Ga0207667_10416623 3300025949 Bacteria 1367
304 Ga0207651_10067767 3300025960 Bacteria 2513
305 Ga0207651_10073917 3300025960 Bacteria 2426
306 Ga0207712_10025840 3300025961 Bacteria 3906
307 Ga0207712_10061553 3300025961 Bacteria 2664
308 Ga0207668_10247059 3300025972 Bacteria 1447
309 Ga0207658_10055793 3300025986 Bacteria 2929
310 Ga0207677_10006533 3300026023 Bacteria 6403
311 Ga0207703_10000361 3300026035 Bacteria 48627
312 Ga0207703_10016330 3300026035 Bacteria 5787
313 Ga0207703_10033407 3300026035 Bacteria 4078
314 Ga0207639_10029251 3300026041 Bacteria 4031
315 Ga0207678_10003142 3300026067 Bacteria 14937
316 Ga0207678_10173229 3300026067 Bacteria 1842
317 Ga0207708_10000114 3300026075 Bacteria 61971
318 Ga0207702_10060486 3300026078 Bacteria 3229
319 Ga0207641_10055731 3300026088 Bacteria 3357
320 Ga0207648_10000789 3300026089 Bacteria 35679
321 Ga0207648_10003084 3300026089 Bacteria 17602
322 Ga0207648_10005196 3300026089 Bacteria 13182
323 Ga0207648_10027223 3300026089 Bacteria 5078
324 Ga0207648_10030882 3300026089 Bacteria 4740
325 Ga0207676_10024509 3300026095 Bacteria 4465
326 Ga0207676_10027573 3300026095 Bacteria 4232
327 Ga0207674_10039486 3300026116 Bacteria 4892
328 Ga0207674_10050247 3300026116 Bacteria 4261
329 Ga0207675_100004863 3300026118 Bacteria 12944
330 Ga0207675_100004938 3300026118 Bacteria 12854
331 Ga0207683_10021751 3300026121 Bacteria 5498
332 Ga0207683_10058744 3300026121 Bacteria 3377
333 Ga0207683_10069179 3300026121 Bacteria 3118
334 Ga0207683_10077671 3300026121 Bacteria 2941
335 Ga0207683_10127732 3300026121 Bacteria 2286
336 Ga0207683_10153194 3300026121 Bacteria 2081
337 Ga0207698_10024216 3300026142 Bacteria 4257
338 Ga0207698_10044424 3300026142 Bacteria 3338
339 Ga0209281_1000007 3300027111 Bacteria 938265
340 Ga0209281_1000195 3300027111 Bacteria 139144
341 Ga0209968_1001974 3300027526 Bacteria 3121
342 Ga0209999_1009468 3300027543 Bacteria 1759
343 Ga0209282_1000027 3300027666 Bacteria 159842
344 Ga0209282_1001176 3300027666 Bacteria 14066
345 Ga0209966_1000039 3300027695 Bacteria 54525
346 Ga0209974_10021764 3300027876 Bacteria 2124
347 Ga0207428_10000624 3300027907 Bacteria 41590
348 Ga0268266_10267656 3300028379 Bacteria 1585
349 Ga0268265_10130619 3300028380 Bacteria 2086
350 Ga0268264_10005385 3300028381 Bacteria 10835
351 Ga0268264_10042331 3300028381 Bacteria 3770
352 Ga0268264_10105768 3300028381 Bacteria 2455
353 Ga0307515_10000040 3300028794 Bacteria 322704
354 Ga0307515_10000090 3300028794 Bacteria 215043
355 Ga0307515_10000132 3300028794 Bacteria 176547
356 Ga0307515_10063613 3300028794 Bacteria 5177
357 Ga0307515_10179585 3300028794 Bacteria 2072
358 Ga0307511_10000248 3300030521 Bacteria 55337
359 Ga0307512_10086046 3300030522 Bacteria 2223
360 Ga0307512_10119946 3300030522 Bacteria 1695
361 Ga0265328_10002207 3300031239 Bacteria 8773
362 Ga0265331_10003815 3300031250 Bacteria 9557
363 Ga0265327_10000328 3300031251 Bacteria 90489
364 Ga0265327_10000341 3300031251 Bacteria 88581
365 Ga0265327_10012542 3300031251 Bacteria 5706
366 Ga0307513_10012051 3300031456 Bacteria 10693
367 Ga0307509_10000031 3300031507 Bacteria 205072
368 Ga0307408_100062988 3300031548 Bacteria 2712
369 Ga0307408_100172309 3300031548 Bacteria 1729
370 Ga0307508_10000007 3300031616 Bacteria 268359
371 Ga0307514_10019551 3300031649 Bacteria 5540
372 Ga0265314_10006635 3300031711 Bacteria 10171
373 Ga0265314_10025632 3300031711 Bacteria 4444
374 Ga0307516_10000398 3300031730 Bacteria 56825
375 Ga0307516_10012557 3300031730 Bacteria 9118
376 Ga0307405_10000483 3300031731 Bacteria 14957
377 Ga0307405_10019331 3300031731 Bacteria 3780
378 Ga0307405_10034202 3300031731 Bacteria 3022
379 Ga0307413_10016227 3300031824 Bacteria 3840
380 Ga0307410_10103386 3300031852 Bacteria 2046
381 Ga0307407_10008666 3300031903 Bacteria 4684
382 Ga0307416_100122804 3300032002 Bacteria 2319
383 Ga0307414_10035226 3300032004 Bacteria 3329
384 Ga0307414_10089455 3300032004 Bacteria 2282
385 Ga0307411_10037345 3300032005 Bacteria 3053
386 Ga0373940_0013014 3300035088 Bacteria 2003
387 Ga0373932_0013913 3300035112 Bacteria 2012
388 Ga0373936_0008562 3300035113 Bacteria 3851
389 Ga0373941_0030681 3300035115 Bacteria 1595
390 Ga0373945_0014220 3300035116 Bacteria 2662
391 Ga0373953_0007230 3300035117 Bacteria 3709
392 Ga0373943_0009478 3300035170 Bacteria 4363
393 Ga0373962_0026958 3300035242 Bacteria 1551
394 Ga0373935_0020327 3300035692 Bacteria 4055
395 Ga0373947_0086584 3300035725 Bacteria 1947
396 Ga0373937_0013036 3300036401 Bacteria 7322
397 Ga0395899_0029996 3300037312 Bacteria 4092
398 Ga0395899_0163687 3300037312 Bacteria 1570
399 Ga0395900_0031313 3300037418 Bacteria 5464
400 Ga0395898_0022575 3300037466 Bacteria 6372
401 Ga0395898_0037496 3300037466 Bacteria 4807
402 Ga0395898_0211872 3300037466 Bacteria 1848
403 Ga0395905_0000025 3300037471 Bacteria 317571
404 Ga0395905_0000460 3300037471 Bacteria 56900
405 Ga0395905_0004785 3300037471 Bacteria 13982
406 Ga0395905_0009246 3300037471 Bacteria 9647
407 Ga0395905_0016841 3300037471 Bacteria 6945
408 Ga0395905_0022801 3300037471 Bacteria 5919
409 Ga0395905_0023364 3300037471 Bacteria 5843
410 Ga0395905_0025632 3300037471 Bacteria 5560
411 Ga0395905_0040137 3300037471 Bacteria 4390
412 Ga0395905_0122647 3300037471 Bacteria 2443
413 Ga0395905_0174150 3300037471 Bacteria 2020
414 Ga0395905_0234720 3300037471 Bacteria 1714
415 Ga0395905_0270118 3300037471 Bacteria 1586
416 Ga0395905_0323256 3300037471 Bacteria 1433
417 Ga0395901_0091140 3300038443 Bacteria 3190
418 Ga0395901_0134674 3300038443 Bacteria 2596
419 Ga0436361_0215868 3300039447 Bacteria 46672
420 Ga0436361_0337087 3300039447 Bacteria 12820
421 Ga0436361_0371412 3300039447 Bacteria 22181
422 Ga0436361_0609661 3300039447 Bacteria 30960
423 Ga0436361_1206467 3300039447 Bacteria 80244
424 Ga0439436_0000259 3300041404 Bacteria 12713
425 Ga0439438_018437 3300041405 Bacteria 1989
426 Ga0439447_018078 3300041407 Bacteria 1908
427 Ga0439466_0001510 3300041411 Bacteria 9089
428 Ga0439466_0011362 3300041411 Bacteria 3295
429 Ga0439465_0054402 3300041413 Bacteria 1317
430 Ga0451789_0365025 3300041443 Bacteria 2662
431 Ga0451800_0572189 3300041459 Bacteria 2789
432 Ga0439431_0016410 3300041997 Bacteria 1733
433 Ga0439433_0002854 3300041999 Bacteria 3691
434 Ga0439442_020008 3300042002 Bacteria 1387
435 Ga0439449_0000530 3300042007 Bacteria 14217
436 Ga0439449_0013872 3300042007 Bacteria 3030
437 Ga0439449_0021363 3300042007 Bacteria 2424
438 Ga0439452_006298 3300042010 Bacteria 3725
439 Ga0439452_006480 3300042010 Bacteria 3666
440 Ga0439462_0000404 3300042015 Bacteria 8339
441 Ga0450911_000366 3300042115 Bacteria 15046
442 Ga0450919_000679 3300042121 Bacteria 4280
443 Ga0450923_000865 3300042125 Bacteria 3700
444 Ga0450888_006183 3300042126 Bacteria 1296
445 Ga0450890_005770 3300042127 Bacteria 1592
446 Ga0450908_001881 3300042184 Bacteria 4109
447 Ga0439434_0003522 3300042435 Bacteria 4570
448 Ga0439434_0020281 3300042435 Bacteria 1995
449 Ga0439464_0006437 3300042439 Bacteria 3058
450 Ga0450918_000036 3300042531 Bacteria 26790
451 Ga0451577_0005895 3300042876 Bacteria 12379
452 Ga0451577_0022122 3300042876 Bacteria 5807
453 Ga0451577_0060099 3300042876 Bacteria 3388
454 Ga0451577_0172188 3300042876 Bacteria 1951
455 Ga0466969_0009596 3300044656 Bacteria 5128
