F473773

General Info

Members Datasets Scaffolds Average Seq Length
666 318 1332 104

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100171580|Ga0075436_1001715802
Length 121
Sequence MAEVTQQQVVDYIKGISVLELSQLVKTLESELGVSAAAAMPVFAGAPGVEEKTEFTVTLTEIGGNKINVIKVVREITALGLKEAKDLVESAPKPIKEGVNKDEANAIKKKFEEVGAKVEIK

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
96 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
99 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
101 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
115 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
116 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
117 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
118 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
119 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
120 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
202 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
203 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
204 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
211 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
212 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
213 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
214 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
215 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
218 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
219 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
224 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
230 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
231 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
232 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
233 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
234 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
235 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
236 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
237 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
238 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
239 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
240 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
241 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
242 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
243 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
246 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
247 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
258 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
259 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
312 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
313 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
314 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
315 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 2.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 0
Rhizoplane 3.15
Rhizosphere 90.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100171580 3300006914 Bacteria 1531
2 JGI24746J21847_1000233 3300001977 Bacteria 7648
3 JGI24033J26618_1005167 3300002155 Bacteria 1431
4 JGI24034J26672_10112326 3300002239 Bacteria 521
5 JGI24751J29686_10012400 3300002459 Bacteria 1758
6 Ga0006777J48905_1123619 3300003308 Bacteria 719
7 Ga0007416J51690_1063111 3300003577 Bacteria 3208
8 Ga0007416J51690_1101573 3300003577 Bacteria 543
9 Ga0058859_10019471 3300004798 Bacteria 1093
10 Ga0058859_11775919 3300004798 Bacteria 829
11 Ga0058860_11906096 3300004801 Bacteria 653
12 Ga0058860_12244637 3300004801 Bacteria 1695
13 Ga0058862_11786879 3300004803 Bacteria 722
14 Ga0065714_10173802 3300005288 Bacteria 992
15 Ga0065704_10476906 3300005289 Bacteria 685
16 Ga0065712_10001933 3300005290 Bacteria 5326
17 Ga0065715_10001671 3300005293 Bacteria 6504
18 Ga0065715_10505047 3300005293 Bacteria 765
19 Ga0065707_10003811 3300005295 Bacteria 4309
20 Ga0065707_10105294 3300005295 Bacteria 2651
21 Ga0070658_11104658 3300005327 Bacteria 690
22 Ga0070676_10015465 3300005328 Bacteria 4210
23 Ga0070683_100765862 3300005329 Bacteria 925
24 Ga0070683_100876216 3300005329 Bacteria 861
25 Ga0070690_100015535 3300005330 Bacteria 4545
26 Ga0070670_100106489 3300005331 Bacteria 2416
27 Ga0070670_100307420 3300005331 Bacteria 1387
28 Ga0070670_101372638 3300005331 Bacteria 648
29 Ga0070677_10003623 3300005333 Bacteria 4989
30 Ga0070677_10017200 3300005333 Bacteria 2585
31 Ga0070677_10241132 3300005333 Bacteria 892
32 Ga0068869_100011339 3300005334 Bacteria 5842
33 Ga0070666_10006773 3300005335 Bacteria 7057
34 Ga0070666_10176944 3300005335 Bacteria 1496
35 Ga0070680_100153870 3300005336 Bacteria 1931
36 Ga0070680_100695760 3300005336 Bacteria 875
37 Ga0070680_100950518 3300005336 Bacteria 742
38 Ga0070682_100420608 3300005337 Bacteria 1015
39 Ga0070682_100672112 3300005337 Bacteria 827
40 Ga0070682_101137338 3300005337 Bacteria 655
41 Ga0068868_100042747 3300005338 Bacteria 3538
42 Ga0068868_100220847 3300005338 Bacteria 1586
43 Ga0070660_101016681 3300005339 Bacteria 700
44 Ga0070687_100123897 3300005343 Bacteria 1482
45 Ga0070661_100143560 3300005344 Bacteria 1800
46 Ga0070661_100251624 3300005344 Bacteria 1363
47 Ga0070668_100060390 3300005347 Bacteria 2936
48 Ga0070668_100298477 3300005347 Bacteria 1350
49 Ga0070668_100412043 3300005347 Bacteria 1156
50 Ga0070669_100018135 3300005353 Bacteria 5028
51 Ga0070669_100065295 3300005353 Bacteria 2681
52 Ga0070669_100199010 3300005353 Bacteria 1575
53 Ga0070669_100241351 3300005353 Bacteria 1436
54 Ga0070675_100069790 3300005354 Bacteria 2911
55 Ga0070675_100073969 3300005354 Bacteria 2829
56 Ga0070675_100318563 3300005354 Bacteria 1373
57 Ga0070675_100435112 3300005354 Bacteria 1175
58 Ga0070675_100458080 3300005354 Bacteria 1144
59 Ga0070675_100592822 3300005354 Bacteria 1005
60 Ga0070674_100059423 3300005356 Bacteria 2661
61 Ga0070674_100063588 3300005356 Bacteria 2583
62 Ga0070674_100529688 3300005356 Bacteria 985
63 Ga0070673_100031948 3300005364 Bacteria 3957
64 Ga0070673_100500937 3300005364 Bacteria 1098
65 Ga0070673_100502769 3300005364 Bacteria 1096
66 Ga0070688_100058832 3300005365 Bacteria 2421
67 Ga0070688_100219723 3300005365 Bacteria 1338
68 Ga0070659_100059312 3300005366 Bacteria 3022
69 Ga0070659_100139468 3300005366 Bacteria 1973
70 Ga0070659_100304541 3300005366 Bacteria 1329
71 Ga0070659_100500519 3300005366 Bacteria 1036
72 Ga0070667_100030091 3300005367 Bacteria 4528
