F473605
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 664 | 376 | 650 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100148431|Ga0070714_1001484311 |
| Length | 273 |
| Sequence | VGFHCCLVPGIAGCEDILRAGAHAVAITLRRGEGLHLKTELQGYRGPVAGTQPEYLHPAYISSVKRAPTQPLVSIPQTLSEVTGPQFGVDDISPCIVDLTRQHKGAPLGERIIVTGRVLDEDARPMAHTLVEVWQANAAGRYLHTIDQHDAPLDPNFTGCGHTLTDADGHYRFITIKPGCYPWRNHHNAWRPAHIHFSLFGPAFATRLVTQMYFPGDPLLASDPIYNCTADEEARKRLVSVFDWETTVPETALGYRFDIVLRGREQTPMEGSE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 3 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 4 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 5 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 6 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 7 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 8 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 9 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 10 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 11 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 12 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 13 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 14 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 15 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 20 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 110 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 111 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 112 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 185 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 190 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 191 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 193 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 196 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 197 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 201 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 202 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 203 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 205 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 208 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 209 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 210 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 217 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 224 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 226 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 227 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 238 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 242 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 243 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 244 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 245 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 246 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 247 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 248 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 249 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 250 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 292 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 293 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 296 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 297 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 301 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 302 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 303 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 304 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 305 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 306 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 307 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 308 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 334 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 340 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 346 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 347 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 358 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 362 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 363 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 364 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 365 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 367 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 368 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 369 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 370 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 371 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 372 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 373 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 376 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.14 |
| Metatranscriptomes | 0.75 |
| Isolates | 2.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.33 |
| Nodule | 0.6 |
| Rhizoplane | 3.01 |
| Rhizosphere | 84.19 |
| Stem | 0 |
| Stem Tuber | 0.15 |
| Unclassified | 5.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24035J26624_1009571 | 3300002126 | Bacteria | 956 |
| 2 | JGI25156J39149_1006284 | 3300002705 | Bacteria | 3268 |
| 3 | JGI25164J39214_1001746 | 3300002772 | Bacteria | 4313 |
| 4 | JGI25165J46597_1000004 | 3300003214 | Bacteria | 667510 |
| 5 | JGI25160J50197_1008717 | 3300003354 | Bacteria | 3840 |
| 6 | Ga0055540_1042764 | 3300003792 | Bacteria | 969 |
| 7 | Ga0065712_10075868 | 3300005290 | Bacteria | 3774 |
| 8 | Ga0065715_10018959 | 3300005293 | Bacteria | 2229 |
| 9 | Ga0070683_100073554 | 3300005329 | Bacteria | 3191 |
| 10 | Ga0070683_100124624 | 3300005329 | Bacteria | 2435 |
| 11 | Ga0070683_100168185 | 3300005329 | Bacteria | 2080 |
| 12 | Ga0070683_100187069 | 3300005329 | Bacteria | 1966 |
| 13 | Ga0070683_100508717 | 3300005329 | Bacteria | 1151 |
| 14 | Ga0070690_100333068 | 3300005330 | Bacteria | 1097 |
| 15 | Ga0070670_100004072 | 3300005331 | Bacteria | 12208 |
| 16 | Ga0070670_100068491 | 3300005331 | Bacteria | 3046 |
| 17 | Ga0070670_100179243 | 3300005331 | Bacteria | 1839 |
| 18 | Ga0068869_100014092 | 3300005334 | Bacteria | 5335 |
| 19 | Ga0070666_10310826 | 3300005335 | Bacteria | 1123 |
| 20 | Ga0070682_100104356 | 3300005337 | Bacteria | 1877 |
| 21 | Ga0070660_100304047 | 3300005339 | Bacteria | 1308 |
| 22 | Ga0070689_100031317 | 3300005340 | Bacteria | 4042 |
| 23 | Ga0070689_100033349 | 3300005340 | Bacteria | 3923 |
| 24 | Ga0070689_100070580 | 3300005340 | Bacteria | 2728 |
| 25 | Ga0070661_100179530 | 3300005344 | Bacteria | 1610 |
| 26 | Ga0070674_100044539 | 3300005356 | Bacteria | 3026 |
| 27 | Ga0070673_100628555 | 3300005364 | Bacteria | 981 |
| 28 | Ga0070688_100610178 | 3300005365 | Bacteria | 836 |
| 29 | Ga0070667_100086872 | 3300005367 | Bacteria | 2684 |
| 30 | Ga0070709_10026270 | 3300005434 | Bacteria | 3449 |
| 31 | Ga0070714_100034440 | 3300005435 | Bacteria | 4241 |
| 32 | Ga0070714_100148431 | 3300005435 | Bacteria | 2110 |
| 33 | Ga0070714_100662021 | 3300005435 | Bacteria | 1006 |
| 34 | Ga0070714_100733518 | 3300005435 | Bacteria | 954 |
| 35 | Ga0070713_100014911 | 3300005436 | Bacteria | 5786 |
| 36 | Ga0070713_100028199 | 3300005436 | Bacteria | 4432 |
| 37 | Ga0070713_100163342 | 3300005436 | Bacteria | 1989 |
| 38 | Ga0070713_100821324 | 3300005436 | Bacteria | 892 |
| 39 | Ga0070710_10216034 | 3300005437 | Bacteria | 1218 |
| 40 | Ga0070701_10015096 | 3300005438 | Bacteria | 3558 |
| 41 | Ga0070711_100011172 | 3300005439 | Bacteria | 5568 |
| 42 | Ga0070711_100043640 | 3300005439 | Bacteria | 3038 |
| 43 | Ga0070705_100032151 | 3300005440 | Bacteria | 2912 |
| 44 | Ga0070694_100063897 | 3300005444 | Bacteria | 2518 |
| 45 | Ga0070708_100036904 | 3300005445 | Bacteria | 4262 |
| 46 | Ga0070678_100051045 | 3300005456 | Bacteria | 2995 |
| 47 | Ga0070662_100518242 | 3300005457 | Bacteria | 996 |
| 48 | Ga0070681_10000304 | 3300005458 | Bacteria | 39863 |
| 49 | Ga0070681_10000747 | 3300005458 | Bacteria | 26992 |
| 50 | Ga0070681_10021101 | 3300005458 | Bacteria | 6526 |
| 51 | Ga0070681_10021818 | 3300005458 | Bacteria | 6422 |
| 52 | Ga0070681_10024461 | 3300005458 | Bacteria | 6080 |
| 53 | Ga0068867_100006678 | 3300005459 | Bacteria | 8158 |
| 54 | Ga0070706_100798993 | 3300005467 | Bacteria | 873 |
| 55 | Ga0070707_100013355 | 3300005468 | Bacteria | 7682 |
| 56 | Ga0070707_100016015 | 3300005468 | Bacteria | 7034 |
| 57 | Ga0070707_100176507 | 3300005468 | Bacteria | 2082 |