456 Ga0466972_0001197 3300044658 Bacteria 12476
457 Ga0453683_0008042 3300044673 Bacteria 7101
458 Ga0466965_0018707 3300044683 Bacteria 3324
459 Ga0466965_0032924 3300044683 Bacteria 2532
460 Ga0466966_0097031 3300044684 Bacteria 1825
461 Ga0466961_0002008 3300044693 Bacteria 12655
462 Ga0466961_0100650 3300044693 Bacteria 1820
463 Ga0466964_0001102 3300044706 Bacteria 9053
464 Ga0453684_0296871 3300044712 Bacteria 1838
465 Ga0466971_0027410 3300044719 Bacteria 2552
466 Ga0466968_0015723 3300044735 Bacteria 3005
467 Ga0466968_0020759 3300044735 Bacteria 2654
468 Ga0466968_0051879 3300044735 Bacteria 1754
469 Ga0466970_0011713 3300044765 Bacteria 4473
470 Ga0466959_0002786 3300045049 Bacteria 11253
471 Ga0466959_0017291 3300045049 Bacteria 5284
472 Ga0451576_0000220 3300045051 Bacteria 141261
473 Ga0451576_0024152 3300045051 Bacteria 6568
474 Ga0451576_0340532 3300045051 Bacteria 1570
475 Ga0466958_0092531 3300045836 Bacteria 1872
476 Ga0466967_0032384 3300045976 Bacteria 4413
477 Ga0466967_0156104 3300045976 Bacteria 2138
478 Ga0495603_0021192 3300046455 Bacteria 3935
479 Ga0495590_0010806 3300046457 Bacteria 3421
480 Ga0495650_0000976 3300046471 Bacteria 32712
481 Ga0495580_0010221 3300046472 Bacteria 7321
482 Ga0495582_0020920 3300046473 Bacteria 3583
483 Ga0495605_0000836 3300046474 Bacteria 21626
484 Ga0495639_0016505 3300046475 Bacteria 3206
485 Ga0495584_0027555 3300046491 Bacteria 2879
486 Ga0495596_0000574 3300046500 Bacteria 22937
487 Ga0495607_0010311 3300046501 Bacteria 6287
488 Ga0495610_0003801 3300046512 Bacteria 11510
489 Ga0495610_0006772 3300046512 Bacteria 7777
490 Ga0495616_0000675 3300046513 Bacteria 25262
491 Ga0495632_0008077 3300046519 Bacteria 6520
492 Ga0495637_0003132 3300046520 Bacteria 8830
493 Ga0495643_0053068 3300046522 Bacteria 2175
494 Ga0495663_0011992 3300046525 Bacteria 2415
495 Ga0495654_0015291 3300046530 Bacteria 4076
496 Ga0495586_0053035 3300046535 Bacteria 2196
497 Ga0495598_0014000 3300046537 Bacteria 1999
498 Ga0495621_0001659 3300046539 Bacteria 5834
499 Ga0495633_0002787 3300046558 Bacteria 12083
500 Ga0495656_0000137 3300046615 Bacteria 27177
501 Ga0495656_0008462 3300046615 Bacteria 3673
502 Ga0495625_0000611 3300046660 Bacteria 51780
503 Ga0495625_0003235 3300046660 Bacteria 16485
504 Ga0495625_0012515 3300046660 Bacteria 6871
505 Ga0495588_0011820 3300046674 Bacteria 4108
506 Ga0495588_0022354 3300046674 Bacteria 3125
507 Ga0495647_0000629 3300046681 Bacteria 10406
508 Ga0495658_0005679 3300046683 Bacteria 6130
509 Ga0495658_0140989 3300046683 Bacteria 1474
510 Ga0495671_0000883 3300046692 Bacteria 21393
511 Ga0495671_0009593 3300046692 Bacteria 5404
512 Ga0495649_0027103 3300046694 Bacteria 3180
513 Ga0495649_0028621 3300046694 Bacteria 3088
514 Ga0495660_0044493 3300046810 Bacteria 2442
515 Ga0495687_000500 3300047443 Bacteria 47248
516 Ga0495687_001392 3300047443 Bacteria 22323
517 Ga0495687_005890 3300047443 Bacteria 7667
518 Ga0495686_0134405 3300047472 Bacteria 1464
519 Ga0495615_0000614 3300048090 Bacteria 5010
520 Ga0496102_0014103 3300048905 Bacteria 6943
521 Ga0496102_0018292 3300048905 Bacteria 6156
522 Ga0496102_0044454 3300048905 Bacteria 4031
523 Ga0496103_0005180 3300048906 Bacteria 7844
524 Ga0496104_0003649 3300048907 Bacteria 13294
525 Ga0496105_0003155 3300048908 Bacteria 12138
526 Ga0496105_0319802 3300048908 Bacteria 1244
527 Ga0496108_0013424 3300048911 Bacteria 6682
528 Ga0496108_0035283 3300048911 Bacteria 4157
529 Ga0496109_0246606 3300048912 Bacteria 1682
530 Ga0496112_0108319 3300048915 Bacteria 2748
531 Ga0496113_0014605 3300048916 Bacteria 5364
532 Ga0496114_0036006 3300048917 Bacteria 4090
533 Ga0496116_0003117 3300048919 Bacteria 16661
534 Ga0496116_0011195 3300048919 Bacteria 7454
535 Ga0496118_0007164 3300048921 Bacteria 11929
536 Ga0496121_0018162 3300048924 Bacteria 7110
537 Ga0496121_0018310 3300048924 Bacteria 7072
538 Ga0496122_0000063 3300048925 Bacteria 241378
539 Ga0496122_0009675 3300048925 Bacteria 10086
540 Ga0496123_0000045 3300048926 Bacteria 249294
541 Ga0496124_0000036 3300048927 Bacteria 318032
542 Ga0496124_0020425 3300048927 Bacteria 6119
543 Ga0496124_0025363 3300048927 Bacteria 5370
544 Ga0496125_0007863 3300048928 Bacteria 11268
545 Ga0496125_0128776 3300048928 Bacteria 1787
546 Ga0496126_0006539 3300048929 Bacteria 12975
547 Ga0501036_0098347 3300049572 Bacteria 2474
548 Ga0501037_0187924 3300049573 Bacteria 1464
549 Ga0501039_0115705 3300049575 Bacteria 2099
550 Ga0501039_0152263 3300049575 Bacteria 1817
551 Ga0501042_0215238 3300049578 Bacteria 1386
552 Ga0501046_0000008 3300049580 Bacteria 351167
553 Ga0501047_0000003 3300049581 Bacteria 508375
554 Ga0501048_0000759 3300049582 Bacteria 23664
555 Ga0501068_0057214 3300049584 Bacteria 2364
556 Ga0501071_0007694 3300049587 Bacteria 7099
557 Ga0501072_0067174 3300049588 Bacteria 2829
558 Ga0501072_0097805 3300049588 Bacteria 2333
559 Ga0501075_0022897 3300049591 Bacteria 4569
560 Ga0501075_0090428 3300049591 Bacteria 2322
561 Ga0501198_000014 3300049649 Bacteria 106940
562 Ga0501222_000008 3300049662 Bacteria 120904
563 Ga0501081_0093588 3300049743 Bacteria 2116
564 nmdc:mga00v17_162367_c1 3300050491 Bacteria 1439
565 nmdc:mga00v17_7516_c1 3300050491 Bacteria 5816
566 nmdc:mga0yw44_179129_c1 3300050492 Bacteria 1394
567 nmdc:mga0k408_10378_c1 3300050493 Bacteria 5038
568 nmdc:mga0k408_1923_c1 3300050493 Bacteria 11126
569 nmdc:mga0k408_674_c1 3300050493 Bacteria 18724
570 nmdc:mga06z11_24680_c1 3300050494 Bacteria 2840
571 nmdc:mga04h51_17493_c1 3300050495 Bacteria 2098
572 nmdc:mga07m45_1847_c1 3300050496 Bacteria 9784
573 nmdc:mga07m45_64432_c1 3300050496 Bacteria 2080
574 nmdc:mga07m45_67_c1 3300050496 Bacteria 40608
575 nmdc:mga05p37_2159_c1 3300050507 Bacteria 22932
576 nmdc:mga09592_116384_c1 3300050508 Bacteria 2294
577 nmdc:mga09592_1272_c1 3300050508 Bacteria 20245
578 nmdc:mga09592_4981_c1 3300050508 Bacteria 10766
579 nmdc:mga0qj67_95144_c1 3300050509 Bacteria 2397
580 nmdc:mga06r32_102221_c1 3300050510 Bacteria 2813
581 nmdc:mga08y16_24628_c1 3300050511 Bacteria 6352
582 nmdc:mga08y16_6286_c1 3300050511 Bacteria 12456
583 nmdc:mga0n895_78702_c1 3300050512 Bacteria 3282
584 nmdc:mga0rr50_23609_c1 3300050513 Bacteria 4244
585 nmdc:mga0rr50_6074_c1 3300050513 Bacteria 7300
586 nmdc:mga08x19_104198_c1 3300050514 Bacteria 1885
587 nmdc:mga08x19_8685_c1 3300050514 Bacteria 6058
588 nmdc:mga0a205_4256_c1 3300050515 Bacteria 12848
589 Ga0500610_0009084 3300053079 Bacteria 4376
590 Ga0500578_0000213 3300053086 Bacteria 71211
591 Ga0500646_0002996 3300053090 Bacteria 4335
592 Ga0500583_0014783 3300053092 Bacteria 3068
593 Ga0500651_0155656 3300053093 Bacteria 1370
594 Ga0500593_000422 3300053117 Bacteria 16701
595 Ga0500593_000462 3300053117 Bacteria 16125
596 Ga0500607_001465 3300053121 Bacteria 21347
597 Ga0500652_000839 3300053131 Bacteria 10178
598 Ga0500658_0018122 3300053134 Bacteria 2636
599 Ga0500568_0016337 3300053139 Bacteria 3302
600 Ga0500590_008920 3300053148 Bacteria 5025
601 Ga0500619_000072 3300053154 Bacteria 29312
602 Ga0500622_0003145 3300053156 Bacteria 11307
603 Ga0500634_0032937 3300053161 Bacteria 2824
604 Ga0501084_0077948 3300054114 Bacteria 2778
605 Ga0501082_0147747 3300060353 Bacteria 2041
606 Ga0466962_0006241 3300061719 Bacteria 5725
607 Ga0466962_0012492 3300061719 Bacteria 4082