73 Ga0070667_100195559 3300005367 Bacteria 1793
74 Ga0070667_101064727 3300005367 Bacteria 755
75 Ga0070703_10410551 3300005406 Bacteria 592
76 Ga0070713_100864289 3300005436 Bacteria 869
77 Ga0070710_10161269 3300005437 Bacteria 1391
78 Ga0070701_10046203 3300005438 Bacteria 2237
79 Ga0070701_10349941 3300005438 Bacteria 923
80 Ga0070705_100770483 3300005440 Bacteria 763
81 Ga0070700_100210188 3300005441 Bacteria 1372
82 Ga0070700_100899322 3300005441 Bacteria 721
83 Ga0070694_100196914 3300005444 Bacteria 1500
84 Ga0070708_100037389 3300005445 Bacteria 4234
85 Ga0070663_100086667 3300005455 Bacteria 2313
86 Ga0070663_100280147 3300005455 Bacteria 1328
87 Ga0070663_100623700 3300005455 Bacteria 909
88 Ga0070678_100073380 3300005456 Bacteria 2568
89 Ga0070678_100157250 3300005456 Bacteria 1837
90 Ga0070678_100237453 3300005456 Bacteria 1522
91 Ga0070662_100021077 3300005457 Bacteria 4446
92 Ga0070662_100289011 3300005457 Bacteria 1329
93 Ga0070681_10363381 3300005458 Bacteria 1358
94 Ga0070681_10523089 3300005458 Bacteria 1100
95 Ga0068867_100457833 3300005459 Bacteria 1088
96 Ga0068867_101802259 3300005459 Bacteria 575
97 Ga0070685_10020159 3300005466 Bacteria 3607
98 Ga0070707_100078245 3300005468 Bacteria 3190
99 Ga0070707_100453081 3300005468 Bacteria 1244
100 Ga0070707_100763141 3300005468 Bacteria 931
101 Ga0070698_100179241 3300005471 Bacteria 2057
102 Ga0070699_100358954 3300005518 Bacteria 1313
103 Ga0070699_100844360 3300005518 Bacteria 838
104 Ga0070684_100000005 3300005535 Bacteria 230164
105 Ga0070684_100151829 3300005535 Bacteria 2098
106 Ga0070684_100227375 3300005535 Bacteria 1703
107 Ga0070684_101186939 3300005535 Bacteria 718
108 Ga0070672_100069103 3300005543 Bacteria 2803
109 Ga0070686_100013157 3300005544 Bacteria 4727
110 Ga0070686_100356719 3300005544 Bacteria 1100
111 Ga0070695_100492584 3300005545 Bacteria 946
112 Ga0070693_100025995 3300005547 Bacteria 3156
113 Ga0070665_100026504 3300005548 Bacteria 5836
114 Ga0070665_100191886 3300005548 Bacteria 2044
115 Ga0070704_100174582 3300005549 Bacteria 1713
116 Ga0070704_100587241 3300005549 Bacteria 977
117 Ga0068855_100341200 3300005563 Bacteria 1652
118 Ga0068855_100542544 3300005563 Bacteria 1260
119 Ga0070664_100015545 3300005564 Bacteria 6227
120 Ga0070664_100312850 3300005564 Bacteria 1421
121 Ga0068857_100288113 3300005577 Bacteria 1512
122 Ga0068857_100342352 3300005577 Bacteria 1383
123 Ga0068856_102417319 3300005614 Bacteria 533
124 Ga0070702_100046299 3300005615 Bacteria 2465
125 Ga0070702_100513235 3300005615 Bacteria 882
126 Ga0070702_101636328 3300005615 Bacteria 534
127 Ga0068852_100100481 3300005616 Bacteria 2610
128 Ga0068859_100030987 3300005617 Bacteria 5367
129 Ga0068864_100041795 3300005618 Bacteria 3921
130 Ga0068864_100048881 3300005618 Bacteria 3637
131 Ga0068864_100122739 3300005618 Bacteria 2325
132 Ga0068866_10067220 3300005718 Bacteria 1881
133 Ga0068861_100082031 3300005719 Bacteria 2526
134 Ga0068861_100193155 3300005719 Bacteria 1703
135 Ga0068861_100391671 3300005719 Bacteria 1231
136 Ga0068861_100652175 3300005719 Bacteria 972
137 Ga0068851_10642413 3300005834 Bacteria 649
138 Ga0068851_10848094 3300005834 Bacteria 570
139 Ga0068870_10002825 3300005840 Bacteria 7306
140 Ga0068870_10018787 3300005840 Bacteria 3343
141 Ga0068870_10143247 3300005840 Bacteria 1400
142 Ga0068870_10345531 3300005840 Bacteria 953
143 Ga0068863_100002641 3300005841 Bacteria 17739
144 Ga0068863_100004974 3300005841 Bacteria 13101
145 Ga0068863_100021102 3300005841 Bacteria 6221
146 Ga0068863_100306660 3300005841 Bacteria 1540
147 Ga0068858_100135030 3300005842 Bacteria 2315
148 Ga0068858_100345287 3300005842 Bacteria 1425
149 Ga0068858_101043585 3300005842 Bacteria 802
150 Ga0068860_100265039 3300005843 Bacteria 1675
151 Ga0068862_100015325 3300005844 Bacteria 6366
152 Ga0068862_100241833 3300005844 Bacteria 1641
153 Ga0068862_100524012 3300005844 Bacteria 1128
154 Ga0081455_10052243 3300005937 Bacteria 3500
155 Ga0081455_10178427 3300005937 Bacteria 1611
156 Ga0081539_10075046 3300005985 Bacteria 1798
157 Ga0081539_10096990 3300005985 Bacteria 1511
158 Ga0070717_10330460 3300006028 Bacteria 1360
159 Ga0070717_11044374 3300006028 Bacteria 744
160 Ga0075365_10056720 3300006038 Bacteria 2604
161 Ga0075365_10134398 3300006038 Bacteria 1713
162 Ga0075368_10078723 3300006042 Bacteria 1339
163 Ga0075363_100196465 3300006048 Bacteria 1152
164 Ga0075364_10020198 3300006051 Bacteria 4189
165 Ga0075364_10026992 3300006051 Bacteria 3666
166 Ga0075364_10234846 3300006051 Bacteria 1245
167 Ga0075364_10238715 3300006051 Bacteria 1234
168 Ga0075364_10365703 3300006051 Bacteria 983
169 Ga0070715_10292104 3300006163 Bacteria 869
170 Ga0070716_100225123 3300006173 Bacteria 1262
171 Ga0075362_10012980 3300006177 Bacteria 3323
172 Ga0075367_10027610 3300006178 Bacteria 3231
173 Ga0097621_100012152 3300006237 Bacteria 6372
174 Ga0097621_100133934 3300006237 Bacteria 2112
175 Ga0075370_10003319 3300006353 Bacteria 7644
176 Ga0075370_10213183 3300006353 Bacteria 1140
177 Ga0068871_100016384 3300006358 Bacteria 5581
178 Ga0068871_100079899 3300006358 Bacteria 2707
179 Ga0068871_100853367 3300006358 Bacteria 842
180 Ga0068871_100995475 3300006358 Bacteria 780
181 Ga0075428_100006247 3300006844 Bacteria 13244
182 Ga0075428_100073818 3300006844 Bacteria 3726
183 Ga0075428_100405285 3300006844 Bacteria 1461
184 Ga0075428_100706973 3300006844 Bacteria 1073
185 Ga0075428_101192791 3300006844 Bacteria 802
186 Ga0075430_100037983 3300006846 Bacteria 4081
187 Ga0075430_100073487 3300006846 Bacteria 2867
188 Ga0075430_100123559 3300006846 Bacteria 2157
189 Ga0075430_100165088 3300006846 Bacteria 1843
190 Ga0075430_100473617 3300006846 Bacteria 1033
191 Ga0075431_100038760 3300006847 Bacteria 4909
192 Ga0075431_100102783 3300006847 Bacteria 2949
193 Ga0075431_100441293 3300006847 Bacteria 1298
194 Ga0075431_100735419 3300006847 Bacteria 963
195 Ga0075433_10137497 3300006852 Bacteria 2172
196 Ga0075433_10384165 3300006852 Bacteria 1239
197 Ga0075434_100075941 3300006871 Bacteria 3355
198 Ga0075434_100207816 3300006871 Bacteria 1978
199 Ga0075434_100444078 3300006871 Bacteria 1318
200 Ga0075434_100771965 3300006871 Bacteria 978
201 Ga0075429_100032192 3300006880 Bacteria 4557
202 Ga0075429_100196209 3300006880 Bacteria 1768
203 Ga0075429_100296134 3300006880 Bacteria 1416
204 Ga0075429_101175681 3300006880 Bacteria 670