| 58 | Ga0070698_100004028 | 3300005471 | Bacteria | 16171 |
| 59 | Ga0070699_100285020 | 3300005518 | Bacteria | 1480 |
| 60 | Ga0070679_100024816 | 3300005530 | Bacteria | 5876 |
| 61 | Ga0070679_100033468 | 3300005530 | Bacteria | 5090 |
| 62 | Ga0070679_100119756 | 3300005530 | Bacteria | 2617 |
| 63 | Ga0070684_100060840 | 3300005535 | Bacteria | 3304 |
| 64 | Ga0070684_100072504 | 3300005535 | Bacteria | 3032 |
| 65 | Ga0070697_100005154 | 3300005536 | Bacteria | 10036 |
| 66 | Ga0070697_100039013 | 3300005536 | Bacteria | 3839 |
| 67 | Ga0070697_100303087 | 3300005536 | Bacteria | 1373 |
| 68 | Ga0068853_100123859 | 3300005539 | Bacteria | 2308 |
| 69 | Ga0068853_100201020 | 3300005539 | Bacteria | 1813 |
| 70 | Ga0068853_100518421 | 3300005539 | Bacteria | 1127 |
| 71 | Ga0070695_100213026 | 3300005545 | Bacteria | 1388 |
| 72 | Ga0070693_100091312 | 3300005547 | Bacteria | 1836 |
| 73 | Ga0070693_100098984 | 3300005547 | Bacteria | 1773 |
| 74 | Ga0070665_100005312 | 3300005548 | Bacteria | 13304 |
| 75 | Ga0070665_100090631 | 3300005548 | Bacteria | 3063 |
| 76 | Ga0068855_100000563 | 3300005563 | Bacteria | 45518 |
| 77 | Ga0068855_100051557 | 3300005563 | Bacteria | 4847 |
| 78 | Ga0068855_100405070 | 3300005563 | Bacteria | 1494 |
| 79 | Ga0070664_100000879 | 3300005564 | Bacteria | 23312 |
| 80 | Ga0070664_100147124 | 3300005564 | Bacteria | 2078 |
| 81 | Ga0068857_100000022 | 3300005577 | Bacteria | 87864 |
| 82 | Ga0068857_100002691 | 3300005577 | Bacteria | 14592 |
| 83 | Ga0068857_100038259 | 3300005577 | Bacteria | 4249 |
| 84 | Ga0068857_100209430 | 3300005577 | Bacteria | 1779 |
| 85 | Ga0068854_100007043 | 3300005578 | Bacteria | 7177 |
| 86 | Ga0068854_100009020 | 3300005578 | Bacteria | 6427 |
| 87 | Ga0068854_100408437 | 3300005578 | Bacteria | 1125 |
| 88 | Ga0068856_100000448 | 3300005614 | Bacteria | 45521 |
| 89 | Ga0068856_100002645 | 3300005614 | Bacteria | 18368 |
| 90 | Ga0068852_100538622 | 3300005616 | Bacteria | 1167 |
| 91 | Ga0068859_100000885 | 3300005617 | Bacteria | 30517 |
| 92 | Ga0068859_100065693 | 3300005617 | Bacteria | 3661 |
| 93 | Ga0068859_100123537 | 3300005617 | Bacteria | 2656 |
| 94 | Ga0068859_100182041 | 3300005617 | Bacteria | 2184 |
| 95 | Ga0068864_100001248 | 3300005618 | Bacteria | 21136 |
| 96 | Ga0068864_100291991 | 3300005618 | Bacteria | 1524 |
| 97 | Ga0068864_100330612 | 3300005618 | Bacteria | 1434 |
| 98 | Ga0068866_10000934 | 3300005718 | Bacteria | 12833 |
| 99 | Ga0068861_100236334 | 3300005719 | Bacteria | 1552 |
| 100 | Ga0068863_100105879 | 3300005841 | Bacteria | 2676 |
| 101 | Ga0068863_100195737 | 3300005841 | Bacteria | 1943 |
| 102 | Ga0068863_100229718 | 3300005841 | Bacteria | 1789 |
| 103 | Ga0068858_100001352 | 3300005842 | Bacteria | 25271 |
| 104 | Ga0068858_100014743 | 3300005842 | Bacteria | 7355 |
| 105 | Ga0068858_100475468 | 3300005842 | Bacteria | 1206 |
| 106 | Ga0068860_100003736 | 3300005843 | Bacteria | 15663 |
| 107 | Ga0068860_100005346 | 3300005843 | Bacteria | 13033 |
| 108 | Ga0068860_100024758 | 3300005843 | Bacteria | 5798 |
| 109 | Ga0068862_100039154 | 3300005844 | Bacteria | 4025 |
| 110 | Ga0081455_10062033 | 3300005937 | Bacteria | 3143 |
| 111 | Ga0081455_10113916 | 3300005937 | Bacteria | 2144 |
| 112 | Ga0081538_10057902 | 3300005981 | Bacteria | 2253 |
| 113 | Ga0081540_1000873 | 3300005983 | Bacteria | 27254 |
| 114 | Ga0081539_10024363 | 3300005985 | Bacteria | 3929 |
| 115 | Ga0070717_10046226 | 3300006028 | Bacteria | 3561 |
| 116 | Ga0070717_10105767 | 3300006028 | Bacteria | 2395 |
| 117 | Ga0070712_100000897 | 3300006175 | Bacteria | 17835 |
| 118 | Ga0070712_100055596 | 3300006175 | Bacteria | 2772 |
| 119 | Ga0070712_100144569 | 3300006175 | Bacteria | 1819 |
| 120 | Ga0075362_10021997 | 3300006177 | Bacteria | 2682 |
| 121 | Ga0075369_10000896 | 3300006186 | Bacteria | 9871 |
| 122 | Ga0097621_100000279 | 3300006237 | Bacteria | 34252 |
| 123 | Ga0097621_100057804 | 3300006237 | Bacteria | 3173 |
| 124 | Ga0075370_10281585 | 3300006353 | Bacteria | 988 |
| 125 | Ga0068871_100000304 | 3300006358 | Bacteria | 34254 |
| 126 | Ga0068871_100031688 | 3300006358 | Bacteria | 4171 |
| 127 | Ga0068871_100340201 | 3300006358 | Bacteria | 1325 |
| 128 | Ga0075428_100031684 | 3300006844 | Bacteria | 5841 |
| 129 | Ga0075428_100145115 | 3300006844 | Bacteria | 2580 |
| 130 | Ga0075430_100010560 | 3300006846 | Bacteria | 7818 |
| 131 | Ga0075430_100161430 | 3300006846 | Bacteria | 1865 |
| 132 | Ga0075431_100062743 | 3300006847 | Bacteria | 3834 |
| 133 | Ga0075431_100392497 | 3300006847 | Bacteria | 1390 |
| 134 | Ga0075431_100427028 | 3300006847 | Bacteria | 1324 |
| 135 | Ga0075429_100019449 | 3300006880 | Bacteria | 5883 |
| 136 | Ga0075429_100224317 | 3300006880 | Bacteria | 1646 |
| 137 | Ga0097620_100000885 | 3300006931 | Bacteria | 30517 |
| 138 | Ga0097620_100065696 | 3300006931 | Bacteria | 3661 |
| 139 | Ga0097620_100123538 | 3300006931 | Bacteria | 2656 |
| 140 | Ga0097620_100182033 | 3300006931 | Bacteria | 2184 |
| 141 | Ga0099826_10000036 | 3300006948 | Bacteria | 104982 |
| 142 | Ga0075435_100100381 | 3300007076 | Bacteria | 2398 |
| 143 | Ga0105251_10020078 | 3300009011 | Bacteria | 3516 |
| 144 | Ga0105240_10007213 | 3300009093 | Bacteria | 16187 |
| 145 | Ga0105240_10025266 | 3300009093 | Bacteria | 7810 |
| 146 | Ga0105245_10461464 | 3300009098 | Bacteria | 1280 |
| 147 | Ga0105245_10652617 | 3300009098 | Bacteria | 1082 |
| 148 | Ga0105241_10047938 | 3300009174 | Bacteria | 3250 |
| 149 | Ga0105241_10119796 | 3300009174 | Bacteria | 2118 |
| 150 | Ga0105242_10118424 | 3300009176 | Bacteria | 2268 |
| 151 | Ga0105248_10420181 | 3300009177 | Bacteria | 1506 |
| 152 | Ga0105248_10588625 | 3300009177 | Bacteria | 1255 |
| 153 | Ga0105248_11311793 | 3300009177 | Bacteria | 819 |
| 154 | Ga0105237_10004260 | 3300009545 | Bacteria | 16634 |
| 155 | Ga0105237_10077670 | 3300009545 | Bacteria | 3310 |
| 156 | Ga0105237_10113762 | 3300009545 | Bacteria | 2698 |
| 157 | Ga0105237_10127292 | 3300009545 | Bacteria | 2541 |
| 158 | Ga0105238_10002919 | 3300009551 | Bacteria | 17068 |
| 159 | Ga0105238_10027383 | 3300009551 | Bacteria | 5807 |
| 160 | Ga0105249_10540294 | 3300009553 | Bacteria | 1215 |
| 161 | Ga0105239_10041668 | 3300010375 | Bacteria | 5031 |
| 162 | Ga0105239_10058972 | 3300010375 | Bacteria | 4213 |
| 163 | Ga0105239_10145496 | 3300010375 | Bacteria | 2643 |
| 164 | Ga0105239_10410719 | 3300010375 | Bacteria | 1533 |
| 165 | Ga0105239_10814026 | 3300010375 | Bacteria | 1070 |
| 166 | Ga0105239_10866644 | 3300010375 | Bacteria | 1036 |
| 167 | Ga0157370_10058618 | 3300013104 | Bacteria | 3659 |
| 168 | Ga0157369_10000243 | 3300013105 | Bacteria | 75602 |
| 169 | Ga0157374_10001216 | 3300013296 | Bacteria | 22009 |
| 170 | Ga0157378_10115644 | 3300013297 | Bacteria | 2465 |
| 171 | Ga0157372_10015924 | 3300013307 | Bacteria | 8063 |
| 172 | Ga0157372_10250419 | 3300013307 | Bacteria | 2056 |
| 173 | Ga0157372_10523405 | 3300013307 | Bacteria | 1382 |
| 174 | Ga0157375_11321365 | 3300013308 | Bacteria | 848 |
| 175 | Ga0157380_10095356 | 3300014326 | Bacteria | 2465 |
| 176 | Ga0157379_10348051 | 3300014968 | Bacteria | 1356 |
| 177 | Ga0213876_10035150 | 3300021384 | Bacteria | 2643 |
| 178 | Ga0213876_10042184 | 3300021384 | Bacteria | 2411 |
| 179 | Ga0213876_10095971 | 3300021384 | Unclassified | 1571 |
| 180 | Ga0224571_100778 | 3300022734 | Bacteria | 1874 |
| 181 | Ga0224572_1011723 | 3300024225 | Bacteria | 1659 |
| 182 | Ga0224572_1034160 | 3300024225 | Bacteria | 966 |
| 183 | Ga0228598_1003353 | 3300024227 | Bacteria | 3447 |
| 184 | Ga0207427_100052 | 3300025231 | Bacteria | 218228 |
| 185 | Ga0209437_100588 | 3300025233 | Bacteria | 23128 |
| 186 | Ga0209026_1005874 | 3300025250 | Bacteria | 3163 |
| 187 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 188 | Ga0207426_1001350 | 3300025302 | Bacteria | 20814 |
| 189 | Ga0207426_1010784 | 3300025302 | Bacteria | 3527 |
| 190 | Ga0207426_1039543 | 3300025302 | Bacteria | 1476 |
| 191 | Ga0209051_1069011 | 3300025303 | Bacteria | 1073 |
| 192 | Ga0207697_10002151 | 3300025315 | Bacteria | 10326 |
| 193 | Ga0207713_1059624 | 3300025735 | Bacteria | 1463 |
| 194 | Ga0207692_10032122 | 3300025898 | Unclassified | 2520 |
| 195 | Ga0207688_10009808 | 3300025901 | Bacteria | 5210 |
| 196 | Ga0207680_10467931 | 3300025903 | Bacteria | 896 |
| 197 | Ga0207647_10089517 | 3300025904 | Bacteria | 1837 |