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041413 Ga0439465_0054402 Ga0439465_0054402_218_1291 357
2 3300042126 Ga0450888_006183 Ga0450888_006183_206_1279 357
3 3300048908 Ga0496105_0319802 Ga0496105_0319802_158_1231 357
4 3300049578 Ga0501042_0215238 Ga0501042_0215238_34_1257 359
5 3300006038 Ga0075365_10036673 Ga0075365_100366732 370
6 3300006042 Ga0075368_10007889 Ga0075368_100078893 370
7 3300006048 Ga0075363_100009910 Ga0075363_1000099104 370
8 3300006051 Ga0075364_10058818 Ga0075364_100588182 370
9 3300006178 Ga0075367_10013104 Ga0075367_100131042 370
10 3300006195 Ga0075366_10017479 Ga0075366_100174794 370
11 3300050491 nmdc:mga00v17_162367_c1 nmdc:mga00v17_162367_c1_23_1276 370
12 3300050495 nmdc:mga04h51_17493_c1 nmdc:mga04h51_17493_c1_164_1417 370
13 3300005548 Ga0070665_100026163 Ga0070665_1000261637 371
14 3300028379 Ga0268266_10267656 Ga0268266_102676561 371
15 3300006178 Ga0075367_10162304 Ga0075367_101623041 372
16 3300027907 Ga0207428_10000624 Ga0207428_100006249 373
17 3300035115 Ga0373941_0030681 Ga0373941_0030681_58_1281 373
18 3300048927 Ga0496124_0000036 Ga0496124_0000036_251168_252448 373
19 3300005330 Ga0070690_100003369 Ga0070690_1000033698 374
20 3300005334 Ga0068869_100006668 Ga0068869_1000066684 374
21 3300005338 Ga0068868_100010982 Ga0068868_1000109828 374
22 3300005340 Ga0070689_100002360 Ga0070689_1000023609 374
23 3300005364 Ga0070673_100045204 Ga0070673_1000452042 374
24 3300005438 Ga0070701_10003296 Ga0070701_100032962 374
25 3300005441 Ga0070700_100010066 Ga0070700_1000100664 374
26 3300005444 Ga0070694_100016546 Ga0070694_1000165464 374
27 3300005458 Ga0070681_10248211 Ga0070681_102482112 374
28 3300005459 Ga0068867_100009496 Ga0068867_1000094968 374
29 3300005544 Ga0070686_100005616 Ga0070686_1000056162 374
30 3300005545 Ga0070695_100009100 Ga0070695_1000091005 374
31 3300005546 Ga0070696_100001380 Ga0070696_10000138016 374
32 3300005547 Ga0070693_100000208 Ga0070693_10000020813 374
33 3300005547 Ga0070693_100134238 Ga0070693_1001342381 374
34 3300005549 Ga0070704_100017542 Ga0070704_1000175421 374
35 3300005563 Ga0068855_100015728 Ga0068855_10001572810 374
36 3300005614 Ga0068856_100036287 Ga0068856_1000362874 374
37 3300005615 Ga0070702_100004253 Ga0070702_1000042538 374
38 3300005617 Ga0068859_100006943 Ga0068859_1000069435 374
39 3300005718 Ga0068866_10003990 Ga0068866_100039905 374
40 3300005719 Ga0068861_100065877 Ga0068861_1000658772 374
41 3300005842 Ga0068858_100003477 Ga0068858_1000034773 374
42 3300005843 Ga0068860_100006430 Ga0068860_1000064305 374
43 3300005844 Ga0068862_100007738 Ga0068862_1000077388 374
44 3300006237 Ga0097621_100006336 Ga0097621_1000063369 374
45 3300006358 Ga0068871_100000860 Ga0068871_1000008607 374
46 3300006844 Ga0075428_100004699 Ga0075428_10000469911 374
47 3300006852 Ga0075433_10018417 Ga0075433_100184175 374
48 3300006871 Ga0075434_100016509 Ga0075434_1000165097 374
49 3300006880 Ga0075429_100000786 Ga0075429_10000078620 374
50 3300006881 Ga0068865_100004558 Ga0068865_1000045583 374
51 3300006914 Ga0075436_100007561 Ga0075436_1000075615 374
52 3300006931 Ga0097620_100006944 Ga0097620_1000069448 374
53 3300009094 Ga0111539_10032268 Ga0111539_100322688 374
54 3300009098 Ga0105245_10020049 Ga0105245_100200497 374
55 3300009148 Ga0105243_10002743 Ga0105243_100027432 374
56 3300009176 Ga0105242_10003088 Ga0105242_1000308814 374
57 3300009553 Ga0105249_10016514 Ga0105249_100165148 374
58 3300013297 Ga0157378_10013173 Ga0157378_100131739 374
59 3300025918 Ga0207662_10000451 Ga0207662_100004513 374
60 3300025921 Ga0207652_10042969 Ga0207652_100429695 374
61 3300025927 Ga0207687_10003609 Ga0207687_1000360913 374
62 3300025934 Ga0207686_10012404 Ga0207686_100124044 374
63 3300025935 Ga0207709_10001689 Ga0207709_100016892 374
64 3300025936 Ga0207670_10004486 Ga0207670_100044863 374
65 3300025942 Ga0207689_10001368 Ga0207689_1000136815 374
66 3300025949 Ga0207667_10020298 Ga0207667_100202982 374
67 3300025960 Ga0207651_10067767 Ga0207651_100677673 374
68 3300025961 Ga0207712_10025840 Ga0207712_100258404 374
69 3300026023 Ga0207677_10006533 Ga0207677_100065338 374
70 3300026035 Ga0207703_10016330 Ga0207703_100163303 374
71 3300026075 Ga0207708_10000114 Ga0207708_1000011428 374
72 3300026078 Ga0207702_10060486 Ga0207702_100604863 374
73 3300026088 Ga0207641_10055731 Ga0207641_100557312 374
74 3300026089 Ga0207648_10003084 Ga0207648_1000308417 374
75 3300026118 Ga0207675_100004938 Ga0207675_1000049383 374
76 3300028380 Ga0268265_10130619 Ga0268265_101306192 374
77 3300028381 Ga0268264_10005385 Ga0268264_100053852 374
78 3300028381 Ga0268264_10105768 Ga0268264_101057682 374
79 3300035088 Ga0373940_0013014 Ga0373940_0013014_471_1694 374
80 3300035112 Ga0373932_0013913 Ga0373932_0013913_608_1831 374
81 3300045051 Ga0451576_0000220 Ga0451576_0000220_42430_43653 374
82 3300050511 nmdc:mga08y16_24628_c1 nmdc:mga08y16_24628_c1_4528_5751 374
83 3300050512 nmdc:mga0n895_78702_c1 nmdc:mga0n895_78702_c1_672_1895 374
84 3300050513 nmdc:mga0rr50_6074_c1 nmdc:mga0rr50_6074_c1_2797_4020 374
85 3300050514 nmdc:mga08x19_8685_c1 nmdc:mga08x19_8685_c1_1930_3153 374
86 3300050515 nmdc:mga0a205_4256_c1 nmdc:mga0a205_4256_c1_11298_12521 374
87 3300032004 Ga0307414_10089455 Ga0307414_100894552 375
88 3300005467 Ga0070706_100012975 Ga0070706_1000129752 376
89 3300006195 Ga0075366_10008365 Ga0075366_100083653 376
90 3300025910 Ga0207684_10039424 Ga0207684_100394243 376
91 3300049588 Ga0501072_0067174 Ga0501072_0067174_1089_2312 376
92 3300035113 Ga0373936_0008562 Ga0373936_0008562_2072_3310 378
93 3300035116 Ga0373945_0014220 Ga0373945_0014220_1354_2592 378
94 3300035170 Ga0373943_0009478 Ga0373943_0009478_2932_4170 378
95 3300035692 Ga0373935_0020327 Ga0373935_0020327_766_2004 378
96 3300035725 Ga0373947_0086584 Ga0373947_0086584_235_1473 378
97 3300046455 Ga0495603_0021192 Ga0495603_0021192_2394_3632 378
98 3300046472 Ga0495580_0010221 Ga0495580_0010221_5904_7142 378
99 3300046473 Ga0495582_0020920 Ga0495582_0020920_156_1394 378
100 3300046535 Ga0495586_0053035 Ga0495586_0053035_60_1298 378
101 3300046674 Ga0495588_0011820 Ga0495588_0011820_2618_3856 378
102 3300046681 Ga0495647_0000629 Ga0495647_0000629_1638_2876 378
103 3300046683 Ga0495658_0005679 Ga0495658_0005679_3272_4510 378
104 3300047472 Ga0495686_0134405 Ga0495686_0134405_28_1287 378
105 3300006042 Ga0075368_10046739 Ga0075368_100467392 379
106 3300006847 Ga0075431_100125543 Ga0075431_1001255432 380
107 3300050510 nmdc:mga06r32_102221_c1 nmdc:mga06r32_102221_c1_277_1518 380
108 3300050511 nmdc:mga08y16_6286_c1 nmdc:mga08y16_6286_c1_7294_8568 380
109 3300009147 Ga0114129_10042609 Ga0114129_100426092 381
110 3300035242 Ga0373962_0026958 Ga0373962_0026958_234_1508 381
111 3300050507 nmdc:mga05p37_2159_c1 nmdc:mga05p37_2159_c1_6038_7312 381
112 3300050508 nmdc:mga09592_1272_c1 nmdc:mga09592_1272_c1_16361_17635 381
113 3300053092 Ga0500583_0014783 Ga0500583_0014783_89_1345 381
114 3300003792 Ga0055540_1010338 Ga0055540_10103383 382
115 3300003794 Ga0055531_10004871 Ga0055531_100048712 382
116 3300021361 Ga0213872_10009186 Ga0213872_100091864 382
117 3300025303 Ga0209051_1000173 Ga0209051_100017332 382
118 3300025304 Ga0209257_1000096 Ga0209257_100009641 382
119 3300025921 Ga0207652_10045633 Ga0207652_100456332 382
120 3300039447 Ga0436361_0371412 Ga0436361_0371412_14588_15841 382
121 3300037471 Ga0395905_0234720 Ga0395905_0234720_355_1608 383
122 3300037471 Ga0395905_0270118 Ga0395905_0270118_418_1572 384
123 3300005617 Ga0068859_100012344 Ga0068859_1000123442 385
124 3300005842 Ga0068858_100006859 Ga0068858_1000068596 385
125 3300005843 Ga0068860_100007870 Ga0068860_10000787015 385
126 3300006038 Ga0075365_10014106 Ga0075365_100141063 385
127 3300006931 Ga0097620_100012344 Ga0097620_1000123449 385
128 3300014326 Ga0157380_10008226 Ga0157380_100082269 385
129 3300021361 Ga0213872_10000006 Ga0213872_10000006223 385
130 3300021361 Ga0213872_10001699 Ga0213872_100016998 385
131 3300026035 Ga0207703_10033407 Ga0207703_100334073 385