205 Ga0068865_100101758 3300006881 Bacteria 2104
206 Ga0068865_100199213 3300006881 Bacteria 1554
207 Ga0068865_100233430 3300006881 Bacteria 1444
208 Ga0068865_100303016 3300006881 Bacteria 1280
209 Ga0075436_100897303 3300006914 Bacteria 663
210 Ga0097620_100030988 3300006931 Bacteria 5367
211 Ga0075435_100111882 3300007076 Bacteria 2271
212 Ga0075435_100209420 3300007076 Bacteria 1653
213 Ga0075435_100541696 3300007076 Bacteria 1007
214 Ga0099795_10507784 3300007788 Bacteria 563
215 Ga0105240_11842780 3300009093 Bacteria 630
216 Ga0111539_10006125 3300009094 Bacteria 15529
217 Ga0111539_10086327 3300009094 Bacteria 3688
218 Ga0111539_10442312 3300009094 Bacteria 1514
219 Ga0111539_10655632 3300009094 Bacteria 1222
220 Ga0111539_10983185 3300009094 Bacteria 981
221 Ga0105245_10873496 3300009098 Bacteria 940
222 Ga0105247_10151099 3300009101 Bacteria 1530
223 Ga0105247_10154422 3300009101 Bacteria 1515
224 Ga0114129_10000509 3300009147 Bacteria 47512
225 Ga0114129_10218741 3300009147 Bacteria 2571
226 Ga0114129_10423270 3300009147 Bacteria 1751
227 Ga0114129_10520539 3300009147 Bacteria 1551
228 Ga0114129_11024530 3300009147 Bacteria 1038
229 Ga0105243_10599455 3300009148 Bacteria 1060
230 Ga0105248_10058749 3300009177 Bacteria 4319
231 Ga0105248_10091578 3300009177 Bacteria 3424
232 Ga0105248_10115515 3300009177 Bacteria 3027
233 Ga0105248_10241022 3300009177 Bacteria 2036
234 Ga0105248_10526826 3300009177 Bacteria 1333
235 Ga0105237_10028737 3300009545 Bacteria 5659
236 Ga0105237_10362882 3300009545 Bacteria 1453
237 Ga0105238_10914134 3300009551 Bacteria 896
238 Ga0105249_10045243 3300009553 Bacteria 4003
239 Ga0105249_10462265 3300009553 Bacteria 1309
240 Ga0105249_12848987 3300009553 Bacteria 555
241 Ga0105249_12874722 3300009553 Bacteria 553
242 Ga0105239_10918573 3300010375 Bacteria 1005
243 Ga0105246_10299022 3300011119 Bacteria 1298
244 Ga0157344_1003056 3300012476 Bacteria 924
245 Ga0157325_1009757 3300012485 Bacteria 692
246 Ga0157321_1014566 3300012487 Bacteria 654
247 Ga0157343_1018638 3300012488 Bacteria 609
248 Ga0157315_1048829 3300012508 Bacteria 562
249 Ga0157327_1015761 3300012512 Bacteria 790
250 Ga0157326_1006712 3300012513 Bacteria 1234
251 Ga0157373_10352549 3300013100 Bacteria 1050
252 Ga0157373_10999713 3300013100 Bacteria 624
253 Ga0157370_10289392 3300013104 Bacteria 1513
254 Ga0157370_10378050 3300013104 Bacteria 1305
255 Ga0157374_10216423 3300013296 Bacteria 1879
256 Ga0157374_10493812 3300013296 Bacteria 1228
257 Ga0157378_10111251 3300013297 Bacteria 2511
258 Ga0157378_10211598 3300013297 Bacteria 1839
259 Ga0157378_10417976 3300013297 Bacteria 1325
260 Ga0157378_10899211 3300013297 Bacteria 916
261 Ga0157378_12062031 3300013297 Bacteria 621
262 Ga0163162_10050913 3300013306 Bacteria 4154
263 Ga0163162_12470200 3300013306 Bacteria 597
264 Ga0157372_10266156 3300013307 Bacteria 1991
265 Ga0157372_10403697 3300013307 Bacteria 1592
266 Ga0157372_10576005 3300013307 Bacteria 1312
267 Ga0157372_12720670 3300013307 Bacteria 567
268 Ga0157375_10024596 3300013308 Bacteria 5577
269 Ga0157375_10224479 3300013308 Bacteria 2037
270 Ga0157375_10239122 3300013308 Bacteria 1975
271 Ga0157375_12255532 3300013308 Bacteria 649
272 Ga0163163_10017278 3300014325 Bacteria 6726
273 Ga0163163_10269853 3300014325 Bacteria 1753
274 Ga0157380_10050583 3300014326 Bacteria 3283
275 Ga0157380_10528649 3300014326 Bacteria 1152
276 Ga0157380_10535944 3300014326 Bacteria 1145
277 Ga0157380_11374864 3300014326 Bacteria 756
278 Ga0157377_10039480 3300014745 Bacteria 2611
279 Ga0157377_10071363 3300014745 Bacteria 2008
280 Ga0157377_10174126 3300014745 Bacteria 1348
281 Ga0157377_10442950 3300014745 Bacteria 895
282 Ga0157377_11285779 3300014745 Bacteria 571
283 Ga0157379_10008242 3300014968 Bacteria 9051
284 Ga0157379_10618670 3300014968 Bacteria 1012
285 Ga0157379_10793856 3300014968 Bacteria 893
286 Ga0157376_10052729 3300014969 Bacteria 3383
287 Ga0157376_10298338 3300014969 Bacteria 1524
288 Ga0157376_10333102 3300014969 Bacteria 1447
289 Ga0163161_10130942 3300017792 Bacteria 1892
290 Ga0163161_10251643 3300017792 Bacteria 1377
291 Ga0163161_10528773 3300017792 Bacteria 964
292 Ga0206354_10578228 3300020081 Bacteria 694
293 Ga0206354_11236891 3300020081 Bacteria 932
294 Ga0206353_11000470 3300020082 Bacteria 750
295 Ga0206353_11454380 3300020082 Bacteria 538
296 Ga0213876_10352014 3300021384 Bacteria 783
297 Ga0213876_10441742 3300021384 Bacteria 692
298 Ga0207673_1044946 3300025290 Bacteria 622
299 Ga0207697_10025064 3300025315 Bacteria 2439
300 Ga0207697_10247629 3300025315 Bacteria 788
301 Ga0207656_10627763 3300025321 Bacteria 549
302 Ga0207682_10003744 3300025893 Bacteria 6539
303 Ga0207682_10160910 3300025893 Bacteria 1017
304 Ga0207682_10200664 3300025893 Bacteria 917
305 Ga0207642_10017409 3300025899 Bacteria 2733
306 Ga0207710_10117877 3300025900 Bacteria 1265
307 Ga0207688_10004034 3300025901 Bacteria 7996
308 Ga0207688_10304090 3300025901 Bacteria 976
309 Ga0207680_10030976 3300025903 Bacteria 3025
310 Ga0207680_10125118 3300025903 Bacteria 1687
311 Ga0207645_10020173 3300025907 Bacteria 4364
312 Ga0207643_10014738 3300025908 Bacteria 4251
313 Ga0207643_10039470 3300025908 Bacteria 2656
314 Ga0207684_10922582 3300025910 Bacteria 733
315 Ga0207707_10289744 3300025912 Bacteria 1417
316 Ga0207707_10467598 3300025912 Bacteria 1078
317 Ga0207695_10005058 3300025913 Bacteria 17685
318 Ga0207671_10107810 3300025914 Bacteria 2116
319 Ga0207671_11373387 3300025914 Bacteria 548
320 Ga0207663_10303034 3300025916 Bacteria 1194
321 Ga0207660_10121427 3300025917 Bacteria 1979
322 Ga0207662_10023780 3300025918 Bacteria 3522
323 Ga0207662_10092020 3300025918 Bacteria 1866
324 Ga0207662_10312280 3300025918 Bacteria 1047
325 Ga0207662_10427638 3300025918 Bacteria 902
326 Ga0207657_10406346 3300025919 Bacteria 1071
327 Ga0207657_10462360 3300025919 Bacteria 995
328 Ga0207649_10041544 3300025920 Bacteria 2799
329 Ga0207649_10060211 3300025920 Bacteria 2385
330 Ga0207681_10007716 3300025923 Bacteria 6588
331 Ga0207681_10021069 3300025923 Bacteria 4138
332 Ga0207681_10098285 3300025923 Bacteria 2105
333 Ga0207681_11009881 3300025923 Bacteria 698
334 Ga0207681_11804193 3300025923 Bacteria 510
335 Ga0207650_10092421 3300025925 Bacteria 2314
336 Ga0207650_10259492 3300025925 Bacteria 1409
337 Ga0207650_11224906 3300025925 Bacteria 639