| 198 | Ga0207699_10119581 | 3300025906 | Bacteria | 1702 |
| 199 | Ga0207645_10281917 | 3300025907 | Bacteria | 1104 |
| 200 | Ga0207684_10098467 | 3300025910 | Bacteria | 2498 |
| 201 | Ga0207654_10082024 | 3300025911 | Bacteria | 1943 |
| 202 | Ga0207707_10001814 | 3300025912 | Bacteria | 19598 |
| 203 | Ga0207707_10003521 | 3300025912 | Bacteria | 13865 |
| 204 | Ga0207707_10083323 | 3300025912 | Bacteria | 2792 |
| 205 | Ga0207695_10020070 | 3300025913 | Bacteria | 7667 |
| 206 | Ga0207695_10036559 | 3300025913 | Bacteria | 5308 |
| 207 | Ga0207695_10267520 | 3300025913 | Bacteria | 1606 |
| 208 | Ga0207671_10056312 | 3300025914 | Bacteria | 2913 |
| 209 | Ga0207671_10078067 | 3300025914 | Bacteria | 2479 |
| 210 | Ga0207693_10015053 | 3300025915 | Bacteria | 6209 |
| 211 | Ga0207693_10034939 | 3300025915 | Bacteria | 3965 |
| 212 | Ga0207693_10089856 | 3300025915 | Bacteria | 2407 |
| 213 | Ga0207663_10022626 | 3300025916 | Bacteria | 3597 |
| 214 | Ga0207663_10025717 | 3300025916 | Bacteria | 3407 |
| 215 | Ga0207663_10111069 | 3300025916 | Bacteria | 1860 |
| 216 | Ga0207663_10146180 | 3300025916 | Bacteria | 1653 |
| 217 | Ga0207663_10154977 | 3300025916 | Bacteria | 1610 |
| 218 | Ga0207657_10184221 | 3300025919 | Bacteria | 1687 |
| 219 | Ga0207652_10003767 | 3300025921 | Bacteria | 12413 |
| 220 | Ga0207652_10009905 | 3300025921 | Bacteria | 7669 |
| 221 | Ga0207652_10123612 | 3300025921 | Bacteria | 2304 |
| 222 | Ga0207652_10640565 | 3300025921 | Bacteria | 951 |
| 223 | Ga0207646_10013154 | 3300025922 | Bacteria | 7919 |
| 224 | Ga0207646_10074267 | 3300025922 | Bacteria | 3037 |
| 225 | Ga0207646_10103448 | 3300025922 | Bacteria | 2554 |
| 226 | Ga0207646_10155012 | 3300025922 | Bacteria | 2066 |
| 227 | Ga0207646_10358220 | 3300025922 | Bacteria | 1318 |
| 228 | Ga0207694_10000896 | 3300025924 | Bacteria | 26371 |
| 229 | Ga0207694_10036803 | 3300025924 | Bacteria | 3756 |
| 230 | Ga0207694_10089884 | 3300025924 | Bacteria | 2422 |
| 231 | Ga0207650_10020298 | 3300025925 | Bacteria | 4684 |
| 232 | Ga0207650_10034595 | 3300025925 | Bacteria | 3665 |
| 233 | Ga0207650_10050834 | 3300025925 | Bacteria | 3066 |
| 234 | Ga0207659_10290469 | 3300025926 | Bacteria | 1339 |
| 235 | Ga0207700_10052042 | 3300025928 | Bacteria | 3060 |
| 236 | Ga0207700_10089216 | 3300025928 | Bacteria | 2430 |
| 237 | Ga0207664_10199227 | 3300025929 | Bacteria | 1727 |
| 238 | Ga0207664_10552658 | 3300025929 | Bacteria | 1033 |
| 239 | Ga0207664_10581100 | 3300025929 | Bacteria | 1006 |
| 240 | Ga0207706_10367160 | 3300025933 | Bacteria | 1250 |
| 241 | Ga0207709_10338180 | 3300025935 | Bacteria | 1132 |
| 242 | Ga0207670_10013183 | 3300025936 | Bacteria | 4864 |
| 243 | Ga0207670_10051690 | 3300025936 | Bacteria | 2760 |
| 244 | Ga0207670_10060659 | 3300025936 | Bacteria | 2578 |
| 245 | Ga0207670_10270796 | 3300025936 | Bacteria | 1320 |
| 246 | Ga0207669_10009321 | 3300025937 | Bacteria | 4668 |
| 247 | Ga0207704_10486414 | 3300025938 | Bacteria | 992 |
| 248 | Ga0207665_10000176 | 3300025939 | Bacteria | 42953 |
| 249 | Ga0207665_10058247 | 3300025939 | Bacteria | 2611 |
| 250 | Ga0207665_10098532 | 3300025939 | Bacteria | 2037 |
| 251 | Ga0207691_10387791 | 3300025940 | Bacteria | 1192 |
| 252 | Ga0207711_10096831 | 3300025941 | Bacteria | 2604 |
| 253 | Ga0207711_10260741 | 3300025941 | Bacteria | 1593 |
| 254 | Ga0207689_10065680 | 3300025942 | Bacteria | 2984 |
| 255 | Ga0207689_10447755 | 3300025942 | Bacteria | 1079 |
| 256 | Ga0207661_10348936 | 3300025944 | Bacteria | 1335 |
| 257 | Ga0207679_10001790 | 3300025945 | Bacteria | 13372 |
| 258 | Ga0207679_10880911 | 3300025945 | Bacteria | 818 |
| 259 | Ga0207667_10000302 | 3300025949 | Bacteria | 68245 |
| 260 | Ga0207667_10027794 | 3300025949 | Bacteria | 6152 |
| 261 | Ga0207667_10169733 | 3300025949 | Bacteria | 2242 |
| 262 | Ga0207667_10767741 | 3300025949 | Bacteria | 962 |
| 263 | Ga0207651_10058532 | 3300025960 | Bacteria | 2664 |
| 264 | Ga0207651_10196936 | 3300025960 | Bacteria | 1611 |
| 265 | Ga0207651_10576133 | 3300025960 | Bacteria | 981 |
| 266 | Ga0207640_10002615 | 3300025981 | Bacteria | 9649 |
| 267 | Ga0207658_10613866 | 3300025986 | Bacteria | 978 |
| 268 | Ga0207677_10168654 | 3300026023 | Bacteria | 1709 |
| 269 | Ga0207677_10494213 | 3300026023 | Bacteria | 1056 |
| 270 | Ga0207703_10001842 | 3300026035 | Bacteria | 18897 |
| 271 | Ga0207703_10063941 | 3300026035 | Bacteria | 3018 |
| 272 | Ga0207703_10382842 | 3300026035 | Bacteria | 1302 |
| 273 | Ga0207639_10020277 | 3300026041 | Bacteria | 4756 |
| 274 | Ga0207639_10032909 | 3300026041 | Bacteria | 3821 |
| 275 | Ga0207639_10049051 | 3300026041 | Bacteria | 3199 |
| 276 | Ga0207678_10089478 | 3300026067 | Bacteria | 2631 |
| 277 | Ga0207708_10527882 | 3300026075 | Bacteria | 993 |
| 278 | Ga0207702_10000120 | 3300026078 | Bacteria | 91853 |
| 279 | Ga0207702_10029438 | 3300026078 | Bacteria | 4570 |
| 280 | Ga0207641_10054475 | 3300026088 | Bacteria | 3394 |
| 281 | Ga0207648_10015149 | 3300026089 | Bacteria | 7097 |
| 282 | Ga0207676_10009792 | 3300026095 | Bacteria | 6815 |
| 283 | Ga0207676_10277223 | 3300026095 | Bacteria | 1521 |
| 284 | Ga0207676_10709904 | 3300026095 | Bacteria | 975 |
| 285 | Ga0207674_10000056 | 3300026116 | Bacteria | 113265 |
| 286 | Ga0207674_10010860 | 3300026116 | Bacteria | 10264 |
| 287 | Ga0207674_10017511 | 3300026116 | Bacteria | 7816 |
| 288 | Ga0207674_10230429 | 3300026116 | Bacteria | 1800 |
| 289 | Ga0207675_100411525 | 3300026118 | Bacteria | 1334 |
| 290 | Ga0207683_10303045 | 3300026121 | Bacteria | 1462 |
| 291 | Ga0207698_10349755 | 3300026142 | Bacteria | 1395 |
| 292 | Ga0209983_1024125 | 3300027665 | Bacteria | 1279 |
| 293 | Ga0209282_1000098 | 3300027666 | Bacteria | 59778 |
| 294 | Ga0209971_1007986 | 3300027682 | Bacteria | 2511 |
| 295 | Ga0209971_1011013 | 3300027682 | Bacteria | 2142 |
| 296 | Ga0209974_10089991 | 3300027876 | Bacteria | 1063 |
| 297 | Ga0265354_1000063 | 3300028016 | Bacteria | 17788 |
| 298 | Ga0265354_1000477 | 3300028016 | Bacteria | 6956 |
| 299 | Ga0268266_10000276 | 3300028379 | Bacteria | 84981 |
| 300 | Ga0268266_10088967 | 3300028379 | Bacteria | 2703 |
| 301 | Ga0268265_10025728 | 3300028380 | Bacteria | 4181 |
| 302 | Ga0268264_10003976 | 3300028381 | Bacteria | 12651 |
| 303 | Ga0265337_1000495 | 3300028556 | Bacteria | 20897 |
| 304 | Ga0265323_10009931 | 3300028653 | Bacteria | 3872 |
| 305 | Ga0265322_10016111 | 3300028654 | Bacteria | 2159 |
| 306 | Ga0307515_10006236 | 3300028794 | Bacteria | 23940 |
| 307 | Ga0265770_1003281 | 3300030878 | Bacteria | 2196 |
| 308 | Ga0265760_10004504 | 3300031090 | Bacteria | 3997 |
| 309 | Ga0265760_10030405 | 3300031090 | Bacteria | 1590 |
| 310 | Ga0265760_10092412 | 3300031090 | Bacteria | 949 |
| 311 | Ga0265320_10000103 | 3300031240 | Bacteria | 72829 |
| 312 | Ga0265320_10088363 | 3300031240 | Bacteria | 1438 |
| 313 | Ga0265325_10051040 | 3300031241 | Bacteria | 2127 |
| 314 | Ga0265340_10002512 | 3300031247 | Bacteria | 10425 |
| 315 | Ga0265340_10050806 | 3300031247 | Bacteria | 2010 |
| 316 | Ga0265340_10122830 | 3300031247 | Bacteria | 1194 |
| 317 | Ga0265339_10039977 | 3300031249 | Bacteria | 2608 |
| 318 | Ga0265331_10018561 | 3300031250 | Bacteria | 3604 |
| 319 | Ga0265316_10003477 | 3300031344 | Bacteria | 15920 |
| 320 | Ga0265316_10013849 | 3300031344 | Bacteria | 7141 |
| 321 | Ga0265316_10082071 | 3300031344 | Bacteria | 2471 |
| 322 | Ga0307509_10000007 | 3300031507 | Bacteria | 409278 |
| 323 | Ga0307509_10037472 | 3300031507 | Bacteria | 5301 |
| 324 | Ga0307408_100424901 | 3300031548 | Bacteria | 1147 |
| 325 | Ga0307408_100607909 | 3300031548 | Bacteria | 972 |
| 326 | Ga0265313_10030041 | 3300031595 | Bacteria | 2803 |
| 327 | Ga0265313_10038206 | 3300031595 | Bacteria | 2393 |
| 328 | Ga0307508_10013489 | 3300031616 | Bacteria | 7475 |
| 329 | Ga0316579_10010076 | 3300031691 | Bacteria | 3986 |
| 330 | Ga0265314_10001239 | 3300031711 | Bacteria | 29122 |
| 331 | Ga0265314_10199746 | 3300031711 | Bacteria | 1183 |
| 332 | Ga0265342_10001720 | 3300031712 | Bacteria | 20028 |
| 333 | Ga0265342_10006613 | 3300031712 | Bacteria | 8608 |
| 334 | Ga0265342_10014169 | 3300031712 | Bacteria | 5304 |
| 335 | Ga0316576_10260484 | 3300031727 | Bacteria | 1301 |
| 336 | Ga0316576_10372833 | 3300031727 | Bacteria | 1060 |
| 337 | Ga0316578_10002833 | 3300031728 | Bacteria | 7755 |