132 3300039447 Ga0436361_0215868 Ga0436361_0215868_6848_8104 385
133 3300039447 Ga0436361_0337087 Ga0436361_0337087_6529_7785 385
134 3300006948 Ga0099826_10000821 Ga0099826_1000082110 386
135 3300025297 Ga0209758_1000146 Ga0209758_100014611 386
136 3300027666 Ga0209282_1001176 Ga0209282_100117611 386
137 3300053093 Ga0500651_0155656 Ga0500651_0155656_86_1342 386
138 3300042015 Ga0439462_0000404 Ga0439462_0000404_581_1834 387
139 3300042876 Ga0451577_0060099 Ga0451577_0060099_703_1956 387
140 3300044673 Ga0453683_0008042 Ga0453683_0008042_297_1550 387
141 3300044712 Ga0453684_0296871 Ga0453684_0296871_188_1441 387
142 3300045051 Ga0451576_0024152 Ga0451576_0024152_1078_2331 387
143 3300042439 Ga0439464_0006437 Ga0439464_0006437_1200_2453 388
144 3300005355 Ga0070671_100047484 Ga0070671_1000474842 390
145 3300006847 Ga0075431_100183686 Ga0075431_1001836863 390
146 3300006880 Ga0075429_100091766 Ga0075429_1000917662 390
147 3300009147 Ga0114129_10049253 Ga0114129_100492532 390
148 3300025931 Ga0207644_10010073 Ga0207644_100100733 390
149 3300025961 Ga0207712_10061553 Ga0207712_100615531 390
150 3300037312 Ga0395899_0029996 Ga0395899_0029996_1905_3158 390
151 3300037466 Ga0395898_0037496 Ga0395898_0037496_3040_4293 390
152 3300037471 Ga0395905_0323256 Ga0395905_0323256_161_1417 390
153 3300038443 Ga0395901_0091140 Ga0395901_0091140_175_1428 390
154 3300044658 Ga0466972_0001197 Ga0466972_0001197_10956_12212 390
155 3300048911 Ga0496108_0013424 Ga0496108_0013424_3675_4931 390
156 3300048912 Ga0496109_0246606 Ga0496109_0246606_303_1559 390
157 3300050508 nmdc:mga09592_116384_c1 nmdc:mga09592_116384_c1_746_1987 390
158 3300025931 Ga0207644_10075627 Ga0207644_100756272 391
159 3300031250 Ga0265331_10003815 Ga0265331_1000381510 391
160 3300031251 Ga0265327_10000328 Ga0265327_1000032811 391
161 3300035117 Ga0373953_0007230 Ga0373953_0007230_1625_2863 391
162 3300036401 Ga0373937_0013036 Ga0373937_0013036_22_1260 391
163 3300042127 Ga0450890_005770 Ga0450890_005770_97_1350 391
164 3300046519 Ga0495632_0008077 Ga0495632_0008077_4427_5653 391
165 3300049580 Ga0501046_0000008 Ga0501046_0000008_66983_68239 391
166 3300049581 Ga0501047_0000003 Ga0501047_0000003_90165_91421 391
167 3300049582 Ga0501048_0000759 Ga0501048_0000759_19210_20466 391
168 3300003759 Ga0055525_1000031 Ga0055525_1000031276 392
169 3300005295 Ga0065707_10179379 Ga0065707_101793791 392
170 3300006353 Ga0075370_10018144 Ga0075370_100181442 392
171 3300025230 Ga0209563_100044 Ga0209563_100044345 392
172 3300037471 Ga0395905_0009246 Ga0395905_0009246_594_1853 392
173 3300046522 Ga0495643_0053068 Ga0495643_0053068_213_1484 392
174 3300046694 Ga0495649_0027103 Ga0495649_0027103_620_1891 392
175 3300046810 Ga0495660_0044493 Ga0495660_0044493_1069_2340 392
176 3300047443 Ga0495687_000500 Ga0495687_000500_17460_18731 392
177 3300047443 Ga0495687_001392 Ga0495687_001392_9972_11243 392
178 3300047443 Ga0495687_005890 Ga0495687_005890_5373_6644 392
179 3300006353 Ga0075370_10000276 Ga0075370_1000027613 393
180 3300026142 Ga0207698_10044424 Ga0207698_100444243 393
181 3300049572 Ga0501036_0098347 Ga0501036_0098347_680_1921 393
182 3300049575 Ga0501039_0115705 Ga0501039_0115705_272_1513 393
183 3300049584 Ga0501068_0057214 Ga0501068_0057214_556_1797 393
184 3300049587 Ga0501071_0007694 Ga0501071_0007694_2162_3403 393
185 3300049588 Ga0501072_0097805 Ga0501072_0097805_497_1738 393
186 3300049591 Ga0501075_0022897 Ga0501075_0022897_1534_2775 393
187 3300049743 Ga0501081_0093588 Ga0501081_0093588_717_1958 393
188 3300050496 nmdc:mga07m45_67_c1 nmdc:mga07m45_67_c1_14996_16267 393
189 3300054114 Ga0501084_0077948 Ga0501084_0077948_871_2112 393
190 3300060353 Ga0501082_0147747 Ga0501082_0147747_618_1859 393
191 3300003187 JGI25151J46595_10001626 JGI25151J46595_100016264 394
192 3300005844 Ga0068862_100040990 Ga0068862_1000409902 394
193 3300009093 Ga0105240_10003836 Ga0105240_1000383613 394
194 3300009545 Ga0105237_10001634 Ga0105237_1000163411 394
195 3300010375 Ga0105239_10002435 Ga0105239_100024357 394
196 3300021361 Ga0213872_10000132 Ga0213872_1000013253 394
197 3300025924 Ga0207694_10012902 Ga0207694_100129022 394
198 3300025935 Ga0207709_10041459 Ga0207709_100414592 394
199 3300026041 Ga0207639_10029251 Ga0207639_100292513 394
200 3300039447 Ga0436361_1206467 Ga0436361_1206467_8581_9840 394
201 3300046471 Ga0495650_0000976 Ga0495650_0000976_13466_14737 394
202 3300048928 Ga0496125_0128776 Ga0496125_0128776_114_1370 394
203 3300003354 JGI25160J50197_1013023 JGI25160J50197_10130232 395
204 3300003761 Ga0055535_1001453 Ga0055535_10014532 395
205 3300003762 Ga0055542_1001330 Ga0055542_100133011 395
206 3300003762 Ga0055542_1001423 Ga0055542_10014236 395
207 3300003771 Ga0055526_1003910 Ga0055526_10039101 395
208 3300003771 Ga0055526_1003992 Ga0055526_10039925 395
209 3300003771 Ga0055526_1006280 Ga0055526_10062805 395
210 3300003773 Ga0055537_1002046 Ga0055537_10020463 395
211 3300003775 Ga0055524_1000360 Ga0055524_100036029 395
212 3300003781 Ga0055536_1000889 Ga0055536_10008898 395
213 3300003781 Ga0055536_1004343 Ga0055536_10043433 395
214 3300003784 Ga0055534_1000386 Ga0055534_100038616 395
215 3300003784 Ga0055534_1002111 Ga0055534_10021114 395
216 3300003792 Ga0055540_1000393 Ga0055540_100039310 395
217 3300005262 Ga0065165_1007030 Ga0065165_10070305 395
218 3300005564 Ga0070664_100019354 Ga0070664_1000193542 395
219 3300005834 Ga0068851_10032784 Ga0068851_100327841 395
220 3300006048 Ga0075363_100085214 Ga0075363_1000852141 395
221 3300006051 Ga0075364_10019781 Ga0075364_100197813 395
222 3300006195 Ga0075366_10004350 Ga0075366_100043508 395
223 3300006946 Ga0079104_1000910 Ga0079104_100091016 395
224 3300009148 Ga0105243_10001150 Ga0105243_100011505 395
225 3300009148 Ga0105243_10018250 Ga0105243_100182502 395
226 3300013307 Ga0157372_10156911 Ga0157372_101569112 395
227 3300014497 Ga0182008_10000287 Ga0182008_1000028720 395
228 3300015261 Ga0182006_1011726 Ga0182006_10117262 395
229 3300015262 Ga0182007_10000736 Ga0182007_100007369 395
230 3300025224 Ga0209784_100516 Ga0209784_10051610 395
231 3300025225 Ga0209566_101242 Ga0209566_1012425 395
232 3300025226 Ga0209674_100179 Ga0209674_10017954 395
233 3300025228 Ga0209672_101105 Ga0209672_1011059 395
234 3300025229 Ga0209147_100741 Ga0209147_1007413 395
235 3300025230 Ga0209563_105942 Ga0209563_1059422 395
236 3300025242 Ga0209258_100009 Ga0209258_100009950 395
237 3300025245 Ga0207425_1000169 Ga0207425_100016946 395
238 3300025246 Ga0209646_1000022 Ga0209646_1000022311 395
239 3300025254 Ga0209148_1000007 Ga0209148_1000007950 395
240 3300025254 Ga0209148_1000021 Ga0209148_1000021502 395
241 3300025256 Ga0209759_1006726 Ga0209759_10067262 395
242 3300025258 Ga0209129_1000024 Ga0209129_1000024127 395
243 3300025258 Ga0209129_1003682 Ga0209129_10036825 395
244 3300025258 Ga0209129_1004780 Ga0209129_10047803 395
245 3300025263 Ga0209565_1000235 Ga0209565_100023521 395
246 3300025263 Ga0209565_1000286 Ga0209565_10002867 395
247 3300025263 Ga0209565_1000825 Ga0209565_10008253 395
248 3300025273 Ga0209673_1000410 Ga0209673_100041039 395
249 3300025284 Ga0209130_1000383 Ga0209130_10003837 395
250 3300025291 Ga0209675_1000125 Ga0209675_100012529 395
251 3300025291 Ga0209675_1000151 Ga0209675_100015148 395
252 3300025291 Ga0209675_1000312 Ga0209675_100031229 395
253 3300025292 Ga0209676_1000014 Ga0209676_100001465 395
254 3300025292 Ga0209676_1000028 Ga0209676_1000028230 395
255 3300025292 Ga0209676_1000275 Ga0209676_10002757 395
256 3300025292 Ga0209676_1000780 Ga0209676_100078042 395
257 3300025294 Ga0209025_1000379 Ga0209025_100037916 395
258 3300025294 Ga0209025_1001571 Ga0209025_100157112 395
259 3300025294 Ga0209025_1001709 Ga0209025_100170911 395
260 3300025294 Ga0209025_1013208 Ga0209025_10132084 395
261 3300025295 Ga0209564_1000209 Ga0209564_100020945 395
262 3300025295 Ga0209564_1001235 Ga0209564_100123513 395
263 3300025295 Ga0209564_1001259 Ga0209564_100125916 395
264 3300025295 Ga0209564_1002311 Ga0209564_10023118 395