338 Ga0207650_11398222 3300025925 Bacteria 595
339 Ga0207659_10016029 3300025926 Bacteria 4869
340 Ga0207659_10022090 3300025926 Bacteria 4233
341 Ga0207659_10045104 3300025926 Bacteria 3105
342 Ga0207659_10864579 3300025926 Bacteria 777
343 Ga0207687_10248681 3300025927 Bacteria 1412
344 Ga0207700_11476553 3300025928 Bacteria 603
345 Ga0207644_10132711 3300025931 Bacteria 1909
346 Ga0207690_10062174 3300025932 Bacteria 2541
347 Ga0207690_10235240 3300025932 Bacteria 1408
348 Ga0207690_10437906 3300025932 Bacteria 1048
349 Ga0207690_11680406 3300025932 Bacteria 530
350 Ga0207706_10010042 3300025933 Bacteria 8675
351 Ga0207706_10036777 3300025933 Bacteria 4348
352 Ga0207706_10215233 3300025933 Bacteria 1683
353 Ga0207706_10484684 3300025933 Bacteria 1068
354 Ga0207709_11815270 3300025935 Bacteria 507
355 Ga0207670_10213994 3300025936 Bacteria 1471
356 Ga0207669_10093698 3300025937 Bacteria 1963
357 Ga0207669_10529415 3300025937 Bacteria 947
358 Ga0207669_11233456 3300025937 Bacteria 634
359 Ga0207704_10356782 3300025938 Bacteria 1140
360 Ga0207704_10381085 3300025938 Bacteria 1107
361 Ga0207691_10026550 3300025940 Bacteria 5433
362 Ga0207691_10032466 3300025940 Bacteria 4866
363 Ga0207691_10075386 3300025940 Bacteria 3042
364 Ga0207691_10427627 3300025940 Bacteria 1128
365 Ga0207711_10214713 3300025941 Bacteria 1758
366 Ga0207711_10228563 3300025941 Bacteria 1703
367 Ga0207711_10302995 3300025941 Bacteria 1474
368 Ga0207689_10009264 3300025942 Bacteria 8513
369 Ga0207689_10266290 3300025942 Bacteria 1418
370 Ga0207661_10000066 3300025944 Bacteria 73856
371 Ga0207661_10597067 3300025944 Bacteria 1013
372 Ga0207661_10711091 3300025944 Bacteria 924
373 Ga0207679_10008656 3300025945 Bacteria 6488
374 Ga0207679_10248210 3300025945 Bacteria 1512
375 Ga0207679_10452185 3300025945 Bacteria 1139
376 Ga0207679_11921989 3300025945 Bacteria 539
377 Ga0207667_10046100 3300025949 Bacteria 4616
378 Ga0207667_11377784 3300025949 Bacteria 679
379 Ga0207651_10113005 3300025960 Bacteria 2042
380 Ga0207651_10157714 3300025960 Bacteria 1775
381 Ga0207712_10009646 3300025961 Bacteria 6117
382 Ga0207712_10268970 3300025961 Bacteria 1385
383 Ga0207712_10309079 3300025961 Bacteria 1300
384 Ga0207668_10376039 3300025972 Bacteria 1194
385 Ga0207668_10784468 3300025972 Bacteria 842
386 Ga0207640_11416475 3300025981 Bacteria 623
387 Ga0207658_10057390 3300025986 Bacteria 2893
388 Ga0207677_10075120 3300026023 Bacteria 2401
389 Ga0207677_10130122 3300026023 Bacteria 1909
390 Ga0207677_10173421 3300026023 Bacteria 1689
391 Ga0207703_10528011 3300026035 Bacteria 1111
392 Ga0207639_10916606 3300026041 Bacteria 819
393 Ga0207639_12175242 3300026041 Bacteria 516
394 Ga0207678_10097055 3300026067 Bacteria 2519
395 Ga0207678_10100642 3300026067 Bacteria 2469
396 Ga0207678_10346728 3300026067 Bacteria 1280
397 Ga0207708_10098605 3300026075 Bacteria 2259
398 Ga0207708_10452344 3300026075 Bacteria 1070
399 Ga0207708_10455915 3300026075 Bacteria 1066
400 Ga0207702_11566826 3300026078 Bacteria 652
401 Ga0207641_10006730 3300026088 Bacteria 9631
402 Ga0207641_10288030 3300026088 Bacteria 1547
403 Ga0207648_10451431 3300026089 Bacteria 1171
404 Ga0207648_10710475 3300026089 Bacteria 932
405 Ga0207676_10066148 3300026095 Bacteria 2881
406 Ga0207676_10342108 3300026095 Bacteria 1380
407 Ga0207674_10031464 3300026116 Bacteria 5575
408 Ga0207674_10217244 3300026116 Bacteria 1860
409 Ga0207674_10957396 3300026116 Bacteria 825
410 Ga0207675_100134337 3300026118 Bacteria 2346
411 Ga0207675_100158686 3300026118 Bacteria 2156
412 Ga0207675_100242080 3300026118 Bacteria 1743
413 Ga0207675_100417863 3300026118 Bacteria 1324
414 Ga0207675_100534130 3300026118 Bacteria 1170
415 Ga0207683_10310362 3300026121 Bacteria 1444
416 Ga0207683_10344395 3300026121 Bacteria 1367
417 Ga0207683_10371427 3300026121 Bacteria 1314
418 Ga0207698_10060317 3300026142 Bacteria 2950
419 Ga0207698_10533726 3300026142 Bacteria 1147
420 Ga0207698_11106440 3300026142 Bacteria 805
421 Ga0209983_1057244 3300027665 Bacteria 858
422 Ga0209983_1064158 3300027665 Bacteria 814
423 Ga0209971_1007890 3300027682 Bacteria 2525
424 Ga0209813_10018512 3300027866 Bacteria 1926
425 Ga0207428_10004000 3300027907 Bacteria 14150
426 Ga0207428_10032350 3300027907 Bacteria 4302
427 Ga0207428_10043855 3300027907 Bacteria 3610
428 Ga0207428_10136531 3300027907 Bacteria 1875
429 Ga0207428_10216892 3300027907 Bacteria 1436
430 Ga0268266_10065213 3300028379 Bacteria 3148
431 Ga0268265_10104877 3300028380 Bacteria 2292
432 Ga0268265_10264276 3300028380 Bacteria 1531
433 Ga0268265_12335428 3300028380 Bacteria 541
434 Ga0268264_10158150 3300028381 Bacteria 2038
435 Ga0268264_10802227 3300028381 Bacteria 940
436 Ga0268264_12079134 3300028381 Bacteria 577
437 Ga0265330_10028687 3300031235 Bacteria 2507
438 Ga0307408_101949367 3300031548 Bacteria 564
439 Ga0265313_10078176 3300031595 Bacteria 1509
440 Ga0265342_10689768 3300031712 Bacteria 511
441 Ga0307413_11666055 3300031824 Bacteria 568
442 Ga0307410_10809899 3300031852 Bacteria 797
443 Ga0307406_10776161 3300031901 Bacteria 807
444 Ga0307412_11460987 3300031911 Bacteria 620
445 Ga0307409_100215295 3300031995 Bacteria 1730
446 Ga0307409_100307922 3300031995 Bacteria 1477
447 Ga0307409_100915181 3300031995 Bacteria 891
448 Ga0307416_100060968 3300032002 Bacteria 3075
449 Ga0307416_100304102 3300032002 Bacteria 1587
450 Ga0307416_100409761 3300032002 Bacteria 1396
451 Ga0307416_102224273 3300032002 Bacteria 649
452 Ga0307416_102777951 3300032002 Bacteria 585
453 Ga0307416_103341253 3300032002 Bacteria 537
454 Ga0307414_10887822 3300032004 Bacteria 817
455 Ga0307411_10536128 3300032005 Bacteria 996
456 Ga0373948_0062923 3300034817 Bacteria 818
457 Ga0373958_0093219 3300034819 Bacteria 697
458 Ga0373958_0139944 3300034819 Bacteria 598
459 Ga0373938_0024985 3300034957 Bacteria 1240
460 Ga0373949_0033107 3300035090 Bacteria 1240
461 Ga0373949_0062584 3300035090 Bacteria 960
462 Ga0373949_0276235 3300035090 Bacteria 527
463 Ga0373951_0093339 3300035091 Bacteria 792
464 Ga0373952_0010237 3300035092 Bacteria 1809
465 Ga0373932_0004171 3300035112 Bacteria 3435
466 Ga0373932_0060186 3300035112 Bacteria 1152
467 Ga0373939_0028793 3300035114 Bacteria 1584
468 Ga0373939_0145600 3300035114 Bacteria 858
469 Ga0373941_0041207 3300035115 Bacteria 1428
470 Ga0373956_0494292 3300035119 Bacteria 584
471 Ga0373946_0629376 3300035171 Bacteria 558