| 338 | Ga0307516_10020750 | 3300031730 | Bacteria | 6783 |
| 339 | Ga0307405_10023943 | 3300031731 | Bacteria | 3480 |
| 340 | Ga0307405_10055092 | 3300031731 | Bacteria | 2487 |
| 341 | Ga0307405_10499163 | 3300031731 | Bacteria | 975 |
| 342 | Ga0307410_10019800 | 3300031852 | Bacteria | 4102 |
| 343 | Ga0307410_10274933 | 3300031852 | Bacteria | 1319 |
| 344 | Ga0307406_10012037 | 3300031901 | Bacteria | 4922 |
| 345 | Ga0307406_10075958 | 3300031901 | Bacteria | 2218 |
| 346 | Ga0307406_10190364 | 3300031901 | Bacteria | 1501 |
| 347 | Ga0307407_10169949 | 3300031903 | Bacteria | 1435 |
| 348 | Ga0307412_10000235 | 3300031911 | Bacteria | 36152 |
| 349 | Ga0307412_10034346 | 3300031911 | Bacteria | 3232 |
| 350 | Ga0307412_10051675 | 3300031911 | Bacteria | 2717 |
| 351 | Ga0307412_10176353 | 3300031911 | Bacteria | 1603 |
| 352 | Ga0307412_10369940 | 3300031911 | Bacteria | 1157 |
| 353 | Ga0307412_10449133 | 3300031911 | Bacteria | 1062 |
| 354 | Ga0307409_100135520 | 3300031995 | Bacteria | 2112 |
| 355 | Ga0307409_100539916 | 3300031995 | Bacteria | 1143 |
| 356 | Ga0307409_100643531 | 3300031995 | Bacteria | 1053 |
| 357 | Ga0307416_100002923 | 3300032002 | Bacteria | 9956 |
| 358 | Ga0307416_100158591 | 3300032002 | Bacteria | 2087 |
| 359 | Ga0307416_100625402 | 3300032002 | Bacteria | 1159 |
| 360 | Ga0307414_10451508 | 3300032004 | Bacteria | 1127 |
| 361 | Ga0307411_10114212 | 3300032005 | Bacteria | 1940 |
| 362 | Ga0307415_100118006 | 3300032126 | Bacteria | 1983 |
| 363 | Ga0316583_10014321 | 3300032133 | Bacteria | 2860 |
| 364 | Ga0316593_10003223 | 3300032168 | Bacteria | 4012 |
| 365 | Ga0373949_0016852 | 3300035090 | Bacteria | 1642 |
| 366 | Ga0373923_0021658 | 3300035111 | Bacteria | 2512 |
| 367 | Ga0373945_0150316 | 3300035116 | Bacteria | 944 |
| 368 | Ga0373953_0200678 | 3300035117 | Bacteria | 863 |
| 369 | Ga0373954_0050841 | 3300035118 | Bacteria | 1945 |
| 370 | Ga0373954_0243177 | 3300035118 | Bacteria | 885 |
| 371 | Ga0373956_0161424 | 3300035119 | Bacteria | 1056 |
| 372 | Ga0373943_0155445 | 3300035170 | Bacteria | 1242 |
| 373 | Ga0373946_0118360 | 3300035171 | Bacteria | 1207 |
| 374 | Ga0373961_0000022 | 3300035241 | Bacteria | 99478 |
| 375 | Ga0373931_0044351 | 3300035691 | Bacteria | 2345 |
| 376 | Ga0373935_0136145 | 3300035692 | Bacteria | 1655 |
| 377 | Ga0373935_0332610 | 3300035692 | Bacteria | 1080 |
| 378 | Ga0373927_0212464 | 3300035695 | Bacteria | 1271 |
| 379 | Ga0373947_0009228 | 3300035725 | Bacteria | 5670 |
| 380 | Ga0373947_0374073 | 3300035725 | Bacteria | 958 |
| 381 | Ga0373937_0012388 | 3300036401 | Bacteria | 7499 |
| 382 | Ga0373937_0153780 | 3300036401 | Bacteria | 2156 |
| 383 | Ga0373937_0484964 | 3300036401 | Bacteria | 1174 |
| 384 | Ga0316582_0018694 | 3300036647 | Bacteria | 4039 |
| 385 | Ga0316584_0129768 | 3300036712 | Bacteria | 1883 |
| 386 | Ga0373925_0002554 | 3300037068 | Bacteria | 14495 |
| 387 | Ga0395899_0006462 | 3300037312 | Bacteria | 9081 |
| 388 | Ga0395899_0155719 | 3300037312 | Bacteria | 1617 |
| 389 | Ga0395900_0018716 | 3300037418 | Bacteria | 7063 |
| 390 | Ga0395900_0021784 | 3300037418 | Bacteria | 6553 |
| 391 | Ga0395900_0037480 | 3300037418 | Bacteria | 4999 |
| 392 | Ga0395900_0522234 | 3300037418 | Bacteria | 1135 |
| 393 | Ga0395898_0048364 | 3300037466 | Bacteria | 4171 |
| 394 | Ga0395905_0036015 | 3300037471 | Bacteria | 4647 |
| 395 | Ga0395905_0540977 | 3300037471 | Bacteria | 1066 |
| 396 | Ga0316581_0006167 | 3300037588 | Bacteria | 3159 |
| 397 | Ga0436364_0173605 | 3300037853 | Bacteria | 6482 |
| 398 | Ga0395901_0003336 | 3300038443 | Bacteria | 16173 |
| 399 | Ga0395901_0458091 | 3300038443 | Bacteria | 1303 |
| 400 | Ga0400483_003250 | 3300039062 | Bacteria | 7949 |
| 401 | Ga0400483_218392 | 3300039062 | Bacteria | 1065 |
| 402 | Ga0436365_0252180 | 3300039437 | Bacteria | 6751 |
| 403 | Ga0436365_0694215 | 3300039437 | Bacteria | 3899 |
| 404 | Ga0436365_1272561 | 3300039437 | Bacteria | 17734 |
| 405 | Ga0436360_0394835 | 3300039438 | Bacteria | 1392 |
| 406 | Ga0436360_0994159 | 3300039438 | Bacteria | 1992 |
| 407 | Ga0436361_0121746 | 3300039447 | Bacteria | 1451 |
| 408 | Ga0436361_0386399 | 3300039447 | Bacteria | 1355 |
| 409 | Ga0436361_1142624 | 3300039447 | Bacteria | 3810 |
| 410 | Ga0436362_0680558 | 3300039453 | Bacteria | 831 |
| 411 | Ga0436362_0870707 | 3300039453 | Bacteria | 1015 |
| 412 | Ga0451797_1494958 | 3300041453 | Bacteria | 2026 |
| 413 | Ga0451837_0363295 | 3300041494 | Bacteria | 1002 |
| 414 | Ga0451843_0385278 | 3300041509 | Bacteria | 2082 |
| 415 | Ga0451853_2377865 | 3300041512 | Bacteria | 5550 |
| 416 | Ga0439451_027425 | 3300042009 | Bacteria | 1148 |
| 417 | Ga0439459_0025286 | 3300042438 | Bacteria | 1171 |
| 418 | Ga0439460_0047890 | 3300042461 | Bacteria | 1274 |
| 419 | Ga0466965_0010250 | 3300044683 | Bacteria | 4366 |
| 420 | Ga0451576_0086375 | 3300045051 | Bacteria | 3263 |
| 421 | Ga0466967_0278983 | 3300045976 | Bacteria | 1603 |
| 422 | Ga0466967_0428636 | 3300045976 | Bacteria | 1290 |
| 423 | Ga0495651_0176181 | 3300046462 | Bacteria | 1518 |
| 424 | Ga0495651_0284323 | 3300046462 | Bacteria | 1116 |
| 425 | Ga0495653_0020662 | 3300046463 | Bacteria | 5334 |
| 426 | Ga0495580_0008165 | 3300046472 | Bacteria | 8339 |
| 427 | Ga0495580_0144653 | 3300046472 | Bacteria | 1648 |
| 428 | Ga0495580_0279016 | 3300046472 | Bacteria | 1140 |
| 429 | Ga0495605_0002172 | 3300046474 | Bacteria | 12251 |
| 430 | Ga0495664_0084305 | 3300046477 | Bacteria | 1907 |
| 431 | Ga0495664_0309053 | 3300046477 | Bacteria | 954 |
| 432 | Ga0495596_0000145 | 3300046500 | Bacteria | 48986 |
| 433 | Ga0495607_0000021 | 3300046501 | Bacteria | 164571 |
| 434 | Ga0495607_0003718 | 3300046501 | Bacteria | 11564 |
| 435 | Ga0495608_0019310 | 3300046511 | Bacteria | 4692 |
| 436 | Ga0495610_0000358 | 3300046512 | Bacteria | 47626 |
| 437 | Ga0495616_0010431 | 3300046513 | Bacteria | 5377 |
| 438 | Ga0495628_0027367 | 3300046516 | Bacteria | 4641 |
| 439 | Ga0495628_0064494 | 3300046516 | Bacteria | 2868 |
| 440 | Ga0495630_0334410 | 3300046517 | Bacteria | 1158 |
| 441 | Ga0495630_0397676 | 3300046517 | Bacteria | 1056 |
| 442 | Ga0495643_0032426 | 3300046522 | Bacteria | 2900 |
| 443 | Ga0495644_0047069 | 3300046523 | Bacteria | 1621 |
| 444 | Ga0495648_0024963 | 3300046524 | Bacteria | 4057 |
| 445 | Ga0495652_0028644 | 3300046529 | Bacteria | 4899 |
| 446 | Ga0495652_0158598 | 3300046529 | Bacteria | 1759 |
| 447 | Ga0495640_0173793 | 3300046533 | Bacteria | 1376 |
| 448 | Ga0495587_0017739 | 3300046536 | Bacteria | 4419 |
| 449 | Ga0495609_0009934 | 3300046538 | Bacteria | 4585 |
| 450 | Ga0495597_0053502 | 3300046542 | Bacteria | 1775 |
| 451 | Ga0495645_0021685 | 3300046543 | Bacteria | 4643 |
| 452 | Ga0495645_0058901 | 3300046543 | Bacteria | 2786 |
| 453 | Ga0495667_0005798 | 3300046559 | Bacteria | 8369 |
| 454 | Ga0495667_0039080 | 3300046559 | Bacteria | 3158 |
| 455 | Ga0495635_0045907 | 3300046663 | Bacteria | 3014 |
| 456 | Ga0495635_0079796 | 3300046663 | Bacteria | 2240 |
| 457 | Ga0495661_0011823 | 3300046665 | Bacteria | 5912 |
| 458 | Ga0495623_0013926 | 3300046679 | Bacteria | 5214 |
| 459 | Ga0495623_0194226 | 3300046679 | Bacteria | 1171 |
| 460 | Ga0495646_0035343 | 3300046680 | Bacteria | 3100 |
| 461 | Ga0495658_0124084 | 3300046683 | Bacteria | 1565 |
| 462 | Ga0495669_0182712 | 3300046684 | Bacteria | 1000 |
| 463 | Ga0495671_0006024 | 3300046692 | Bacteria | 7046 |
| 464 | Ga0495649_0009020 | 3300046694 | Bacteria | 5955 |
| 465 | Ga0495589_0097158 | 3300046794 | Bacteria | 1427 |
| 466 | Ga0495600_0006876 | 3300046809 | Bacteria | 6936 |
| 467 | Ga0495604_0001357 | 3300047317 | Bacteria | 20014 |
| 468 | Ga0495604_0154369 | 3300047317 | Bacteria | 1628 |
| 469 | Ga0495604_0223049 | 3300047317 | Bacteria | 1297 |
| 470 | Ga0495604_0265529 | 3300047317 | Bacteria | 1165 |
| 471 | Ga0495674_0016327 | 3300047319 | Bacteria | 6922 |
| 472 | Ga0495674_0137091 | 3300047319 | Bacteria | 2058 |
| 473 | Ga0495674_0321300 | 3300047319 | Bacteria | 1261 |
| 474 | Ga0495672_0003805 | 3300047320 | Bacteria | 12705 |
| 475 | Ga0495680_0021296 | 3300047322 | Bacteria | 5430 |
| 476 | Ga0495680_0071200 | 3300047322 | Bacteria | 2648 |
| 477 | Ga0495675_0002040 | 3300047444 | Bacteria | 12084 |
| 478 | Ga0495675_0177658 | 3300047444 | Bacteria | 1305 |
| 479 | Ga0495675_0237251 | 3300047444 | Bacteria | 1099 |