265 3300025297 Ga0209758_1000049 Ga0209758_100004946 395
266 3300025298 Ga0209050_1000002 Ga0209050_100000213 395
267 3300025298 Ga0209050_1029450 Ga0209050_10294501 395
268 3300025299 Ga0209256_1000253 Ga0209256_100025328 395
269 3300025299 Ga0209256_1000291 Ga0209256_100029110 395
270 3300025299 Ga0209256_1000700 Ga0209256_10007009 395
271 3300025302 Ga0207426_1000053 Ga0207426_100005382 395
272 3300025303 Ga0209051_1000015 Ga0209051_1000015159 395
273 3300025303 Ga0209051_1000531 Ga0209051_100053132 395
274 3300025303 Ga0209051_1015948 Ga0209051_10159483 395
275 3300025304 Ga0209257_1001928 Ga0209257_10019285 395
276 3300025304 Ga0209257_1006537 Ga0209257_10065375 395
277 3300025728 Ga0207655_1006582 Ga0207655_10065822 395
278 3300025933 Ga0207706_10034273 Ga0207706_100342735 395
279 3300025935 Ga0207709_10000211 Ga0207709_1000021170 395
280 3300025935 Ga0207709_10004882 Ga0207709_100048822 395
281 3300026067 Ga0207678_10173229 Ga0207678_101732292 395
282 3300026116 Ga0207674_10039486 Ga0207674_100394862 395
283 3300027111 Ga0209281_1000195 Ga0209281_100019552 395
284 3300031731 Ga0307405_10019331 Ga0307405_100193312 395
285 3300041411 Ga0439466_0011362 Ga0439466_0011362_335_1591 395
286 3300042125 Ga0450923_000865 Ga0450923_000865_2208_3464 395
287 3300042184 Ga0450908_001881 Ga0450908_001881_1768_3024 395
288 3300042435 Ga0439434_0020281 Ga0439434_0020281_371_1627 395
289 3300042876 Ga0451577_0005895 Ga0451577_0005895_8905_10173 395
290 3300044656 Ga0466969_0009596 Ga0466969_0009596_733_2022 395
291 3300044683 Ga0466965_0032924 Ga0466965_0032924_370_1620 395
292 3300044684 Ga0466966_0097031 Ga0466966_0097031_329_1618 395
293 3300044693 Ga0466961_0002008 Ga0466961_0002008_9675_10925 395
294 3300044706 Ga0466964_0001102 Ga0466964_0001102_6729_7979 395
295 3300044735 Ga0466968_0020759 Ga0466968_0020759_1207_2457 395
296 3300045049 Ga0466959_0002786 Ga0466959_0002786_1728_2978 395
297 3300045049 Ga0466959_0017291 Ga0466959_0017291_178_1467 395
298 3300045976 Ga0466967_0032384 Ga0466967_0032384_1434_2684 395
299 3300046513 Ga0495616_0000675 Ga0495616_0000675_14945_16201 395
300 3300046660 Ga0495625_0000611 Ga0495625_0000611_43021_44277 395
301 3300048905 Ga0496102_0014103 Ga0496102_0014103_1318_2583 395
302 3300048919 Ga0496116_0011195 Ga0496116_0011195_786_2042 395
303 3300048921 Ga0496118_0007164 Ga0496118_0007164_1528_2784 395
304 3300050491 nmdc:mga00v17_7516_c1 nmdc:mga00v17_7516_c1_751_2007 395
305 3300050493 nmdc:mga0k408_1923_c1 nmdc:mga0k408_1923_c1_5971_7227 395
306 3300050496 nmdc:mga07m45_1847_c1 nmdc:mga07m45_1847_c1_6229_7485 395
307 3300053086 Ga0500578_0000213 Ga0500578_0000213_19427_20665 395
308 3300061719 Ga0466962_0006241 Ga0466962_0006241_4425_5675 395
309 iso_pu_bacteria 2513237150 2513952918 395
310 iso_pu_bacteria 2513237165 2514042433 395
311 iso_pu_bacteria 2834641062 2834641808 395
312 iso_pu_bacteria 2885266251 2885266863 395
313 iso_pu_bacteria 2928058823 2928062821 395
314 iso_pu_bacteria 644736347 644747467 395
315 iso_pu_bacteria 8003400568 8003404648 395
316 3300006948 Ga0099826_10000004 Ga0099826_10000004469 396
317 3300025294 Ga0209025_1000423 Ga0209025_100042355 396
318 3300027666 Ga0209282_1000027 Ga0209282_100002720 396
319 3300037471 Ga0395905_0022801 Ga0395905_0022801_3049_4305 396
320 3300042007 Ga0439449_0013872 Ga0439449_0013872_705_1961 396
321 3300042876 Ga0451577_0022122 Ga0451577_0022122_397_1662 396
322 3300045051 Ga0451576_0340532 Ga0451576_0340532_161_1417 396
323 3300046474 Ga0495605_0000836 Ga0495605_0000836_9190_10479 396
324 3300046491 Ga0495584_0027555 Ga0495584_0027555_1139_2428 396
325 3300046500 Ga0495596_0000574 Ga0495596_0000574_6090_7379 396
326 3300046501 Ga0495607_0010311 Ga0495607_0010311_1645_2934 396
327 3300046512 Ga0495610_0003801 Ga0495610_0003801_7816_9105 396
328 3300046692 Ga0495671_0000883 Ga0495671_0000883_15425_16714 396
329 3300046694 Ga0495649_0028621 Ga0495649_0028621_1519_2808 396
330 3300048905 Ga0496102_0044454 Ga0496102_0044454_180_1436 396
331 3300048919 Ga0496116_0003117 Ga0496116_0003117_1375_2664 396
332 3300048924 Ga0496121_0018310 Ga0496121_0018310_186_1475 396
333 3300049575 Ga0501039_0152263 Ga0501039_0152263_261_1517 396
334 3300049591 Ga0501075_0090428 Ga0501075_0090428_796_2052 396
335 3300053117 Ga0500593_000462 Ga0500593_000462_12849_14105 396
336 iso_pu_bacteria 2839138175 2839142578 396
337 3300005536 Ga0070697_100114875 Ga0070697_1001148752 397
338 3300005545 Ga0070695_100011804 Ga0070695_1000118043 397
339 3300005546 Ga0070696_100013721 Ga0070696_1000137213 397
340 3300006173 Ga0070716_100115045 Ga0070716_1001150452 397
341 3300025933 Ga0207706_10001386 Ga0207706_1000138612 397
342 3300025939 Ga0207665_10086928 Ga0207665_100869282 397
343 3300031507 Ga0307509_10000031 Ga0307509_10000031126 397
344 3300032002 Ga0307416_100122804 Ga0307416_1001228042 397
345 3300037471 Ga0395905_0004785 Ga0395905_0004785_4415_5668 397
346 3300050513 nmdc:mga0rr50_23609_c1 nmdc:mga0rr50_23609_c1_587_1828 397
347 3300050514 nmdc:mga08x19_104198_c1 nmdc:mga08x19_104198_c1_262_1503 397
348 iso_pu_bacteria 2513020051 2513231245 397
349 iso_pu_bacteria 2585428057 2587724856 397
350 iso_pu_bacteria 2585428058 2587736737 397
351 iso_pu_bacteria 2588253510 2588295347 397
352 iso_pu_bacteria 2599185214 2599620533 397
353 iso_pu_bacteria 2599185226 2599673831 397
354 iso_pu_bacteria 2599185227 2599678852 397
355 iso_pu_bacteria 2599185229 2599690043 397
356 iso_pu_bacteria 2643221585 2643936437 397
357 iso_pu_bacteria 2643221592 2643970219 397
358 iso_pu_bacteria 2643221625 2644142383 397
359 iso_pu_bacteria 2643221628 2644162209 397
360 iso_pu_bacteria 2643221644 2644246997 397
361 iso_pu_bacteria 2643221648 2644275151 397
362 iso_pu_bacteria 2643221656 2644317793 397
363 iso_pu_bacteria 2643221658 2644324344 397
364 iso_pu_bacteria 2643221660 2644338178 397
365 iso_pu_bacteria 2643221672 2644396188 397
366 iso_pu_bacteria 2643221683 2644464816 397
367 iso_pu_bacteria 2738541277 2738720427 397
368 iso_pu_bacteria 2738541307 2738880356 397
369 iso_pu_bacteria 2738543013 2739248012 397
370 iso_pu_bacteria 2738543019 2739279626 397
371 iso_pu_bacteria 2818991446 2819601109 397
372 iso_pu_bacteria 2831265667 2831271578 397
373 iso_pu_bacteria 2838054893 2838055480 397
374 iso_pu_bacteria 2842677519 2842682098 397
375 iso_pu_bacteria 2842733646 2842734163 397
376 iso_pu_bacteria 2842747753 2842749577 397
377 iso_pu_bacteria 2885192300 2885193138 397
378 iso_pu_bacteria 2885198086 2885200986 397
379 iso_pu_bacteria 2885211737 2885214231 397
380 iso_pu_bacteria 2899924645 2899927544 397
381 iso_pu_bacteria 2904449895 2904450723 397
382 iso_pu_bacteria 2904456579 2904459777 397
383 iso_pu_bacteria 2904479285 2904483518 397
384 iso_pu_bacteria 2904541872 2904547917 397
385 iso_pu_bacteria 2919462493 2919462747 397
386 iso_pu_bacteria 2928037797 2928042543 397
387 iso_pu_bacteria 2928044640 2928049030 397
388 iso_pu_bacteria 2928051484 2928051581 397
389 iso_pu_bacteria 2928064002 2928070803 397
390 iso_pu_bacteria 2928070936 2928073212 397
391 iso_pu_bacteria 2928084124 2928086972 397
392 iso_pu_bacteria 2928115317 2928115480 397
393 iso_pu_bacteria 2929160207 2929161702 397
394 iso_pu_bacteria 2929520902 2929521441 397
395 iso_pu_bacteria 2932422444 2932425338 397
396 iso_pu_bacteria 2945909444 2945913906 397
397 iso_pu_bacteria 2945945610 2945949453 397
398 iso_pu_bacteria 2945972063 2945973500 397
399 iso_pu_bacteria 2945984333 2945990696 397
400 iso_pu_bacteria 2954767861 2954770893 397
401 3300030521 Ga0307511_10000248 Ga0307511_1000024827 398
402 3300031852 Ga0307410_10103386 Ga0307410_101033862 398
403 3300042007 Ga0439449_0021363 Ga0439449_0021363_167_1420 398
404 3300005328 Ga0070676_10013767 Ga0070676_100137673 399
405 3300005331 Ga0070670_100015056 Ga0070670_1000150565 399
406 3300005334 Ga0068869_100033907 Ga0068869_1000339075 399
407 3300005353 Ga0070669_100005917 Ga0070669_1000059176 399