472 Ga0373955_0330740 3300035172 Bacteria 921
473 Ga0373961_0037722 3300035241 Bacteria 1382
474 Ga0373962_0029609 3300035242 Bacteria 1493
475 Ga0373931_0177612 3300035691 Bacteria 1259
476 Ga0373931_1155038 3300035691 Bacteria 529
477 Ga0373937_0452562 3300036401 Bacteria 1219
478 Ga0373937_0592203 3300036401 Bacteria 1053
479 Ga0242420_040590 3300038996 Bacteria 888
480 Ga0242420_064823 3300038996 Bacteria 734
481 Ga0436365_1495932 3300039437 Bacteria 1287
482 Ga0436365_1905291 3300039437 Bacteria 620
483 Ga0436363_0000938 3300039450 Bacteria 670
484 Ga0436363_0635795 3300039450 Bacteria 820
485 Ga0451789_0922011 3300041443 Bacteria 1426
486 Ga0451802_1438812 3300041460 Bacteria 832
487 Ga0451837_0032524 3300041494 Bacteria 980
488 Ga0439450_017840 3300042008 Bacteria 1485
489 Ga0439457_119048 3300042014 Bacteria 623
490 Ga0450913_029300 3300042117 Bacteria 538
491 Ga0450923_039302 3300042125 Bacteria 990
492 Ga0439446_0060606 3300042156 Bacteria 1143
493 Ga0450908_014072 3300042184 Bacteria 1441
494 Ga0439435_0226863 3300042436 Bacteria 623
495 Ga0439464_0044240 3300042439 Bacteria 1275
496 Ga0439464_0054163 3300042439 Bacteria 1165
497 Ga0450918_015273 3300042531 Bacteria 1335
498 Ga0466963_0011480 3300044694 Bacteria 5395
499 Ga0466963_0321594 3300044694 Bacteria 1089
500 Ga0466963_0720272 3300044694 Bacteria 704
501 Ga0453684_0532977 3300044712 Bacteria 1296
502 Ga0453684_1241675 3300044712 Bacteria 780
503 Ga0466957_0290090 3300044842 Bacteria 1097
504 Ga0451576_0809224 3300045051 Bacteria 984
505 Ga0451576_1390070 3300045051 Bacteria 731
506 Ga0451576_2228305 3300045051 Bacteria 562
507 Ga0466967_0189555 3300045976 Bacteria 1943
508 Ga0466967_0874181 3300045976 Bacteria 894
509 Ga0466967_1344030 3300045976 Bacteria 712
510 Ga0495603_0545395 3300046455 Bacteria 664
511 Ga0495580_0126095 3300046472 Bacteria 1777
512 Ga0495580_0203345 3300046472 Bacteria 1364
513 Ga0495580_0608282 3300046472 Bacteria 722
514 Ga0495607_0332242 3300046501 Bacteria 706
515 Ga0495628_0684821 3300046516 Bacteria 725
516 Ga0495621_0103593 3300046539 Bacteria 1085
517 Ga0495633_0038251 3300046558 Bacteria 2293
518 Ga0495656_0158161 3300046615 Bacteria 1099
519 Ga0495635_0510639 3300046663 Bacteria 791
520 Ga0495599_0173553 3300046678 Bacteria 1330
521 Ga0495671_0147927 3300046692 Bacteria 1144
522 Ga0495681_0351625 3300047470 Bacteria 560
523 Ga0496101_0340361 3300048904 Bacteria 1178
524 Ga0496101_1075604 3300048904 Bacteria 632
525 Ga0496102_0567258 3300048905 Bacteria 1058
526 Ga0496104_0095500 3300048907 Bacteria 2844
527 Ga0496104_0422773 3300048907 Bacteria 1245
528 Ga0496105_0698329 3300048908 Bacteria 779
529 Ga0496106_0177937 3300048909 Bacteria 1688
530 Ga0496108_0075002 3300048911 Bacteria 2857
531 Ga0496108_0686800 3300048911 Bacteria 888
532 Ga0496109_0020569 3300048912 Bacteria 5829
533 Ga0496109_0182351 3300048912 Bacteria 1972
534 Ga0496110_0114980 3300048913 Bacteria 2422
535 Ga0496110_0268846 3300048913 Bacteria 1552
536 Ga0496110_0898034 3300048913 Bacteria 792
537 Ga0496112_0013647 3300048915 Bacteria 7506
538 Ga0496112_0074263 3300048915 Bacteria 3362
539 Ga0496112_0383849 3300048915 Bacteria 1346
540 Ga0496112_0402070 3300048915 Bacteria 1309
541 Ga0496113_0603381 3300048916 Bacteria 879
542 Ga0501316_010529 3300049532 Bacteria 1053
543 Ga0501033_0437752 3300049570 Bacteria 909
544 Ga0501036_0032096 3300049572 Bacteria 4437
545 Ga0501038_0206105 3300049574 Bacteria 1576
546 Ga0501038_0640084 3300049574 Bacteria 801
547 Ga0501039_0035361 3300049575 Bacteria 3855
548 Ga0501040_0013689 3300049576 Bacteria 5335
549 Ga0501040_0024036 3300049576 Bacteria 4089
550 Ga0501040_0755144 3300049576 Bacteria 704
551 Ga0501041_0051260 3300049577 Bacteria 2515
552 Ga0501041_0095363 3300049577 Bacteria 1838
553 Ga0501041_0451874 3300049577 Bacteria 816
554 Ga0501042_0077986 3300049578 Bacteria 2372
555 Ga0501042_0488044 3300049578 Bacteria 894
556 Ga0501042_0606776 3300049578 Bacteria 796
557 Ga0501043_0128567 3300049579 Bacteria 1986
558 Ga0501043_0414404 3300049579 Bacteria 1016
559 Ga0501043_0926375 3300049579 Bacteria 624
560 Ga0501046_0549883 3300049580 Bacteria 823
561 Ga0501048_0016036 3300049582 Bacteria 5525
562 Ga0501048_0643112 3300049582 Bacteria 761
563 Ga0501048_0905918 3300049582 Bacteria 634
564 Ga0501067_0296184 3300049583 Bacteria 901
565 Ga0501068_0157699 3300049584 Bacteria 1429
566 Ga0501068_0896606 3300049584 Bacteria 583
567 Ga0501071_0018416 3300049587 Bacteria 4834
568 Ga0501071_0093009 3300049587 Bacteria 2217
569 Ga0501071_1182187 3300049587 Bacteria 591
570 Ga0501072_0066972 3300049588 Bacteria 2833
571 Ga0501072_0223944 3300049588 Bacteria 1499
572 Ga0501072_0631113 3300049588 Bacteria 844
573 Ga0501073_0289144 3300049589 Bacteria 1131
574 Ga0501074_0505640 3300049590 Bacteria 856
575 Ga0501074_0660963 3300049590 Bacteria 738
576 Ga0501075_0001529 3300049591 Bacteria 15085
577 Ga0501075_0195322 3300049591 Bacteria 1543
578 Ga0501075_0938214 3300049591 Bacteria 658
579 Ga0501076_0002067 3300049592 Bacteria 13745
580 Ga0501076_0099686 3300049592 Bacteria 2340
581 Ga0501076_1555076 3300049592 Bacteria 543
582 Ga0501077_0050775 3300049593 Bacteria 2636
583 Ga0501077_0648883 3300049593 Bacteria 678
584 Ga0501079_0046902 3300049741 Bacteria 3334
585 Ga0501079_0253189 3300049741 Bacteria 1376
586 Ga0501080_0350257 3300049742 Bacteria 1334
587 Ga0501080_0382180 3300049742 Bacteria 1269
588 Ga0501080_0885174 3300049742 Bacteria 779
589 Ga0501080_1274567 3300049742 Bacteria 630
590 Ga0501081_0061259 3300049743 Bacteria 2609
591 Ga0501081_0262251 3300049743 Bacteria 1263
592 Ga0501081_0368947 3300049743 Bacteria 1060
593 Ga0501081_0485077 3300049743 Bacteria 920
594 Ga0501081_1312744 3300049743 Bacteria 549
595 Ga0501083_0337302 3300049744 Bacteria 980
596 Ga0501035_0284427 3300049822 Bacteria 1397
597 Ga0501045_0008126 3300049824 Bacteria 7308
598 nmdc:mga03683_795_c1 3300050489 Bacteria 9025
599 nmdc:mga03n38_68435_c1 3300050490 Bacteria 1637
600 nmdc:mga00v17_511815_c1 3300050491 Bacteria 778
601 nmdc:mga00v17_6511_c1 3300050491 Bacteria 6200
602 nmdc:mga00v17_7196_c1 3300050491 Bacteria 5930
603 nmdc:mga00v17_7353_c1 3300050491 Bacteria 5871
604 nmdc:mga0yw44_253465_c1 3300050492 Bacteria 1172
605 nmdc:mga0yw44_61017_c1 3300050492 Bacteria 2312
606 nmdc:mga0k408_213715_c2 3300050493 Bacteria 578
607 nmdc:mga0k408_29262_c1 3300050493 Bacteria 3135