| 480 | Ga0495675_0442897 | 3300047444 | Bacteria | 752 |
| 481 | Ga0495685_002240 | 3300047447 | Bacteria | 6026 |
| 482 | Ga0495684_0009756 | 3300047471 | Bacteria | 7409 |
| 483 | Ga0496100_0278906 | 3300048903 | Bacteria | 1245 |
| 484 | Ga0496101_0192624 | 3300048904 | Bacteria | 1574 |
| 485 | Ga0496101_0374066 | 3300048904 | Bacteria | 1120 |
| 486 | Ga0496103_0352455 | 3300048906 | Bacteria | 946 |
| 487 | Ga0496104_0061218 | 3300048907 | Bacteria | 3568 |
| 488 | Ga0496108_0070791 | 3300048911 | Bacteria | 2943 |
| 489 | Ga0496109_0040990 | 3300048912 | Bacteria | 4195 |
| 490 | Ga0496109_0096858 | 3300048912 | Bacteria | 2734 |
| 491 | Ga0496109_0193284 | 3300048912 | Bacteria | 1912 |
| 492 | Ga0496110_0016748 | 3300048913 | Bacteria | 6124 |
| 493 | Ga0496110_0088480 | 3300048913 | Bacteria | 2766 |
| 494 | Ga0496110_0096586 | 3300048913 | Bacteria | 2648 |
| 495 | Ga0496111_0042537 | 3300048914 | Bacteria | 3263 |
| 496 | Ga0496112_0004054 | 3300048915 | Bacteria | 12292 |
| 497 | Ga0496112_0018421 | 3300048915 | Bacteria | 6574 |
| 498 | Ga0496114_0079493 | 3300048917 | Bacteria | 2768 |
| 499 | Ga0496114_0104925 | 3300048917 | Bacteria | 2417 |
| 500 | Ga0496115_0227301 | 3300048918 | Bacteria | 1539 |
| 501 | Ga0496115_0293825 | 3300048918 | Bacteria | 1332 |
| 502 | Ga0496116_0009306 | 3300048919 | Bacteria | 8393 |
| 503 | Ga0496116_0013463 | 3300048919 | Bacteria | 6593 |
| 504 | Ga0496119_0059557 | 3300048922 | Bacteria | 2293 |
| 505 | Ga0496121_0000444 | 3300048924 | Bacteria | 81596 |
| 506 | Ga0496121_0023152 | 3300048924 | Bacteria | 5996 |
| 507 | Ga0496122_0006772 | 3300048925 | Bacteria | 13028 |
| 508 | Ga0496122_0234301 | 3300048925 | Bacteria | 1041 |
| 509 | Ga0496123_0001730 | 3300048926 | Bacteria | 28930 |
| 510 | Ga0496123_0022278 | 3300048926 | Bacteria | 4889 |
| 511 | Ga0496124_0038248 | 3300048927 | Bacteria | 4168 |
| 512 | Ga0496125_0203949 | 3300048928 | Bacteria | 1291 |
| 513 | Ga0496126_0127385 | 3300048929 | Bacteria | 2202 |
| 514 | Ga0501299_046320 | 3300049522 | Bacteria | 887 |
| 515 | Ga0501031_0082131 | 3300049568 | Bacteria | 2101 |
| 516 | Ga0501033_0137498 | 3300049570 | Bacteria | 1768 |
| 517 | Ga0501033_0165082 | 3300049570 | Bacteria | 1592 |
| 518 | Ga0501034_0002554 | 3300049571 | Bacteria | 21716 |
| 519 | Ga0501034_0167837 | 3300049571 | Bacteria | 2163 |
| 520 | Ga0501034_0581888 | 3300049571 | Bacteria | 1026 |
| 521 | Ga0501036_0007624 | 3300049572 | Bacteria | 8833 |
| 522 | Ga0501036_0107404 | 3300049572 | Bacteria | 2360 |
| 523 | Ga0501038_0007405 | 3300049574 | Bacteria | 10124 |
| 524 | Ga0501038_0285638 | 3300049574 | Bacteria | 1298 |
| 525 | Ga0501038_0362381 | 3300049574 | Bacteria | 1127 |
| 526 | Ga0501039_0060821 | 3300049575 | Bacteria | 2925 |
| 527 | Ga0501039_0160290 | 3300049575 | Bacteria | 1768 |
| 528 | Ga0501039_0215325 | 3300049575 | Bacteria | 1510 |
| 529 | Ga0501040_0029705 | 3300049576 | Bacteria | 3690 |
| 530 | Ga0501040_0035020 | 3300049576 | Bacteria | 3403 |
| 531 | Ga0501040_0084392 | 3300049576 | Bacteria | 2203 |
| 532 | Ga0501040_0085010 | 3300049576 | Bacteria | 2196 |
| 533 | Ga0501040_0494333 | 3300049576 | Bacteria | 882 |
| 534 | Ga0501040_0508115 | 3300049576 | Bacteria | 869 |
| 535 | Ga0501041_0010800 | 3300049577 | Bacteria | 5386 |
| 536 | Ga0501041_0119548 | 3300049577 | Bacteria | 1637 |
| 537 | Ga0501041_0139203 | 3300049577 | Bacteria | 1513 |
| 538 | Ga0501042_0030504 | 3300049578 | Bacteria | 3808 |
| 539 | Ga0501042_0180209 | 3300049578 | Bacteria | 1524 |
| 540 | Ga0501043_0090508 | 3300049579 | Bacteria | 2406 |
| 541 | Ga0501043_0102700 | 3300049579 | Bacteria | 2247 |
| 542 | Ga0501043_0158217 | 3300049579 | Bacteria | 1771 |
| 543 | Ga0501046_0148131 | 3300049580 | Bacteria | 1772 |
| 544 | Ga0501046_0180016 | 3300049580 | Bacteria | 1581 |
| 545 | Ga0501046_0273090 | 3300049580 | Bacteria | 1240 |
| 546 | Ga0501047_0012523 | 3300049581 | Bacteria | 8033 |
| 547 | Ga0501048_0021038 | 3300049582 | Bacteria | 4779 |
| 548 | Ga0501048_0049581 | 3300049582 | Bacteria | 2992 |
| 549 | Ga0501048_0116522 | 3300049582 | Bacteria | 1887 |
| 550 | Ga0501067_0139523 | 3300049583 | Bacteria | 1350 |
| 551 | Ga0501067_0235638 | 3300049583 | Bacteria | 1018 |
| 552 | Ga0501068_0035178 | 3300049584 | Bacteria | 2989 |
| 553 | Ga0501069_0407516 | 3300049585 | Bacteria | 805 |
| 554 | Ga0501070_0095803 | 3300049586 | Bacteria | 2455 |
| 555 | Ga0501071_0034529 | 3300049587 | Bacteria | 3600 |
| 556 | Ga0501071_0280674 | 3300049587 | Bacteria | 1260 |
| 557 | Ga0501072_0000978 | 3300049588 | Bacteria | 21105 |
| 558 | Ga0501072_0011768 | 3300049588 | Bacteria | 6683 |
| 559 | Ga0501072_0016152 | 3300049588 | Bacteria | 5726 |
| 560 | Ga0501072_0029570 | 3300049588 | Bacteria | 4281 |
| 561 | Ga0501073_0002116 | 3300049589 | Bacteria | 14879 |
| 562 | Ga0501073_0040672 | 3300049589 | Bacteria | 3288 |
| 563 | Ga0501073_0077868 | 3300049589 | Bacteria | 2307 |
| 564 | Ga0501074_0040093 | 3300049590 | Bacteria | 3392 |
| 565 | Ga0501074_0058878 | 3300049590 | Bacteria | 2768 |
| 566 | Ga0501074_0068939 | 3300049590 | Bacteria | 2543 |
| 567 | Ga0501074_0145349 | 3300049590 | Bacteria | 1696 |
| 568 | Ga0501075_0000016 | 3300049591 | Bacteria | 70964 |
| 569 | Ga0501075_0030254 | 3300049591 | Bacteria | 4010 |
| 570 | Ga0501075_0157761 | 3300049591 | Bacteria | 1730 |
| 571 | Ga0501075_0498687 | 3300049591 | Bacteria | 929 |
| 572 | Ga0501076_0000053 | 3300049592 | Bacteria | 56853 |
| 573 | Ga0501076_0029073 | 3300049592 | Bacteria | 4296 |
| 574 | Ga0501076_0106481 | 3300049592 | Bacteria | 2264 |
| 575 | Ga0501077_0032712 | 3300049593 | Bacteria | 3311 |
| 576 | Ga0501077_0130106 | 3300049593 | Bacteria | 1596 |
| 577 | Ga0501202_060960 | 3300049652 | Bacteria | 853 |
| 578 | Ga0501225_0022612 | 3300049705 | Bacteria | 1736 |
| 579 | Ga0501079_0006500 | 3300049741 | Bacteria | 8780 |
| 580 | Ga0501079_0079549 | 3300049741 | Bacteria | 2535 |
| 581 | Ga0501080_0008305 | 3300049742 | Bacteria | 9406 |
| 582 | Ga0501080_0019084 | 3300049742 | Bacteria | 6348 |
| 583 | Ga0501080_0029008 | 3300049742 | Bacteria | 5151 |
| 584 | Ga0501081_0015484 | 3300049743 | Bacteria | 5033 |
| 585 | Ga0501083_0034475 | 3300049744 | Bacteria | 3461 |
| 586 | Ga0501083_0071378 | 3300049744 | Bacteria | 2309 |
| 587 | Ga0501083_0113371 | 3300049744 | Bacteria | 1781 |
| 588 | Ga0501083_0134277 | 3300049744 | Bacteria | 1622 |
| 589 | Ga0501083_0193302 | 3300049744 | Bacteria | 1328 |
| 590 | Ga0501263_000676 | 3300049760 | Bacteria | 2766 |
| 591 | Ga0501035_0097702 | 3300049822 | Bacteria | 2579 |
| 592 | Ga0501035_0162732 | 3300049822 | Bacteria | 1931 |
| 593 | Ga0501035_0477033 | 3300049822 | Bacteria | 1029 |
| 594 | Ga0501044_0250617 | 3300049823 | Bacteria | 1712 |
| 595 | Ga0501044_0515417 | 3300049823 | Bacteria | 1096 |
| 596 | Ga0501045_0006931 | 3300049824 | Bacteria | 7854 |
| 597 | Ga0501045_0095850 | 3300049824 | Bacteria | 2195 |
| 598 | Ga0501045_0330323 | 3300049824 | Bacteria | 1135 |
| 599 | nmdc:mga03683_1487_c1 | 3300050489 | Bacteria | 5363 |
| 600 | nmdc:mga03683_35731_c1 | 3300050489 | Bacteria | 2017 |
| 601 | nmdc:mga0yw44_41216_c1 | 3300050492 | Bacteria | 2748 |
| 602 | nmdc:mga0yw44_421452_c1 | 3300050492 | Bacteria | 904 |
| 603 | nmdc:mga0k408_12193_c1 | 3300050493 | Bacteria | 4696 |
| 604 | nmdc:mga06z11_92906_c1 | 3300050494 | Bacteria | 1641 |
| 605 | nmdc:mga07m45_238987_c1 | 3300050496 | Bacteria | 1057 |
| 606 | nmdc:mga05p37_440602_c1 | 3300050507 | Bacteria | 1511 |
| 607 | nmdc:mga09592_155995_c1 | 3300050508 | Bacteria | 1971 |
| 608 | nmdc:mga09592_30572_c1 | 3300050508 | Bacteria | 4482 |
| 609 | nmdc:mga0qj67_21225_c1 | 3300050509 | Bacteria | 4981 |
| 610 | nmdc:mga0qj67_7968_c1 | 3300050509 | Bacteria | 7832 |
| 611 | nmdc:mga06r32_11919_c1 | 3300050510 | Bacteria | 7832 |
| 612 | nmdc:mga06r32_306167_c1 | 3300050510 | Bacteria | 1574 |
| 613 | nmdc:mga08y16_173588_c1 | 3300050511 | Bacteria | 2238 |
| 614 | nmdc:mga08y16_246637_c1 | 3300050511 | Bacteria | 1845 |
| 615 | nmdc:mga0rr50_90355_c1 | 3300050513 | Bacteria | 2383 |
| 616 | nmdc:mga0sz30_34794_c1 | 3300050516 | Bacteria | 2099 |
| 617 | nmdc:mga0sz30_5521_c1 | 3300050516 | Bacteria | 4644 |
| 618 | Ga0495655_0007617 | 3300053083 | Bacteria | 2021 |
| 619 | Ga0495619_0064799 | 3300053085 | Bacteria | 2437 |
| 620 | Ga0500646_0020747 | 3300053090 | Bacteria | 1747 |
| 621 | Ga0500647_0110488 | 3300053091 | Bacteria | 1307 |