408 3300005354 Ga0070675_100058026 Ga0070675_1000580263 399
409 3300005355 Ga0070671_100166738 Ga0070671_1001667382 399
410 3300005356 Ga0070674_100000568 Ga0070674_10000056811 399
411 3300005356 Ga0070674_100011792 Ga0070674_1000117927 399
412 3300005459 Ga0068867_100007834 Ga0068867_1000078344 399
413 3300005543 Ga0070672_100039019 Ga0070672_1000390193 399
414 3300005564 Ga0070664_100264621 Ga0070664_1002646211 399
415 3300005578 Ga0068854_100026600 Ga0068854_1000266003 399
416 3300005616 Ga0068852_100098873 Ga0068852_1000988732 399
417 3300005719 Ga0068861_100064370 Ga0068861_1000643702 399
418 3300005843 Ga0068860_100000968 Ga0068860_1000009689 399
419 3300005844 Ga0068862_100005951 Ga0068862_1000059514 399
420 3300006195 Ga0075366_10007203 Ga0075366_100072033 399
421 3300006358 Ga0068871_100024514 Ga0068871_1000245142 399
422 3300006880 Ga0075429_100002300 Ga0075429_1000023006 399
423 3300014969 Ga0157376_10079429 Ga0157376_100794292 399
424 3300017792 Ga0163161_10010411 Ga0163161_100104113 399
425 3300025893 Ga0207682_10003641 Ga0207682_100036417 399
426 3300025899 Ga0207642_10041594 Ga0207642_100415942 399
427 3300025907 Ga0207645_10024778 Ga0207645_100247784 399
428 3300025907 Ga0207645_10043333 Ga0207645_100433331 399
429 3300025923 Ga0207681_10005519 Ga0207681_100055196 399
430 3300025925 Ga0207650_10000265 Ga0207650_100002658 399
431 3300025926 Ga0207659_10001160 Ga0207659_100011604 399
432 3300025935 Ga0207709_10037486 Ga0207709_100374862 399
433 3300025940 Ga0207691_10000390 Ga0207691_1000039067 399
434 3300025940 Ga0207691_10029711 Ga0207691_100297113 399
435 3300026089 Ga0207648_10000789 Ga0207648_1000078918 399
436 3300026089 Ga0207648_10005196 Ga0207648_100051964 399
437 3300026089 Ga0207648_10027223 Ga0207648_100272232 399
438 3300026118 Ga0207675_100004863 Ga0207675_10000486313 399
439 3300026121 Ga0207683_10058744 Ga0207683_100587443 399
440 3300028381 Ga0268264_10042331 Ga0268264_100423313 399
441 3300031548 Ga0307408_100172309 Ga0307408_1001723092 399
442 3300031731 Ga0307405_10000483 Ga0307405_1000048313 399
443 3300031824 Ga0307413_10016227 Ga0307413_100162273 399
444 3300031903 Ga0307407_10008666 Ga0307407_100086662 399
445 3300032004 Ga0307414_10035226 Ga0307414_100352264 399
446 3300032005 Ga0307411_10037345 Ga0307411_100373452 399
447 3300041997 Ga0439431_0016410 Ga0439431_0016410_14_1270 399
448 3300042876 Ga0451577_0172188 Ga0451577_0172188_632_1888 399
449 3300044683 Ga0466965_0018707 Ga0466965_0018707_176_1432 399
450 3300044693 Ga0466961_0100650 Ga0466961_0100650_496_1752 399
451 3300044719 Ga0466971_0027410 Ga0466971_0027410_779_2035 399
452 3300044735 Ga0466968_0051879 Ga0466968_0051879_217_1473 399
453 3300044765 Ga0466970_0011713 Ga0466970_0011713_1186_2442 399
454 3300045836 Ga0466958_0092531 Ga0466958_0092531_374_1630 399
455 3300046457 Ga0495590_0010806 Ga0495590_0010806_1125_2483 399
456 3300049649 Ga0501198_000014 Ga0501198_000014_28824_30080 399
457 3300049662 Ga0501222_000008 Ga0501222_000008_74404_75660 399
458 3300050493 nmdc:mga0k408_10378_c1 nmdc:mga0k408_10378_c1_838_2094 399
459 3300050508 nmdc:mga09592_4981_c1 nmdc:mga09592_4981_c1_4211_5467 399
460 3300050509 nmdc:mga0qj67_95144_c1 nmdc:mga0qj67_95144_c1_1083_2339 399
461 3300061719 Ga0466962_0012492 Ga0466962_0012492_829_2085 399
462 3300005530 Ga0070679_100230249 Ga0070679_1002302492 400
463 3300006051 Ga0075364_10000943 Ga0075364_100009433 400
464 3300006195 Ga0075366_10065013 Ga0075366_100650132 400
465 3300006946 Ga0079104_1000055 Ga0079104_1000055122 400
466 3300009148 Ga0105243_10007469 Ga0105243_100074695 400
467 3300009176 Ga0105242_10000304 Ga0105242_1000030431 400
468 3300025273 Ga0209673_1015346 Ga0209673_10153463 400
469 3300025920 Ga0207649_10064964 Ga0207649_100649642 400
470 3300025934 Ga0207686_10001386 Ga0207686_100013863 400
471 3300025935 Ga0207709_10000273 Ga0207709_1000027326 400
472 3300027111 Ga0209281_1000007 Ga0209281_1000007707 400
473 3300028794 Ga0307515_10000132 Ga0307515_1000013273 400
474 3300031239 Ga0265328_10002207 Ga0265328_100022075 400
475 3300031251 Ga0265327_10000341 Ga0265327_1000034137 400
476 3300031456 Ga0307513_10012051 Ga0307513_100120519 400
477 3300031548 Ga0307408_100062988 Ga0307408_1000629883 400
478 3300031711 Ga0265314_10006635 Ga0265314_100066354 400
479 3300031711 Ga0265314_10025632 Ga0265314_100256324 400
480 3300037312 Ga0395899_0163687 Ga0395899_0163687_46_1335 400
481 3300037418 Ga0395900_0031313 Ga0395900_0031313_2786_4075 400
482 3300037466 Ga0395898_0022575 Ga0395898_0022575_1611_2900 400
483 3300037466 Ga0395898_0211872 Ga0395898_0211872_371_1633 400
484 3300037471 Ga0395905_0000025 Ga0395905_0000025_200792_202045 400
485 3300037471 Ga0395905_0000460 Ga0395905_0000460_30681_31970 400
486 3300037471 Ga0395905_0016841 Ga0395905_0016841_4424_5677 400
487 3300037471 Ga0395905_0023364 Ga0395905_0023364_1877_3166 400
488 3300037471 Ga0395905_0025632 Ga0395905_0025632_4061_5350 400
489 3300037471 Ga0395905_0040137 Ga0395905_0040137_1883_3172 400
490 3300037471 Ga0395905_0122647 Ga0395905_0122647_539_1828 400
491 3300037471 Ga0395905_0174150 Ga0395905_0174150_583_1836 400
492 3300038443 Ga0395901_0134674 Ga0395901_0134674_1198_2487 400
493 3300044735 Ga0466968_0015723 Ga0466968_0015723_1513_2826 400
494 3300045976 Ga0466967_0156104 Ga0466967_0156104_561_1814 400
495 3300048925 Ga0496122_0009675 Ga0496122_0009675_2181_3434 400
496 3300048929 Ga0496126_0006539 Ga0496126_0006539_5090_6343 400
497 3300049573 Ga0501037_0187924 Ga0501037_0187924_74_1327 400
498 iso_pu_bacteria 2721755523 2722882066 400
499 3300002773 JGI25152J39213_1006822 JGI25152J39213_10068223 401
500 3300002774 JGI25150J39212_1007356 JGI25150J39212_10073562 401
501 3300003187 JGI25151J46595_10002427 JGI25151J46595_100024276 401
502 3300003771 Ga0055526_1001897 Ga0055526_100189712 401
503 3300003775 Ga0055524_1000125 Ga0055524_100012528 401
504 3300003784 Ga0055534_1000986 Ga0055534_100098613 401
505 3300003791 Ga0055530_10016267 Ga0055530_100162672 401
506 3300003792 Ga0055540_1000011 Ga0055540_100001153 401
507 3300003794 Ga0055531_10004809 Ga0055531_100048097 401
508 3300005262 Ga0065165_1000967 Ga0065165_100096714 401
509 3300005335 Ga0070666_10000930 Ga0070666_1000093031 401
510 3300005338 Ga0068868_100001477 Ga0068868_1000014772 401
511 3300005353 Ga0070669_100036437 Ga0070669_1000364372 401
512 3300005354 Ga0070675_100044883 Ga0070675_1000448832 401
513 3300005354 Ga0070675_100060990 Ga0070675_1000609902 401
514 3300005354 Ga0070675_100091473 Ga0070675_1000914732 401
515 3300005355 Ga0070671_100041655 Ga0070671_1000416552 401
516 3300005355 Ga0070671_100060329 Ga0070671_1000603292 401
517 3300005367 Ga0070667_100051456 Ga0070667_1000514562 401
518 3300005455 Ga0070663_100001074 Ga0070663_10000107415 401
519 3300005456 Ga0070678_100000637 Ga0070678_10000063723 401
520 3300005459 Ga0068867_100068184 Ga0068867_1000681843 401
521 3300005467 Ga0070706_100259610 Ga0070706_1002596101 401
522 3300005543 Ga0070672_100031460 Ga0070672_1000314603 401
523 3300005543 Ga0070672_100093361 Ga0070672_1000933612 401
524 3300005563 Ga0068855_100431198 Ga0068855_1004311981 401
525 3300005564 Ga0070664_100017715 Ga0070664_1000177153 401
526 3300005577 Ga0068857_100089073 Ga0068857_1000890732 401
527 3300005616 Ga0068852_100020418 Ga0068852_1000204184 401
528 3300005617 Ga0068859_100001613 Ga0068859_10000161336 401
529 3300005618 Ga0068864_100039622 Ga0068864_1000396222 401
530 3300005618 Ga0068864_100133915 Ga0068864_1001339152 401
531 3300005718 Ga0068866_10058733 Ga0068866_100587332 401
532 3300005841 Ga0068863_100006228 Ga0068863_1000062284 401
533 3300005842 Ga0068858_100007536 Ga0068858_10000753612 401
534 3300005844 Ga0068862_100049190 Ga0068862_1000491905 401
535 3300006038 Ga0075365_10178564 Ga0075365_101785641 401
536 3300006042 Ga0075368_10008999 Ga0075368_100089993 401
537 3300006048 Ga0075363_100053231 Ga0075363_1000532311 401
538 3300006178 Ga0075367_10028385 Ga0075367_100283852 401
539 3300006195 Ga0075366_10005284 Ga0075366_100052847 401