608 nmdc:mga0k408_333389_c1 3300050493 Bacteria 905
609 nmdc:mga0k408_787048_c1 3300050493 Bacteria 555
610 nmdc:mga06z11_134938_c1 3300050494 Bacteria 1390
611 nmdc:mga06z11_13867_c1 3300050494 Bacteria 3553
612 nmdc:mga06z11_288996_c1 3300050494 Bacteria 972
613 nmdc:mga07m45_131885_c1 3300050496 Bacteria 1446
614 nmdc:mga07m45_583_c1 3300050496 Bacteria 15528
615 nmdc:mga05p37_167051_c1 3300050507 Bacteria 2685
616 nmdc:mga05p37_174_c1 3300050507 Bacteria 62666
617 nmdc:mga05p37_64450_c1 3300050507 Bacteria 4509
618 nmdc:mga05p37_72026_c1 3300050507 Bacteria 2695
619 nmdc:mga05p37_89187_c1 3300050507 Bacteria 3800
620 nmdc:mga09592_216693_c1 3300050508 Bacteria 1659
621 nmdc:mga09592_22043_c1 3300050508 Bacteria 5256
622 nmdc:mga09592_506863_c1 3300050508 Bacteria 1039
623 nmdc:mga09592_879334_c1 3300050508 Bacteria 754
624 nmdc:mga09592_962840_c1 3300050508 Bacteria 715
625 nmdc:mga0qj67_1151_c1 3300050509 Bacteria 18319
626 nmdc:mga0qj67_175518_c1 3300050509 Bacteria 1740
627 nmdc:mga0qj67_191086_c1 3300050509 Bacteria 1664
628 nmdc:mga0qj67_57581_c1 3300050509 Bacteria 3081
629 nmdc:mga06r32_252949_c1 3300050510 Bacteria 1749
630 nmdc:mga06r32_33135_c1 3300050510 Bacteria 4865
631 nmdc:mga06r32_6659_c1 3300050510 Bacteria 10384
632 nmdc:mga06r32_930135_c1 3300050510 Bacteria 825
633 nmdc:mga08y16_1025612_c1 3300050511 Bacteria 804
634 nmdc:mga08y16_114159_c1 3300050511 Bacteria 2812
635 nmdc:mga08y16_115075_c1 3300050511 Bacteria 2800
636 nmdc:mga08y16_26595_c1 3300050511 Bacteria 6100
637 nmdc:mga08y16_33537_c1 3300050511 Bacteria 5392
638 nmdc:mga08y16_348475_c1 3300050511 Bacteria 1522
639 nmdc:mga08y16_936733_c1 3300050511 Bacteria 850
640 nmdc:mga0n895_11385_c1 3300050512 Bacteria 7934
641 nmdc:mga0n895_414535_c1 3300050512 Bacteria 1362
642 nmdc:mga0rr50_1020476_c1 3300050513 Bacteria 705
643 nmdc:mga0rr50_327152_c1 3300050513 Bacteria 1286
644 nmdc:mga0rr50_774090_c1 3300050513 Bacteria 819
645 nmdc:mga0a205_210479_c1 3300050515 Bacteria 1833
646 nmdc:mga0a205_322396_c1 3300050515 Bacteria 1416
647 nmdc:mga0a205_5905_c2 3300050515 Bacteria 3456
648 nmdc:mga0a205_92170_c1 3300050515 Bacteria 2928
649 Ga0495619_0647209 3300053085 Bacteria 721
650 Ga0501084_0013715 3300054114 Bacteria 6708
651 Ga0501084_0868665 3300054114 Bacteria 759
652 Ga0501084_1062864 3300054114 Bacteria 680
653 Ga0590071_000639 3300059421 Bacteria 9941
654 Ga0590074_000990 3300059423 Bacteria 4468
655 Ga0590075_000405 3300059424 Bacteria 11801
656 Ga0590075_001993 3300059424 Bacteria 4928
657 Ga0590077_000732 3300059426 Bacteria 8606
658 Ga0587091_114604 3300059511 Bacteria 648
659 Ga0587109_130034 3300059624 Bacteria 606
660 Ga0501082_0001088 3300060353 Bacteria 24065
661 Ga0501082_0843703 3300060353 Bacteria 801
662 Ga0501082_0849083 3300060353 Bacteria 799
663 Ga0501082_1306911 3300060353 Bacteria 633
664 Ga0530510_0024932 3300061734 Bacteria 4274
665 Ga0530510_0143170 3300061734 Bacteria 1762
666 Ga0530510_0200670 3300061734 Bacteria 1481
667 Ga0075436_100171580
668 JGI24746J21847_1000233
669 JGI24033J26618_1005167
670 JGI24034J26672_10112326
671 JGI24751J29686_10012400
672 Ga0006777J48905_1123619
673 Ga0007416J51690_1063111
674 Ga0007416J51690_1101573
675 Ga0058859_10019471
676 Ga0058859_11775919
677 Ga0058860_11906096
678 Ga0058860_12244637
679 Ga0058862_11786879
680 Ga0065714_10173802
681 Ga0065704_10476906
682 Ga0065712_10001933
683 Ga0065715_10001671
684 Ga0065715_10505047
685 Ga0065707_10003811
686 Ga0065707_10105294
687 Ga0070658_11104658
688 Ga0070676_10015465
689 Ga0070683_100765862
690 Ga0070683_100876216
691 Ga0070690_100015535
692 Ga0070670_100106489
693 Ga0070670_100307420
694 Ga0070670_101372638
695 Ga0070677_10003623
696 Ga0070677_10017200
697 Ga0070677_10241132
698 Ga0068869_100011339
699 Ga0070666_10006773
700 Ga0070666_10176944
701 Ga0070680_100153870
702 Ga0070680_100695760
703 Ga0070680_100950518
704 Ga0070682_100420608
705 Ga0070682_100672112
706 Ga0070682_101137338
707 Ga0068868_100042747
708 Ga0068868_100220847
709 Ga0070660_101016681
710 Ga0070687_100123897
711 Ga0070661_100143560
712 Ga0070661_100251624
713 Ga0070668_100060390
714 Ga0070668_100298477
715 Ga0070668_100412043
716 Ga0070669_100018135
717 Ga0070669_100065295
718 Ga0070669_100199010
719 Ga0070669_100241351
720 Ga0070675_100069790
721 Ga0070675_100073969
722 Ga0070675_100318563
723 Ga0070675_100435112
724 Ga0070675_100458080
725 Ga0070675_100592822
726 Ga0070674_100059423
727 Ga0070674_100063588
728 Ga0070674_100529688
729 Ga0070673_100031948
730 Ga0070673_100500937
731 Ga0070673_100502769
732 Ga0070688_100058832
733 Ga0070688_100219723
734 Ga0070659_100059312
735 Ga0070659_100139468
736 Ga0070659_100304541
737 Ga0070659_100500519
738 Ga0070667_100030091
739 Ga0070667_100195559
740 Ga0070667_101064727
741 Ga0070703_10410551
742 Ga0070713_100864289
743 Ga0070710_10161269
744 Ga0070701_10046203
745 Ga0070701_10349941
746 Ga0070705_100770483
747 Ga0070700_100210188
748 Ga0070700_100899322
749 Ga0070694_100196914
750 Ga0070708_100037389
751 Ga0070663_100086667
752 Ga0070663_100280147
753 Ga0070663_100623700
754 Ga0070678_100073380
755 Ga0070678_100157250
756 Ga0070678_100237453
757 Ga0070662_100021077
758 Ga0070662_100289011
759 Ga0070681_10363381
760 Ga0070681_10523089
761 Ga0068867_100457833
762 Ga0068867_101802259
763 Ga0070685_10020159
764 Ga0070707_100078245
765 Ga0070707_100453081
766 Ga0070707_100763141
767 Ga0070698_100179241
768 Ga0070699_100358954
769 Ga0070699_100844360
770 Ga0070684_100000005
771 Ga0070684_100151829
772 Ga0070684_100227375
773 Ga0070684_101186939
774 Ga0070672_100069103
775 Ga0070686_100013157
776 Ga0070686_100356719
777 Ga0070695_100492584
778 Ga0070693_100025995
779 Ga0070665_100026504
780 Ga0070665_100191886
781 Ga0070704_100174582
782 Ga0070704_100587241
783 Ga0068855_100341200
784 Ga0068855_100542544
785 Ga0070664_100015545
786 Ga0070664_100312850
787 Ga0068857_100288113
788 Ga0068857_100342352
789 Ga0068856_102417319
790 Ga0070702_100046299
791 Ga0070702_100513235
792 Ga0070702_101636328
793 Ga0068852_100100481
794 Ga0068859_100030987
795 Ga0068864_100041795
796 Ga0068864_100048881
797 Ga0068864_100122739
798 Ga0068866_10067220
799 Ga0068861_100082031
800 Ga0068861_100193155
801 Ga0068861_100391671
802 Ga0068861_100652175
803 Ga0068851_10642413
804 Ga0068851_10848094
805 Ga0068870_10002825
806 Ga0068870_10018787
807 Ga0068870_10143247