| 622 | Ga0500651_0312097 | 3300053093 | Bacteria | 900 |
| 623 | Ga0500566_0050094 | 3300053094 | Bacteria | 2392 |
| 624 | Ga0500566_0053384 | 3300053094 | Bacteria | 2307 |
| 625 | Ga0500640_000889 | 3300053095 | Bacteria | 8318 |
| 626 | Ga0500554_002959 | 3300053102 | Bacteria | 3409 |
| 627 | Ga0500572_005566 | 3300053111 | Bacteria | 2860 |
| 628 | Ga0500595_000089 | 3300053119 | Bacteria | 63090 |
| 629 | Ga0500597_005808 | 3300053120 | Bacteria | 4027 |
| 630 | Ga0500597_034137 | 3300053120 | Bacteria | 2110 |
| 631 | Ga0500614_000332 | 3300053123 | Bacteria | 12218 |
| 632 | Ga0500559_0048966 | 3300053136 | Bacteria | 1860 |
| 633 | Ga0500579_185961 | 3300053143 | Bacteria | 805 |
| 634 | Ga0500616_0039346 | 3300053153 | Bacteria | 2550 |
| 635 | Ga0500622_0012471 | 3300053156 | Bacteria | 4601 |
| 636 | Ga0500627_0101327 | 3300053158 | Bacteria | 1293 |
| 637 | Ga0500636_0039454 | 3300053177 | Bacteria | 2793 |
| 638 | Ga0500636_0106683 | 3300053177 | Bacteria | 1587 |
| 639 | Ga0501084_0007936 | 3300054114 | Bacteria | 8740 |
| 640 | Ga0501084_0012556 | 3300054114 | Bacteria | 7018 |
| 641 | Ga0501084_0209126 | 3300054114 | Bacteria | 1646 |
| 642 | Ga0501084_0299783 | 3300054114 | Bacteria | 1357 |
| 643 | Ga0501084_0892605 | 3300054114 | Bacteria | 748 |
| 644 | Ga0501082_0007898 | 3300060353 | Bacteria | 9186 |
| 645 | Ga0501082_0144165 | 3300060353 | Bacteria | 2067 |
| 646 | Ga0501082_0248973 | 3300060353 | Bacteria | 1546 |
| 647 | Ga0530510_0000002 | 3300061734 | Bacteria | 284155 |
| 648 | Ga0530510_0007581 | 3300061734 | Bacteria | 7560 |
| 649 | Ga0530510_0047889 | 3300061734 | Bacteria | 3089 |
| 650 | Ga0530510_0243775 | 3300061734 | Bacteria | 1338 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025936 | Ga0207670_10270796 | Ga0207670_102707962 | 191 |
| 2 | 3300053094 | Ga0500566_0053384 | Ga0500566_0053384_664_1260 | 196 |
| 3 | 3300049576 | Ga0501040_0494333 | Ga0501040_0494333_248_850 | 198 |
| 4 | 3300049583 | Ga0501067_0139523 | Ga0501067_0139523_682_1287 | 198 |
| 5 | 3300035117 | Ga0373953_0200678 | Ga0373953_0200678_15_782 | 200 |
| 6 | 3300005458 | Ga0070681_10024461 | Ga0070681_100244616 | 216 |
| 7 | 3300053094 | Ga0500566_0050094 | Ga0500566_0050094_990_1691 | 216 |
| 8 | 3300053095 | Ga0500640_000889 | Ga0500640_000889_2433_3134 | 216 |
| 9 | 3300053102 | Ga0500554_002959 | Ga0500554_002959_1953_2654 | 216 |
| 10 | 3300053111 | Ga0500572_005566 | Ga0500572_005566_489_1190 | 216 |
| 11 | 3300053119 | Ga0500595_000089 | Ga0500595_000089_30734_31435 | 216 |
| 12 | 3300053120 | Ga0500597_034137 | Ga0500597_034137_454_1155 | 216 |
| 13 | 3300053123 | Ga0500614_000332 | Ga0500614_000332_613_1314 | 216 |
| 14 | 3300053136 | Ga0500559_0048966 | Ga0500559_0048966_746_1447 | 216 |
| 15 | 3300005435 | Ga0070714_100662021 | Ga0070714_1006620212 | 219 |
| 16 | 3300005436 | Ga0070713_100821324 | Ga0070713_1008213241 | 219 |
| 17 | 3300005445 | Ga0070708_100036904 | Ga0070708_1000369042 | 219 |
| 18 | 3300005468 | Ga0070707_100013355 | Ga0070707_1000133554 | 219 |
| 19 | 3300005468 | Ga0070707_100176507 | Ga0070707_1001765073 | 219 |
| 20 | 3300005471 | Ga0070698_100004028 | Ga0070698_10000402812 | 219 |
| 21 | 3300005536 | Ga0070697_100005154 | Ga0070697_1000051548 | 219 |
| 22 | 3300025922 | Ga0207646_10103448 | Ga0207646_101034482 | 219 |
| 23 | 3300025922 | Ga0207646_10358220 | Ga0207646_103582202 | 219 |
| 24 | 3300025929 | Ga0207664_10552658 | Ga0207664_105526582 | 219 |
| 25 | 3300025939 | Ga0207665_10098532 | Ga0207665_100985322 | 219 |
| 26 | 3300031240 | Ga0265320_10088363 | Ga0265320_100883633 | 219 |
| 27 | 3300037418 | Ga0395900_0522234 | Ga0395900_0522234_348_1019 | 219 |
| 28 | 3300037471 | Ga0395905_0540977 | Ga0395905_0540977_111_782 | 219 |
| 29 | 3300005468 | Ga0070707_100016015 | Ga0070707_1000160157 | 220 |
| 30 | 3300025910 | Ga0207684_10098467 | Ga0207684_100984672 | 220 |
| 31 | 3300025922 | Ga0207646_10013154 | Ga0207646_100131541 | 220 |
| 32 | 3300025922 | Ga0207646_10074267 | Ga0207646_100742673 | 220 |
| 33 | 3300025922 | Ga0207646_10155012 | Ga0207646_101550121 | 220 |
| 34 | 3300035116 | Ga0373945_0150316 | Ga0373945_0150316_77_832 | 220 |
| 35 | 3300035170 | Ga0373943_0155445 | Ga0373943_0155445_274_993 | 220 |
| 36 | 3300035692 | Ga0373935_0332610 | Ga0373935_0332610_18_737 | 220 |
| 37 | 3300035725 | Ga0373947_0009228 | Ga0373947_0009228_4022_4747 | 220 |
| 38 | 3300005337 | Ga0070682_100104356 | Ga0070682_1001043562 | 221 |
| 39 | 3300037418 | Ga0395900_0018716 | Ga0395900_0018716_826_1590 | 221 |
| 40 | 3300049591 | Ga0501075_0498687 | Ga0501075_0498687_45_764 | 222 |
| 41 | 3300031995 | Ga0307409_100643531 | Ga0307409_1006435312 | 223 |
| 42 | 3300032126 | Ga0307415_100118006 | Ga0307415_1001180063 | 223 |
| 43 | 3300005618 | Ga0068864_100330612 | Ga0068864_1003306122 | 224 |
| 44 | 3300007076 | Ga0075435_100100381 | Ga0075435_1001003811 | 224 |
| 45 | 3300025913 | Ga0207695_10267520 | Ga0207695_102675202 | 224 |
| 46 | 3300025941 | Ga0207711_10096831 | Ga0207711_100968313 | 224 |
| 47 | 3300025942 | Ga0207689_10447755 | Ga0207689_104477552 | 224 |
| 48 | 3300025960 | Ga0207651_10196936 | Ga0207651_101969362 | 224 |
| 49 | 3300026035 | Ga0207703_10382842 | Ga0207703_103828422 | 224 |
| 50 | 3300026095 | Ga0207676_10277223 | Ga0207676_102772233 | 224 |
| 51 | 3300026118 | Ga0207675_100411525 | Ga0207675_1004115252 | 224 |
| 52 | 3300028380 | Ga0268265_10025728 | Ga0268265_100257284 | 224 |
| 53 | 3300035111 | Ga0373923_0021658 | Ga0373923_0021658_34_756 | 224 |
| 54 | 3300035119 | Ga0373956_0161424 | Ga0373956_0161424_252_974 | 224 |
| 55 | 3300036401 | Ga0373937_0012388 | Ga0373937_0012388_1950_2672 | 224 |
| 56 | 3300037068 | Ga0373925_0002554 | Ga0373925_0002554_3155_3877 | 224 |
| 57 | 3300039062 | Ga0400483_003250 | Ga0400483_003250_4039_4719 | 224 |
| 58 | 3300046472 | Ga0495580_0279016 | Ga0495580_0279016_251_973 | 224 |
| 59 | 3300047322 | Ga0495680_0071200 | Ga0495680_0071200_1571_2266 | 224 |
| 60 | 3300048913 | Ga0496110_0096586 | Ga0496110_0096586_1522_2235 | 224 |
| 61 | 3300048914 | Ga0496111_0042537 | Ga0496111_0042537_628_1341 | 224 |
| 62 | 3300050513 | nmdc:mga0rr50_90355_c1 | nmdc:mga0rr50_90355_c1_1637_2344 | 224 |
| 63 | 3300005564 | Ga0070664_100147124 | Ga0070664_1001471243 | 225 |
| 64 | 3300006028 | Ga0070717_10046226 | Ga0070717_100462264 | 225 |
| 65 | 3300009553 | Ga0105249_10540294 | Ga0105249_105402942 | 225 |
| 66 | 3300013308 | Ga0157375_11321365 | Ga0157375_113213652 | 225 |
| 67 | 3300025938 | Ga0207704_10486414 | Ga0207704_104864142 | 225 |
| 68 | 3300025945 | Ga0207679_10880911 | Ga0207679_108809111 | 225 |
| 69 | 3300026075 | Ga0207708_10527882 | Ga0207708_105278821 | 225 |
| 70 | 3300035695 | Ga0373927_0212464 | Ga0373927_0212464_212_919 | 225 |
| 71 | 3300035725 | Ga0373947_0374073 | Ga0373947_0374073_213_920 | 225 |
| 72 | 3300046472 | Ga0495580_0144653 | Ga0495580_0144653_363_1070 | 225 |
| 73 | 3300050511 | nmdc:mga08y16_246637_c1 | nmdc:mga08y16_246637_c1_998_1705 | 225 |
| 74 | iso_pu_bacteria | 2857479173 | 2857479175 | 225 |
| 75 | iso_pu_bacteria | 2870801768 | 2870804169 | 225 |
| 76 | 3300005518 | Ga0070699_100285020 | Ga0070699_1002850202 | 226 |
| 77 | 3300005340 | Ga0070689_100031317 | Ga0070689_1000313172 | 227 |
| 78 | 3300005340 | Ga0070689_100070580 | Ga0070689_1000705802 | 227 |
| 79 | 3300005438 | Ga0070701_10015096 | Ga0070701_100150964 | 227 |
| 80 | 3300025936 | Ga0207670_10013183 | Ga0207670_100131834 | 227 |
| 81 | 3300025936 | Ga0207670_10051690 | Ga0207670_100516903 | 227 |
| 82 | 3300025942 | Ga0207689_10065680 | Ga0207689_100656803 | 227 |
| 83 | 3300028794 | Ga0307515_10006236 | Ga0307515_100062364 | 227 |
| 84 | 3300031507 | Ga0307509_10000007 | Ga0307509_10000007188 | 227 |
| 85 | 3300031507 | Ga0307509_10037472 | Ga0307509_100374723 | 227 |
| 86 | 3300031616 | Ga0307508_10013489 | Ga0307508_100134893 | 227 |
| 87 | 3300031730 | Ga0307516_10020750 | Ga0307516_100207503 | 227 |
| 88 | 3300035118 | Ga0373954_0243177 | Ga0373954_0243177_90_791 | 227 |
| 89 | 3300035241 | Ga0373961_0000022 | Ga0373961_0000022_7368_8069 | 227 |
| 90 | 3300042009 | Ga0439451_027425 | Ga0439451_027425_296_1009 | 227 |
| 91 | 3300045976 | Ga0466967_0278983 | Ga0466967_0278983_15_701 | 227 |
| 92 | 3300050494 | nmdc:mga06z11_92906_c1 | nmdc:mga06z11_92906_c1_335_1024 | 227 |
| 93 | 3300053090 | Ga0500646_0020747 | Ga0500646_0020747_294_1013 | 227 |