540 3300006931 Ga0097620_100001613 Ga0097620_1000016135 401
541 3300009148 Ga0105243_10250372 Ga0105243_102503722 401
542 3300009177 Ga0105248_10022695 Ga0105248_100226955 401
543 3300013308 Ga0157375_10062266 Ga0157375_100622664 401
544 3300014325 Ga0163163_10061335 Ga0163163_100613352 401
545 3300014497 Ga0182008_10010682 Ga0182008_100106823 401
546 3300014968 Ga0157379_10050576 Ga0157379_100505763 401
547 3300015262 Ga0182007_10001789 Ga0182007_100017893 401
548 3300017792 Ga0163161_10000088 Ga0163161_1000008836 401
549 3300017792 Ga0163161_10080858 Ga0163161_100808581 401
550 3300021361 Ga0213872_10000004 Ga0213872_100000049 401
551 3300025245 Ga0207425_1001454 Ga0207425_10014548 401
552 3300025258 Ga0209129_1000027 Ga0209129_100002734 401
553 3300025273 Ga0209673_1004437 Ga0209673_10044373 401
554 3300025284 Ga0209130_1004634 Ga0209130_10046342 401
555 3300025291 Ga0209675_1001004 Ga0209675_10010049 401
556 3300025292 Ga0209676_1009775 Ga0209676_10097753 401
557 3300025294 Ga0209025_1000289 Ga0209025_100028985 401
558 3300025295 Ga0209564_1000139 Ga0209564_100013925 401
559 3300025297 Ga0209758_1000052 Ga0209758_100005286 401
560 3300025298 Ga0209050_1000583 Ga0209050_10005832 401
561 3300025298 Ga0209050_1000980 Ga0209050_10009804 401
562 3300025299 Ga0209256_1000113 Ga0209256_100011370 401
563 3300025303 Ga0209051_1000020 Ga0209051_100002052 401
564 3300025303 Ga0209051_1043986 Ga0209051_10439862 401
565 3300025304 Ga0209257_1000085 Ga0209257_100008552 401
566 3300025304 Ga0209257_1008315 Ga0209257_10083153 401
567 3300025893 Ga0207682_10017191 Ga0207682_100171912 401
568 3300025903 Ga0207680_10006275 Ga0207680_100062752 401
569 3300025926 Ga0207659_10031008 Ga0207659_100310082 401
570 3300025926 Ga0207659_10211516 Ga0207659_102115162 401
571 3300025931 Ga0207644_10035747 Ga0207644_100357472 401
572 3300025940 Ga0207691_10065242 Ga0207691_100652425 401
573 3300025940 Ga0207691_10123800 Ga0207691_101238003 401
574 3300025941 Ga0207711_10008232 Ga0207711_100082326 401
575 3300025941 Ga0207711_10030475 Ga0207711_100304753 401
576 3300025945 Ga0207679_10044103 Ga0207679_100441032 401
577 3300025949 Ga0207667_10416623 Ga0207667_104166231 401
578 3300025960 Ga0207651_10073917 Ga0207651_100739173 401
579 3300025972 Ga0207668_10247059 Ga0207668_102470592 401
580 3300025986 Ga0207658_10055793 Ga0207658_100557932 401
581 3300026035 Ga0207703_10000361 Ga0207703_1000036186 401
582 3300026067 Ga0207678_10003142 Ga0207678_1000314214 401
583 3300026089 Ga0207648_10030882 Ga0207648_100308822 401
584 3300026095 Ga0207676_10024509 Ga0207676_100245095 401
585 3300026095 Ga0207676_10027573 Ga0207676_100275732 401
586 3300026116 Ga0207674_10050247 Ga0207674_100502472 401
587 3300026121 Ga0207683_10021751 Ga0207683_100217514 401
588 3300026121 Ga0207683_10069179 Ga0207683_100691792 401
589 3300026121 Ga0207683_10077671 Ga0207683_100776712 401
590 3300026121 Ga0207683_10127732 Ga0207683_101277322 401
591 3300026121 Ga0207683_10153194 Ga0207683_101531942 401
592 3300026142 Ga0207698_10024216 Ga0207698_100242162 401
593 3300027526 Ga0209968_1001974 Ga0209968_10019742 401
594 3300027543 Ga0209999_1009468 Ga0209999_10094682 401
595 3300027695 Ga0209966_1000039 Ga0209966_100003939 401
596 3300027876 Ga0209974_10021764 Ga0209974_100217642 401
597 3300028794 Ga0307515_10000040 Ga0307515_10000040234 401
598 3300028794 Ga0307515_10000090 Ga0307515_10000090129 401
599 3300028794 Ga0307515_10063613 Ga0307515_100636132 401
600 3300028794 Ga0307515_10179585 Ga0307515_101795851 401
601 3300030522 Ga0307512_10086046 Ga0307512_100860462 401
602 3300030522 Ga0307512_10119946 Ga0307512_101199462 401
603 3300031251 Ga0265327_10012542 Ga0265327_100125423 401
604 3300031616 Ga0307508_10000007 Ga0307508_1000000712 401
605 3300031649 Ga0307514_10019551 Ga0307514_100195512 401
606 3300031730 Ga0307516_10000398 Ga0307516_1000039837 401
607 3300031730 Ga0307516_10012557 Ga0307516_100125577 401
608 3300031731 Ga0307405_10034202 Ga0307405_100342023 401
609 3300039447 Ga0436361_0609661 Ga0436361_0609661_8819_10078 401
610 3300041404 Ga0439436_0000259 Ga0439436_0000259_1442_2698 401
611 3300041405 Ga0439438_018437 Ga0439438_018437_32_1288 401
612 3300041407 Ga0439447_018078 Ga0439447_018078_600_1856 401
613 3300041411 Ga0439466_0001510 Ga0439466_0001510_6128_7384 401
614 3300041443 Ga0451789_0365025 Ga0451789_0365025_308_1564 401
615 3300041459 Ga0451800_0572189 Ga0451800_0572189_198_1454 401
616 3300041999 Ga0439433_0002854 Ga0439433_0002854_1925_3181 401
617 3300042002 Ga0439442_020008 Ga0439442_020008_77_1333 401
618 3300042007 Ga0439449_0000530 Ga0439449_0000530_526_1782 401
619 3300042010 Ga0439452_006298 Ga0439452_006298_299_1555 401
620 3300042010 Ga0439452_006480 Ga0439452_006480_717_1973 401
621 3300042115 Ga0450911_000366 Ga0450911_000366_11645_12901 401
622 3300042121 Ga0450919_000679 Ga0450919_000679_1179_2435 401
623 3300042435 Ga0439434_0003522 Ga0439434_0003522_1652_2908 401
624 3300042531 Ga0450918_000036 Ga0450918_000036_18579_19835 401
625 3300046475 Ga0495639_0016505 Ga0495639_0016505_1203_2459 401
626 3300046512 Ga0495610_0006772 Ga0495610_0006772_1151_2407 401
627 3300046520 Ga0495637_0003132 Ga0495637_0003132_4772_6028 401
628 3300046525 Ga0495663_0011992 Ga0495663_0011992_213_1469 401
629 3300046530 Ga0495654_0015291 Ga0495654_0015291_1444_2700 401
630 3300046537 Ga0495598_0014000 Ga0495598_0014000_81_1337 401
631 3300046539 Ga0495621_0001659 Ga0495621_0001659_1021_2277 401
632 3300046558 Ga0495633_0002787 Ga0495633_0002787_4325_5581 401
633 3300046615 Ga0495656_0000137 Ga0495656_0000137_9999_11255 401
634 3300046615 Ga0495656_0008462 Ga0495656_0008462_754_2043 401
635 3300046660 Ga0495625_0003235 Ga0495625_0003235_9465_10721 401
636 3300046660 Ga0495625_0012515 Ga0495625_0012515_4571_5842 401
637 3300046674 Ga0495588_0022354 Ga0495588_0022354_336_1592 401
638 3300046683 Ga0495658_0140989 Ga0495658_0140989_165_1421 401
639 3300046692 Ga0495671_0009593 Ga0495671_0009593_3686_4942 401
640 3300048090 Ga0495615_0000614 Ga0495615_0000614_637_1893 401
641 3300048905 Ga0496102_0018292 Ga0496102_0018292_934_2190 401
642 3300048906 Ga0496103_0005180 Ga0496103_0005180_3145_4401 401
643 3300048907 Ga0496104_0003649 Ga0496104_0003649_4454_5710 401
644 3300048908 Ga0496105_0003155 Ga0496105_0003155_753_2009 401
645 3300048911 Ga0496108_0035283 Ga0496108_0035283_997_2253 401
646 3300048915 Ga0496112_0108319 Ga0496112_0108319_882_2138 401
647 3300048916 Ga0496113_0014605 Ga0496113_0014605_252_1508 401
648 3300048917 Ga0496114_0036006 Ga0496114_0036006_1697_2953 401
649 3300048924 Ga0496121_0018162 Ga0496121_0018162_4131_5387 401
650 3300048925 Ga0496122_0000063 Ga0496122_0000063_149903_151159 401
651 3300048926 Ga0496123_0000045 Ga0496123_0000045_200328_201584 401
652 3300048927 Ga0496124_0020425 Ga0496124_0020425_4847_6103 401
653 3300048927 Ga0496124_0025363 Ga0496124_0025363_23_1279 401
654 3300048928 Ga0496125_0007863 Ga0496125_0007863_7037_8293 401
655 3300050492 nmdc:mga0yw44_179129_c1 nmdc:mga0yw44_179129_c1_43_1299 401
656 3300050493 nmdc:mga0k408_674_c1 nmdc:mga0k408_674_c1_10146_11402 401
657 3300050494 nmdc:mga06z11_24680_c1 nmdc:mga06z11_24680_c1_1484_2740 401
658 3300050496 nmdc:mga07m45_64432_c1 nmdc:mga07m45_64432_c1_794_2050 401
659 3300053079 Ga0500610_0009084 Ga0500610_0009084_33_1289 401
660 3300053090 Ga0500646_0002996 Ga0500646_0002996_2389_3645 401
661 3300053117 Ga0500593_000422 Ga0500593_000422_14079_15335 401
662 3300053121 Ga0500607_001465 Ga0500607_001465_1937_3193 401
663 3300053131 Ga0500652_000839 Ga0500652_000839_5132_6388 401
664 3300053134 Ga0500658_0018122 Ga0500658_0018122_94_1350 401
665 3300053139 Ga0500568_0016337 Ga0500568_0016337_816_2072 401
666 3300053148 Ga0500590_008920 Ga0500590_008920_2443_3699 401
667 3300053154 Ga0500619_000072 Ga0500619_000072_27734_28990 401
668 3300053156 Ga0500622_0003145 Ga0500622_0003145_5702_6958 401
669 3300053161 Ga0500634_0032937 Ga0500634_0032937_110_1366 401