808 Ga0068870_10345531
809 Ga0068863_100002641
810 Ga0068863_100004974
811 Ga0068863_100021102
812 Ga0068863_100306660
813 Ga0068858_100135030
814 Ga0068858_100345287
815 Ga0068858_101043585
816 Ga0068860_100265039
817 Ga0068862_100015325
818 Ga0068862_100241833
819 Ga0068862_100524012
820 Ga0081455_10052243
821 Ga0081455_10178427
822 Ga0081539_10075046
823 Ga0081539_10096990
824 Ga0070717_10330460
825 Ga0070717_11044374
826 Ga0075365_10056720
827 Ga0075365_10134398
828 Ga0075368_10078723
829 Ga0075363_100196465
830 Ga0075364_10020198
831 Ga0075364_10026992
832 Ga0075364_10234846
833 Ga0075364_10238715
834 Ga0075364_10365703
835 Ga0070715_10292104
836 Ga0070716_100225123
837 Ga0075362_10012980
838 Ga0075367_10027610
839 Ga0097621_100012152
840 Ga0097621_100133934
841 Ga0075370_10003319
842 Ga0075370_10213183
843 Ga0068871_100016384
844 Ga0068871_100079899
845 Ga0068871_100853367
846 Ga0068871_100995475
847 Ga0075428_100006247
848 Ga0075428_100073818
849 Ga0075428_100405285
850 Ga0075428_100706973
851 Ga0075428_101192791
852 Ga0075430_100037983
853 Ga0075430_100073487
854 Ga0075430_100123559
855 Ga0075430_100165088
856 Ga0075430_100473617
857 Ga0075431_100038760
858 Ga0075431_100102783
859 Ga0075431_100441293
860 Ga0075431_100735419
861 Ga0075433_10137497
862 Ga0075433_10384165
863 Ga0075434_100075941
864 Ga0075434_100207816
865 Ga0075434_100444078
866 Ga0075434_100771965
867 Ga0075429_100032192
868 Ga0075429_100196209
869 Ga0075429_100296134
870 Ga0075429_101175681
871 Ga0068865_100101758
872 Ga0068865_100199213
873 Ga0068865_100233430
874 Ga0068865_100303016
875 Ga0075436_100897303
876 Ga0097620_100030988
877 Ga0075435_100111882
878 Ga0075435_100209420
879 Ga0075435_100541696
880 Ga0099795_10507784
881 Ga0105240_11842780
882 Ga0111539_10006125
883 Ga0111539_10086327
884 Ga0111539_10442312
885 Ga0111539_10655632
886 Ga0111539_10983185
887 Ga0105245_10873496
888 Ga0105247_10151099
889 Ga0105247_10154422
890 Ga0114129_10000509
891 Ga0114129_10218741
892 Ga0114129_10423270
893 Ga0114129_10520539
894 Ga0114129_11024530
895 Ga0105243_10599455
896 Ga0105248_10058749
897 Ga0105248_10091578
898 Ga0105248_10115515
899 Ga0105248_10241022
900 Ga0105248_10526826
901 Ga0105237_10028737
902 Ga0105237_10362882
903 Ga0105238_10914134
904 Ga0105249_10045243
905 Ga0105249_10462265
906 Ga0105249_12848987
907 Ga0105249_12874722
908 Ga0105239_10918573
909 Ga0105246_10299022
910 Ga0157344_1003056
911 Ga0157325_1009757
912 Ga0157321_1014566
913 Ga0157343_1018638
914 Ga0157315_1048829
915 Ga0157327_1015761
916 Ga0157326_1006712
917 Ga0157373_10352549
918 Ga0157373_10999713
919 Ga0157370_10289392
920 Ga0157370_10378050
921 Ga0157374_10216423
922 Ga0157374_10493812
923 Ga0157378_10111251
924 Ga0157378_10211598
925 Ga0157378_10417976
926 Ga0157378_10899211
927 Ga0157378_12062031
928 Ga0163162_10050913
929 Ga0163162_12470200
930 Ga0157372_10266156
931 Ga0157372_10403697
932 Ga0157372_10576005
933 Ga0157372_12720670
934 Ga0157375_10024596
935 Ga0157375_10224479
936 Ga0157375_10239122
937 Ga0157375_12255532
938 Ga0163163_10017278
939 Ga0163163_10269853
940 Ga0157380_10050583
941 Ga0157380_10528649
942 Ga0157380_10535944
943 Ga0157380_11374864
944 Ga0157377_10039480
945 Ga0157377_10071363
946 Ga0157377_10174126
947 Ga0157377_10442950
948 Ga0157377_11285779
949 Ga0157379_10008242
950 Ga0157379_10618670
951 Ga0157379_10793856
952 Ga0157376_10052729
953 Ga0157376_10298338
954 Ga0157376_10333102
955 Ga0163161_10130942
956 Ga0163161_10251643
957 Ga0163161_10528773
958 Ga0206354_10578228
959 Ga0206354_11236891
960 Ga0206353_11000470
961 Ga0206353_11454380
962 Ga0213876_10352014
963 Ga0213876_10441742
964 Ga0207673_1044946
965 Ga0207697_10025064
966 Ga0207697_10247629
967 Ga0207656_10627763
968 Ga0207682_10003744
969 Ga0207682_10160910
970 Ga0207682_10200664
971 Ga0207642_10017409
972 Ga0207710_10117877
973 Ga0207688_10004034
974 Ga0207688_10304090
975 Ga0207680_10030976
976 Ga0207680_10125118
977 Ga0207645_10020173
978 Ga0207643_10014738
979 Ga0207643_10039470
980 Ga0207684_10922582
981 Ga0207707_10289744
982 Ga0207707_10467598
983 Ga0207695_10005058
984 Ga0207671_10107810
985 Ga0207671_11373387
986 Ga0207663_10303034
987 Ga0207660_10121427
988 Ga0207662_10023780
989 Ga0207662_10092020
990 Ga0207662_10312280
991 Ga0207662_10427638
992 Ga0207657_10406346
993 Ga0207657_10462360
994 Ga0207649_10041544
995 Ga0207649_10060211
996 Ga0207681_10007716
997 Ga0207681_10021069
998 Ga0207681_10098285
999 Ga0207681_11009881
1000 Ga0207681_11804193
1001 Ga0207650_10092421
1002 Ga0207650_10259492
1003 Ga0207650_11224906
1004 Ga0207650_11398222
1005 Ga0207659_10016029
1006 Ga0207659_10022090
1007 Ga0207659_10045104
1008 Ga0207659_10864579
1009 Ga0207687_10248681
1010 Ga0207700_11476553
1011 Ga0207644_10132711
1012 Ga0207690_10062174
1013 Ga0207690_10235240
1014 Ga0207690_10437906
1015 Ga0207690_11680406
1016 Ga0207706_10010042
1017 Ga0207706_10036777
1018 Ga0207706_10215233
1019 Ga0207706_10484684
1020 Ga0207709_11815270
1021 Ga0207670_10213994
1022 Ga0207669_10093698
1023 Ga0207669_10529415
1024 Ga0207669_11233456
1025 Ga0207704_10356782
1026 Ga0207704_10381085
1027 Ga0207691_10026550
1028 Ga0207691_10032466
1029 Ga0207691_10075386
1030 Ga0207691_10427627
1031 Ga0207711_10214713
1032 Ga0207711_10228563
1033 Ga0207711_10302995
1034 Ga0207689_10009264
1035 Ga0207689_10266290
1036 Ga0207661_10000066
1037 Ga0207661_10597067
1038 Ga0207661_10711091
1039 Ga0207679_10008656
1040 Ga0207679_10248210
1041 Ga0207679_10452185
1042 Ga0207679_11921989
1043 Ga0207667_10046100
1044 Ga0207667_11377784
1045 Ga0207651_10113005
1046 Ga0207651_10157714
1047 Ga0207712_10009646
1048 Ga0207712_10268970
1049 Ga0207712_10309079
1050 Ga0207668_10376039
1051 Ga0207668_10784468
1052 Ga0207640_11416475
1053 Ga0207658_10057390
1054 Ga0207677_10075120
1055 Ga0207677_10130122
1056 Ga0207677_10173421
1057 Ga0207703_10528011
1058 Ga0207639_10916606
1059 Ga0207639_12175242
1060 Ga0207678_10097055
1061 Ga0207678_10100642
1062 Ga0207678_10346728
1063 Ga0207708_10098605
1064 Ga0207708_10452344
1065 Ga0207708_10455915
1066 Ga0207702_11566826
1067 Ga0207641_10006730
1068 Ga0207641_10288030
1069 Ga0207648_10451431
1070 Ga0207648_10710475
1071 Ga0207676_10066148
1072 Ga0207676_10342108
1073 Ga0207674_10031464
1074 Ga0207674_10217244
1075 Ga0207674_10957396
1076 Ga0207675_100134337
1077 Ga0207675_100158686
1078 Ga0207675_100242080