| 94 | 3300053120 | Ga0500597_005808 | Ga0500597_005808_2092_2793 | 227 |
| 95 | 3300053143 | Ga0500579_185961 | Ga0500579_185961_39_758 | 227 |
| 96 | 3300053177 | Ga0500636_0106683 | Ga0500636_0106683_165_866 | 227 |
| 97 | 3300054114 | Ga0501084_0892605 | Ga0501084_0892605_13_726 | 227 |
| 98 | iso_pu_bacteria | 2852677369 | 2852680604 | 227 |
| 99 | iso_pu_bacteria | 2904434214 | 2904435019 | 227 |
| 100 | 3300002772 | JGI25164J39214_1001746 | JGI25164J39214_10017462 | 228 |
| 101 | 3300003214 | JGI25165J46597_1000004 | JGI25165J46597_1000004590 | 228 |
| 102 | 3300005329 | Ga0070683_100168185 | Ga0070683_1001681853 | 228 |
| 103 | 3300005329 | Ga0070683_100508717 | Ga0070683_1005087172 | 228 |
| 104 | 3300005456 | Ga0070678_100051045 | Ga0070678_1000510453 | 228 |
| 105 | 3300006177 | Ga0075362_10021997 | Ga0075362_100219973 | 228 |
| 106 | 3300009176 | Ga0105242_10118424 | Ga0105242_101184243 | 228 |
| 107 | 3300014326 | Ga0157380_10095356 | Ga0157380_100953563 | 228 |
| 108 | 3300025231 | Ga0207427_100052 | Ga0207427_10005210 | 228 |
| 109 | 3300025233 | Ga0209437_100588 | Ga0209437_10058817 | 228 |
| 110 | 3300025261 | Ga0209233_1000001 | Ga0209233_10000011958 | 228 |
| 111 | 3300025935 | Ga0207709_10338180 | Ga0207709_103381801 | 228 |
| 112 | 3300028556 | Ga0265337_1000495 | Ga0265337_100049510 | 228 |
| 113 | 3300031240 | Ga0265320_10000103 | Ga0265320_1000010352 | 228 |
| 114 | 3300031548 | Ga0307408_100424901 | Ga0307408_1004249012 | 228 |
| 115 | 3300031711 | Ga0265314_10199746 | Ga0265314_101997462 | 228 |
| 116 | 3300031852 | Ga0307410_10274933 | Ga0307410_102749332 | 228 |
| 117 | 3300031901 | Ga0307406_10075958 | Ga0307406_100759582 | 228 |
| 118 | 3300031903 | Ga0307407_10169949 | Ga0307407_101699492 | 228 |
| 119 | 3300031911 | Ga0307412_10034346 | Ga0307412_100343462 | 228 |
| 120 | 3300031911 | Ga0307412_10051675 | Ga0307412_100516752 | 228 |
| 121 | 3300032002 | Ga0307416_100625402 | Ga0307416_1006254022 | 228 |
| 122 | 3300037471 | Ga0395905_0036015 | Ga0395905_0036015_3481_4194 | 228 |
| 123 | 3300041453 | Ga0451797_1494958 | Ga0451797_1494958_843_1676 | 228 |
| 124 | 3300041494 | Ga0451837_0363295 | Ga0451837_0363295_103_891 | 228 |
| 125 | 3300041509 | Ga0451843_0385278 | Ga0451843_0385278_741_1598 | 228 |
| 126 | 3300041512 | Ga0451853_2377865 | Ga0451853_2377865_909_1697 | 228 |
| 127 | 3300044683 | Ga0466965_0010250 | Ga0466965_0010250_404_1231 | 228 |
| 128 | 3300045976 | Ga0466967_0428636 | Ga0466967_0428636_291_1121 | 228 |
| 129 | 3300046462 | Ga0495651_0176181 | Ga0495651_0176181_294_1160 | 228 |
| 130 | 3300046683 | Ga0495658_0124084 | Ga0495658_0124084_368_1141 | 228 |
| 131 | 3300048912 | Ga0496109_0040990 | Ga0496109_0040990_382_1161 | 228 |
| 132 | 3300048912 | Ga0496109_0096858 | Ga0496109_0096858_1257_2039 | 228 |
| 133 | 3300048912 | Ga0496109_0193284 | Ga0496109_0193284_1103_1876 | 228 |
| 134 | 3300048913 | Ga0496110_0016748 | Ga0496110_0016748_986_1765 | 228 |
| 135 | 3300048917 | Ga0496114_0079493 | Ga0496114_0079493_286_1086 | 228 |
| 136 | 3300048917 | Ga0496114_0104925 | Ga0496114_0104925_795_1568 | 228 |
| 137 | 3300053083 | Ga0495655_0007617 | Ga0495655_0007617_54_899 | 228 |
| 138 | 3300053085 | Ga0495619_0064799 | Ga0495619_0064799_560_1333 | 228 |
| 139 | iso_pu_bacteria | 2537561592 | 2537900337 | 228 |
| 140 | iso_pu_bacteria | 2554235227 | 2555230265 | 228 |
| 141 | iso_pu_bacteria | 2654587600 | 2655031283 | 228 |
| 142 | iso_pu_bacteria | 2841911363 | 2841915247 | 228 |
| 143 | iso_pu_bacteria | 2841917233 | 2841922144 | 228 |
| 144 | iso_pu_bacteria | 2884763398 | 2884765546 | 228 |
| 145 | iso_pu_bacteria | 2897561785 | 2897562802 | 228 |
| 146 | iso_pu_bacteria | 2920879853 | 2920882803 | 228 |
| 147 | iso_pu_bacteria | 642555113 | 642617788 | 228 |
| 148 | 3300005536 | Ga0070697_100303087 | Ga0070697_1003030872 | 229 |
| 149 | 3300005841 | Ga0068863_100195737 | Ga0068863_1001957373 | 229 |
| 150 | 3300009098 | Ga0105245_10652617 | Ga0105245_106526172 | 229 |
| 151 | 3300021384 | Ga0213876_10095971 | Ga0213876_100959713 | 229 |
| 152 | 3300031548 | Ga0307408_100607909 | Ga0307408_1006079091 | 229 |
| 153 | 3300031727 | Ga0316576_10260484 | Ga0316576_102604842 | 229 |
| 154 | 3300031727 | Ga0316576_10372833 | Ga0316576_103728331 | 229 |
| 155 | 3300031731 | Ga0307405_10055092 | Ga0307405_100550923 | 229 |
| 156 | 3300032168 | Ga0316593_10003223 | Ga0316593_100032234 | 229 |
| 157 | 3300036712 | Ga0316584_0129768 | Ga0316584_0129768_119_814 | 229 |
| 158 | 3300037853 | Ga0436364_0173605 | Ga0436364_0173605_3947_4657 | 229 |
| 159 | 3300039062 | Ga0400483_218392 | Ga0400483_218392_148_843 | 229 |
| 160 | 3300039437 | Ga0436365_0252180 | Ga0436365_0252180_5012_5713 | 229 |
| 161 | 3300039438 | Ga0436360_0394835 | Ga0436360_0394835_431_1147 | 229 |
| 162 | 3300049589 | Ga0501073_0002116 | Ga0501073_0002116_3216_3923 | 229 |
| 163 | 3300049744 | Ga0501083_0193302 | Ga0501083_0193302_437_1144 | 229 |
| 164 | 3300050507 | nmdc:mga05p37_440602_c1 | nmdc:mga05p37_440602_c1_715_1458 | 229 |
| 165 | iso_pu_bacteria | 2941479691 | 2941482696 | 229 |
| 166 | 3300002705 | JGI25156J39149_1006284 | JGI25156J39149_10062842 | 230 |
| 167 | 3300003354 | JGI25160J50197_1008717 | JGI25160J50197_10087172 | 230 |
| 168 | 3300005458 | Ga0070681_10021101 | Ga0070681_100211017 | 230 |
| 169 | 3300005530 | Ga0070679_100119756 | Ga0070679_1001197562 | 230 |
| 170 | 3300005563 | Ga0068855_100405070 | Ga0068855_1004050702 | 230 |
| 171 | 3300005577 | Ga0068857_100209430 | Ga0068857_1002094302 | 230 |
| 172 | 3300005842 | Ga0068858_100014743 | Ga0068858_1000147434 | 230 |
| 173 | 3300005937 | Ga0081455_10062033 | Ga0081455_100620333 | 230 |
| 174 | 3300005937 | Ga0081455_10113916 | Ga0081455_101139162 | 230 |
| 175 | 3300005981 | Ga0081538_10057902 | Ga0081538_100579022 | 230 |
| 176 | 3300005985 | Ga0081539_10024363 | Ga0081539_100243633 | 230 |
| 177 | 3300006186 | Ga0075369_10000896 | Ga0075369_100008966 | 230 |
| 178 | 3300006353 | Ga0075370_10281585 | Ga0075370_102815851 | 230 |
| 179 | 3300009093 | Ga0105240_10025266 | Ga0105240_100252667 | 230 |
| 180 | 3300025302 | Ga0207426_1001350 | Ga0207426_100135010 | 230 |
| 181 | 3300025912 | Ga0207707_10083323 | Ga0207707_100833233 | 230 |
| 182 | 3300025913 | Ga0207695_10036559 | Ga0207695_100365597 | 230 |
| 183 | 3300025921 | Ga0207652_10009905 | Ga0207652_100099054 | 230 |
| 184 | 3300025925 | Ga0207650_10034595 | Ga0207650_100345954 | 230 |
| 185 | 3300025949 | Ga0207667_10169733 | Ga0207667_101697333 | 230 |
| 186 | 3300026116 | Ga0207674_10230429 | Ga0207674_102304293 | 230 |
| 187 | 3300031731 | Ga0307405_10499163 | Ga0307405_104991631 | 230 |
| 188 | 3300035171 | Ga0373946_0118360 | Ga0373946_0118360_119_814 | 230 |
| 189 | 3300036401 | Ga0373937_0484964 | Ga0373937_0484964_337_1029 | 230 |
| 190 | 3300037312 | Ga0395899_0006462 | Ga0395899_0006462_5647_6342 | 230 |
| 191 | 3300037312 | Ga0395899_0155719 | Ga0395899_0155719_670_1365 | 230 |
| 192 | 3300037418 | Ga0395900_0021784 | Ga0395900_0021784_581_1276 | 230 |
| 193 | 3300037418 | Ga0395900_0037480 | Ga0395900_0037480_991_1686 | 230 |
| 194 | 3300037466 | Ga0395898_0048364 | Ga0395898_0048364_891_1586 | 230 |
| 195 | 3300038443 | Ga0395901_0003336 | Ga0395901_0003336_11999_12694 | 230 |
| 196 | 3300038443 | Ga0395901_0458091 | Ga0395901_0458091_332_1027 | 230 |
| 197 | 3300039447 | Ga0436361_0121746 | Ga0436361_0121746_696_1391 | 230 |
| 198 | 3300039447 | Ga0436361_0386399 | Ga0436361_0386399_582_1295 | 230 |
| 199 | 3300039447 | Ga0436361_1142624 | Ga0436361_1142624_510_1220 | 230 |
| 200 | 3300049568 | Ga0501031_0082131 | Ga0501031_0082131_1246_1965 | 230 |
| 201 | 3300049570 | Ga0501033_0137498 | Ga0501033_0137498_989_1708 | 230 |
| 202 | 3300049571 | Ga0501034_0167837 | Ga0501034_0167837_1245_1949 | 230 |
| 203 | 3300049572 | Ga0501036_0107404 | Ga0501036_0107404_1012_1731 | 230 |
| 204 | 3300049574 | Ga0501038_0362381 | Ga0501038_0362381_317_1036 | 230 |
| 205 | 3300049575 | Ga0501039_0060821 | Ga0501039_0060821_1889_2590 | 230 |
| 206 | 3300049575 | Ga0501039_0215325 | Ga0501039_0215325_115_834 | 230 |
| 207 | 3300049576 | Ga0501040_0084392 | Ga0501040_0084392_1153_1872 | 230 |
| 208 | 3300049576 | Ga0501040_0085010 | Ga0501040_0085010_761_1462 | 230 |
| 209 | 3300049577 | Ga0501041_0139203 | Ga0501041_0139203_230_949 | 230 |
| 210 | 3300049578 | Ga0501042_0030504 | Ga0501042_0030504_363_1082 | 230 |