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02687

FtsX

FtsX-like permease family

258

392

0.89

PF12704

MacB_PCD

MacB-like periplasmic core domain

14

229

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.9049 39 242
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8895 39 242
5udf-assembly1.cif.gz_C structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8839 39 242
5udf-assembly1.cif.gz_B structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8744 39 242
5udf-assembly1.cif.gz_D structure of the n-terminal domain of lipoprotein-releasing system transmembrane protein lole from acinetobacter baumannii 0.8729 39 242
ID Description Score Start End Superfamily
af_P0AG90_2_103_3.30.70.1530 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.7689 209 239 3.30.70.1530
af_Q7LL14_1_93_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6363 206 240 3.30.70.330
af_P36629_411_516_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6338 206 241 3.30.70.330
af_Q9Y3B4_14_93_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6308 206 241 3.30.70.330
af_A0A1D8PGR8_607_716_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.6227 201 241 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A3N5GK49-F1-model_v4 FtsX-like permease family protein 0.8811 266 401 GO:0044874
GO:0098797
AF-A0A3N5GK49-F1-model_v4 FtsX-like permease family protein 0.8695 266 401 GO:0044874
GO:0098797
AF-A0A7X0JU13-F1-model_v4 Lipoprotein-releasing system permease protein 0.8649 1 401 GO:0042953
GO:0044874
GO:0098797
AF-A0A7X0JU13-F1-model_v4 Lipoprotein-releasing system permease protein 0.857 1 401 GO:0042953
GO:0044874
GO:0098797
AF-A0A0B8NV53-F1-model_v4 Lipoprotein releasing system transmembrane protein lolE 0.8555 75 181 GO:0044874
GO:0098797

Feature Viewer

pLDDT pTM Quality
77.49 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map