1079 Ga0207675_100417863
1080 Ga0207675_100534130
1081 Ga0207683_10310362
1082 Ga0207683_10344395
1083 Ga0207683_10371427
1084 Ga0207698_10060317
1085 Ga0207698_10533726
1086 Ga0207698_11106440
1087 Ga0209983_1057244
1088 Ga0209983_1064158
1089 Ga0209971_1007890
1090 Ga0209813_10018512
1091 Ga0207428_10004000
1092 Ga0207428_10032350
1093 Ga0207428_10043855
1094 Ga0207428_10136531
1095 Ga0207428_10216892
1096 Ga0268266_10065213
1097 Ga0268265_10104877
1098 Ga0268265_10264276
1099 Ga0268265_12335428
1100 Ga0268264_10158150
1101 Ga0268264_10802227
1102 Ga0268264_12079134
1103 Ga0265330_10028687
1104 Ga0307408_101949367
1105 Ga0265313_10078176
1106 Ga0265342_10689768
1107 Ga0307413_11666055
1108 Ga0307410_10809899
1109 Ga0307406_10776161
1110 Ga0307412_11460987
1111 Ga0307409_100215295
1112 Ga0307409_100307922
1113 Ga0307409_100915181
1114 Ga0307416_100060968
1115 Ga0307416_100304102
1116 Ga0307416_100409761
1117 Ga0307416_102224273
1118 Ga0307416_102777951
1119 Ga0307416_103341253
1120 Ga0307414_10887822
1121 Ga0307411_10536128
1122 Ga0373948_0062923
1123 Ga0373958_0093219
1124 Ga0373958_0139944
1125 Ga0373938_0024985
1126 Ga0373949_0033107
1127 Ga0373949_0062584
1128 Ga0373949_0276235
1129 Ga0373951_0093339
1130 Ga0373952_0010237
1131 Ga0373932_0004171
1132 Ga0373932_0060186
1133 Ga0373939_0028793
1134 Ga0373939_0145600
1135 Ga0373941_0041207
1136 Ga0373956_0494292
1137 Ga0373946_0629376
1138 Ga0373955_0330740
1139 Ga0373961_0037722
1140 Ga0373962_0029609
1141 Ga0373931_0177612
1142 Ga0373931_1155038
1143 Ga0373937_0452562
1144 Ga0373937_0592203
1145 Ga0242420_040590
1146 Ga0242420_064823
1147 Ga0436365_1495932
1148 Ga0436365_1905291
1149 Ga0436363_0000938
1150 Ga0436363_0635795
1151 Ga0451789_0922011
1152 Ga0451802_1438812
1153 Ga0451837_0032524
1154 Ga0439450_017840
1155 Ga0439457_119048
1156 Ga0450913_029300
1157 Ga0450923_039302
1158 Ga0439446_0060606
1159 Ga0450908_014072
1160 Ga0439435_0226863
1161 Ga0439464_0044240
1162 Ga0439464_0054163
1163 Ga0450918_015273
1164 Ga0466963_0011480
1165 Ga0466963_0321594
1166 Ga0466963_0720272
1167 Ga0453684_0532977
1168 Ga0453684_1241675
1169 Ga0466957_0290090
1170 Ga0451576_0809224
1171 Ga0451576_1390070
1172 Ga0451576_2228305
1173 Ga0466967_0189555
1174 Ga0466967_0874181
1175 Ga0466967_1344030
1176 Ga0495603_0545395
1177 Ga0495580_0126095
1178 Ga0495580_0203345
1179 Ga0495580_0608282
1180 Ga0495607_0332242
1181 Ga0495628_0684821
1182 Ga0495621_0103593
1183 Ga0495633_0038251
1184 Ga0495656_0158161
1185 Ga0495635_0510639
1186 Ga0495599_0173553
1187 Ga0495671_0147927
1188 Ga0495681_0351625
1189 Ga0496101_0340361
1190 Ga0496101_1075604
1191 Ga0496102_0567258
1192 Ga0496104_0095500
1193 Ga0496104_0422773
1194 Ga0496105_0698329
1195 Ga0496106_0177937
1196 Ga0496108_0075002
1197 Ga0496108_0686800
1198 Ga0496109_0020569
1199 Ga0496109_0182351
1200 Ga0496110_0114980
1201 Ga0496110_0268846
1202 Ga0496110_0898034
1203 Ga0496112_0013647
1204 Ga0496112_0074263
1205 Ga0496112_0383849
1206 Ga0496112_0402070
1207 Ga0496113_0603381
1208 Ga0501316_010529
1209 Ga0501033_0437752
1210 Ga0501036_0032096
1211 Ga0501038_0206105
1212 Ga0501038_0640084
1213 Ga0501039_0035361
1214 Ga0501040_0013689
1215 Ga0501040_0024036
1216 Ga0501040_0755144
1217 Ga0501041_0051260
1218 Ga0501041_0095363
1219 Ga0501041_0451874
1220 Ga0501042_0077986
1221 Ga0501042_0488044
1222 Ga0501042_0606776
1223 Ga0501043_0128567
1224 Ga0501043_0414404
1225 Ga0501043_0926375
1226 Ga0501046_0549883
1227 Ga0501048_0016036
1228 Ga0501048_0643112
1229 Ga0501048_0905918
1230 Ga0501067_0296184
1231 Ga0501068_0157699
1232 Ga0501068_0896606
1233 Ga0501071_0018416
1234 Ga0501071_0093009
1235 Ga0501071_1182187
1236 Ga0501072_0066972
1237 Ga0501072_0223944
1238 Ga0501072_0631113
1239 Ga0501073_0289144
1240 Ga0501074_0505640
1241 Ga0501074_0660963
1242 Ga0501075_0001529
1243 Ga0501075_0195322
1244 Ga0501075_0938214
1245 Ga0501076_0002067
1246 Ga0501076_0099686
1247 Ga0501076_1555076
1248 Ga0501077_0050775
1249 Ga0501077_0648883
1250 Ga0501079_0046902
1251 Ga0501079_0253189
1252 Ga0501080_0350257
1253 Ga0501080_0382180
1254 Ga0501080_0885174
1255 Ga0501080_1274567
1256 Ga0501081_0061259
1257 Ga0501081_0262251
1258 Ga0501081_0368947
1259 Ga0501081_0485077
1260 Ga0501081_1312744
1261 Ga0501083_0337302
1262 Ga0501035_0284427
1263 Ga0501045_0008126
1264 nmdc:mga03683_795_c1
1265 nmdc:mga03n38_68435_c1
1266 nmdc:mga00v17_511815_c1
1267 nmdc:mga00v17_6511_c1
1268 nmdc:mga00v17_7196_c1
1269 nmdc:mga00v17_7353_c1
1270 nmdc:mga0yw44_253465_c1
1271 nmdc:mga0yw44_61017_c1
1272 nmdc:mga0k408_213715_c2
1273 nmdc:mga0k408_29262_c1
1274 nmdc:mga0k408_333389_c1
1275 nmdc:mga0k408_787048_c1
1276 nmdc:mga06z11_134938_c1
1277 nmdc:mga06z11_13867_c1
1278 nmdc:mga06z11_288996_c1
1279 nmdc:mga07m45_131885_c1
1280 nmdc:mga07m45_583_c1
1281 nmdc:mga05p37_167051_c1
1282 nmdc:mga05p37_174_c1
1283 nmdc:mga05p37_64450_c1
1284 nmdc:mga05p37_72026_c1
1285 nmdc:mga05p37_89187_c1
1286 nmdc:mga09592_216693_c1
1287 nmdc:mga09592_22043_c1
1288 nmdc:mga09592_506863_c1
1289 nmdc:mga09592_879334_c1
1290 nmdc:mga09592_962840_c1
1291 nmdc:mga0qj67_1151_c1
1292 nmdc:mga0qj67_175518_c1
1293 nmdc:mga0qj67_191086_c1
1294 nmdc:mga0qj67_57581_c1
1295 nmdc:mga06r32_252949_c1
1296 nmdc:mga06r32_33135_c1
1297 nmdc:mga06r32_6659_c1
1298 nmdc:mga06r32_930135_c1
1299 nmdc:mga08y16_1025612_c1
1300 nmdc:mga08y16_114159_c1
1301 nmdc:mga08y16_115075_c1
1302 nmdc:mga08y16_26595_c1
1303 nmdc:mga08y16_33537_c1
1304 nmdc:mga08y16_348475_c1
1305 nmdc:mga08y16_936733_c1
1306 nmdc:mga0n895_11385_c1
1307 nmdc:mga0n895_414535_c1
1308 nmdc:mga0rr50_1020476_c1
1309 nmdc:mga0rr50_327152_c1
1310 nmdc:mga0rr50_774090_c1
1311 nmdc:mga0a205_210479_c1
1312 nmdc:mga0a205_322396_c1
1313 nmdc:mga0a205_5905_c2
1314 nmdc:mga0a205_92170_c1
1315 Ga0495619_0647209
1316 Ga0501084_0013715
1317 Ga0501084_0868665
1318 Ga0501084_1062864
1319 Ga0590071_000639
1320 Ga0590074_000990
1321 Ga0590075_000405
1322 Ga0590075_001993
1323 Ga0590077_000732
1324 Ga0587091_114604
1325 Ga0587109_130034
1326 Ga0501082_0001088
1327 Ga0501082_0843703
1328 Ga0501082_0849083
1329 Ga0501082_1306911
1330 Ga0530510_0024932
1331 Ga0530510_0143170
1332 Ga0530510_0200670

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00542

Ribosomal_L12

Ribosomal protein L7/L12 C-terminal domain

55

121

0.99

PF16320

Ribosomal_L12_N

Ribosomal protein L7/L12 dimerisation domain

5

52

0.86

Map