| 211 | 3300049579 | Ga0501043_0158217 | Ga0501043_0158217_547_1266 | 230 |
| 212 | 3300049580 | Ga0501046_0180016 | Ga0501046_0180016_116_835 | 230 |
| 213 | 3300049582 | Ga0501048_0116522 | Ga0501048_0116522_581_1300 | 230 |
| 214 | 3300049584 | Ga0501068_0035178 | Ga0501068_0035178_738_1457 | 230 |
| 215 | 3300049585 | Ga0501069_0407516 | Ga0501069_0407516_13_732 | 230 |
| 216 | 3300049587 | Ga0501071_0280674 | Ga0501071_0280674_503_1222 | 230 |
| 217 | 3300049588 | Ga0501072_0016152 | Ga0501072_0016152_1139_1858 | 230 |
| 218 | 3300049590 | Ga0501074_0145349 | Ga0501074_0145349_341_1060 | 230 |
| 219 | 3300049591 | Ga0501075_0157761 | Ga0501075_0157761_121_840 | 230 |
| 220 | 3300049593 | Ga0501077_0130106 | Ga0501077_0130106_213_932 | 230 |
| 221 | 3300049741 | Ga0501079_0079549 | Ga0501079_0079549_1500_2219 | 230 |
| 222 | 3300049744 | Ga0501083_0071378 | Ga0501083_0071378_568_1287 | 230 |
| 223 | 3300049822 | Ga0501035_0162732 | Ga0501035_0162732_1183_1902 | 230 |
| 224 | 3300050489 | nmdc:mga03683_1487_c1 | nmdc:mga03683_1487_c1_351_1046 | 230 |
| 225 | 3300050489 | nmdc:mga03683_35731_c1 | nmdc:mga03683_35731_c1_973_1668 | 230 |
| 226 | 3300050492 | nmdc:mga0yw44_41216_c1 | nmdc:mga0yw44_41216_c1_1602_2297 | 230 |
| 227 | 3300050496 | nmdc:mga07m45_238987_c1 | nmdc:mga07m45_238987_c1_221_916 | 230 |
| 228 | 3300050511 | nmdc:mga08y16_173588_c1 | nmdc:mga08y16_173588_c1_1438_2133 | 230 |
| 229 | 3300050516 | nmdc:mga0sz30_5521_c1 | nmdc:mga0sz30_5521_c1_648_1343 | 230 |
| 230 | 3300053091 | Ga0500647_0110488 | Ga0500647_0110488_453_1148 | 230 |
| 231 | 3300053093 | Ga0500651_0312097 | Ga0500651_0312097_85_780 | 230 |
| 232 | 3300054114 | Ga0501084_0209126 | Ga0501084_0209126_138_857 | 230 |
| 233 | 3300060353 | Ga0501082_0144165 | Ga0501082_0144165_452_1171 | 230 |
| 234 | 3300061734 | Ga0530510_0243775 | Ga0530510_0243775_310_1029 | 230 |
| 235 | 3300003792 | Ga0055540_1042764 | Ga0055540_10427642 | 231 |
| 236 | 3300005290 | Ga0065712_10075868 | Ga0065712_100758685 | 231 |
| 237 | 3300005293 | Ga0065715_10018959 | Ga0065715_100189593 | 231 |
| 238 | 3300005548 | Ga0070665_100090631 | Ga0070665_1000906312 | 231 |
| 239 | 3300005577 | Ga0068857_100038259 | Ga0068857_1000382593 | 231 |
| 240 | 3300005617 | Ga0068859_100182041 | Ga0068859_1001820413 | 231 |
| 241 | 3300006847 | Ga0075431_100392497 | Ga0075431_1003924973 | 231 |
| 242 | 3300006931 | Ga0097620_100182033 | Ga0097620_1001820333 | 231 |
| 243 | 3300006948 | Ga0099826_10000036 | Ga0099826_1000003658 | 231 |
| 244 | 3300009011 | Ga0105251_10020078 | Ga0105251_100200782 | 231 |
| 245 | 3300009174 | Ga0105241_10047938 | Ga0105241_100479382 | 231 |
| 246 | 3300009545 | Ga0105237_10077670 | Ga0105237_100776703 | 231 |
| 247 | 3300009545 | Ga0105237_10113762 | Ga0105237_101137622 | 231 |
| 248 | 3300009545 | Ga0105237_10127292 | Ga0105237_101272923 | 231 |
| 249 | 3300009551 | Ga0105238_10027383 | Ga0105238_100273834 | 231 |
| 250 | 3300010375 | Ga0105239_10041668 | Ga0105239_100416684 | 231 |
| 251 | 3300010375 | Ga0105239_10145496 | Ga0105239_101454963 | 231 |
| 252 | 3300010375 | Ga0105239_10410719 | Ga0105239_104107192 | 231 |
| 253 | 3300025302 | Ga0207426_1010784 | Ga0207426_10107842 | 231 |
| 254 | 3300025302 | Ga0207426_1039543 | Ga0207426_10395433 | 231 |
| 255 | 3300025303 | Ga0209051_1069011 | Ga0209051_10690112 | 231 |
| 256 | 3300025735 | Ga0207713_1059624 | Ga0207713_10596242 | 231 |
| 257 | 3300025906 | Ga0207699_10119581 | Ga0207699_101195812 | 231 |
| 258 | 3300025914 | Ga0207671_10056312 | Ga0207671_100563123 | 231 |
| 259 | 3300025914 | Ga0207671_10078067 | Ga0207671_100780673 | 231 |
| 260 | 3300025924 | Ga0207694_10036803 | Ga0207694_100368033 | 231 |
| 261 | 3300025924 | Ga0207694_10089884 | Ga0207694_100898843 | 231 |
| 262 | 3300025960 | Ga0207651_10058532 | Ga0207651_100585323 | 231 |
| 263 | 3300026116 | Ga0207674_10017511 | Ga0207674_100175116 | 231 |
| 264 | 3300027666 | Ga0209282_1000098 | Ga0209282_100009824 | 231 |
| 265 | 3300027682 | Ga0209971_1007986 | Ga0209971_10079863 | 231 |
| 266 | 3300031247 | Ga0265340_10050806 | Ga0265340_100508062 | 231 |
| 267 | 3300031344 | Ga0265316_10003477 | Ga0265316_100034778 | 231 |
| 268 | 3300031691 | Ga0316579_10010076 | Ga0316579_100100764 | 231 |
| 269 | 3300031728 | Ga0316578_10002833 | Ga0316578_100028337 | 231 |
| 270 | 3300031911 | Ga0307412_10000235 | Ga0307412_1000023528 | 231 |
| 271 | 3300032133 | Ga0316583_10014321 | Ga0316583_100143214 | 231 |
| 272 | 3300035691 | Ga0373931_0044351 | Ga0373931_0044351_241_939 | 231 |
| 273 | 3300035692 | Ga0373935_0136145 | Ga0373935_0136145_31_729 | 231 |
| 274 | 3300036647 | Ga0316582_0018694 | Ga0316582_0018694_957_1670 | 231 |
| 275 | 3300037588 | Ga0316581_0006167 | Ga0316581_0006167_429_1169 | 231 |
| 276 | 3300039453 | Ga0436362_0870707 | Ga0436362_0870707_279_977 | 231 |
| 277 | 3300046462 | Ga0495651_0284323 | Ga0495651_0284323_353_1057 | 231 |
| 278 | 3300046463 | Ga0495653_0020662 | Ga0495653_0020662_2268_2972 | 231 |
| 279 | 3300046474 | Ga0495605_0002172 | Ga0495605_0002172_5701_6405 | 231 |
| 280 | 3300046477 | Ga0495664_0084305 | Ga0495664_0084305_772_1476 | 231 |
| 281 | 3300046477 | Ga0495664_0309053 | Ga0495664_0309053_47_751 | 231 |
| 282 | 3300046500 | Ga0495596_0000145 | Ga0495596_0000145_12451_13155 | 231 |
| 283 | 3300046501 | Ga0495607_0000021 | Ga0495607_0000021_144998_145699 | 231 |
| 284 | 3300046501 | Ga0495607_0003718 | Ga0495607_0003718_7865_8569 | 231 |
| 285 | 3300046511 | Ga0495608_0019310 | Ga0495608_0019310_2514_3218 | 231 |
| 286 | 3300046512 | Ga0495610_0000358 | Ga0495610_0000358_4034_4738 | 231 |
| 287 | 3300046513 | Ga0495616_0010431 | Ga0495616_0010431_2280_2984 | 231 |
| 288 | 3300046516 | Ga0495628_0064494 | Ga0495628_0064494_2100_2804 | 231 |
| 289 | 3300046517 | Ga0495630_0334410 | Ga0495630_0334410_171_875 | 231 |
| 290 | 3300046523 | Ga0495644_0047069 | Ga0495644_0047069_103_807 | 231 |
| 291 | 3300046524 | Ga0495648_0024963 | Ga0495648_0024963_1079_1783 | 231 |
| 292 | 3300046529 | Ga0495652_0028644 | Ga0495652_0028644_1951_2655 | 231 |
| 293 | 3300046529 | Ga0495652_0158598 | Ga0495652_0158598_1042_1746 | 231 |
| 294 | 3300046533 | Ga0495640_0173793 | Ga0495640_0173793_298_1002 | 231 |
| 295 | 3300046536 | Ga0495587_0017739 | Ga0495587_0017739_432_1136 | 231 |
| 296 | 3300046538 | Ga0495609_0009934 | Ga0495609_0009934_2394_3098 | 231 |
| 297 | 3300046542 | Ga0495597_0053502 | Ga0495597_0053502_54_758 | 231 |
| 298 | 3300046543 | Ga0495645_0021685 | Ga0495645_0021685_2495_3199 | 231 |
| 299 | 3300046559 | Ga0495667_0005798 | Ga0495667_0005798_1433_2137 | 231 |
| 300 | 3300046559 | Ga0495667_0039080 | Ga0495667_0039080_2418_3122 | 231 |
| 301 | 3300046663 | Ga0495635_0045907 | Ga0495635_0045907_799_1503 | 231 |
| 302 | 3300046663 | Ga0495635_0079796 | Ga0495635_0079796_990_1694 | 231 |
| 303 | 3300046665 | Ga0495661_0011823 | Ga0495661_0011823_1672_2376 | 231 |
| 304 | 3300046679 | Ga0495623_0013926 | Ga0495623_0013926_2088_2792 | 231 |
| 305 | 3300046679 | Ga0495623_0194226 | Ga0495623_0194226_252_956 | 231 |
| 306 | 3300046680 | Ga0495646_0035343 | Ga0495646_0035343_239_943 | 231 |
| 307 | 3300046692 | Ga0495671_0006024 | Ga0495671_0006024_4982_5686 | 231 |
| 308 | 3300046694 | Ga0495649_0009020 | Ga0495649_0009020_3229_3933 | 231 |
| 309 | 3300046794 | Ga0495589_0097158 | Ga0495589_0097158_513_1217 | 231 |
| 310 | 3300046809 | Ga0495600_0006876 | Ga0495600_0006876_3925_4629 | 231 |
| 311 | 3300047317 | Ga0495604_0001357 | Ga0495604_0001357_3660_4364 | 231 |
| 312 | 3300047317 | Ga0495604_0154369 | Ga0495604_0154369_600_1304 | 231 |
| 313 | 3300047317 | Ga0495604_0223049 | Ga0495604_0223049_255_959 | 231 |
| 314 | 3300047319 | Ga0495674_0016327 | Ga0495674_0016327_1468_2172 | 231 |
| 315 | 3300047319 | Ga0495674_0137091 | Ga0495674_0137091_938_1642 | 231 |
| 316 | 3300047319 | Ga0495674_0321300 | Ga0495674_0321300_187_891 | 231 |
| 317 | 3300047320 | Ga0495672_0003805 | Ga0495672_0003805_7866_8570 | 231 |
| 318 | 3300047322 | Ga0495680_0021296 | Ga0495680_0021296_800_1504 | 231 |
| 319 | 3300047444 | Ga0495675_0002040 | Ga0495675_0002040_781_1485 | 231 |
| 320 | 3300047444 | Ga0495675_0177658 | Ga0495675_0177658_82_786 | 231 |
| 321 | 3300047444 | Ga0495675_0237251 | Ga0495675_0237251_76_780 | 231 |
| 322 | 3300047444 | Ga0495675_0442897 | Ga0495675_0442897_18_722 | 231 |
| 323 | 3300047447 | Ga0495685_002240 | Ga0495685_002240_3647_4351 | 231 |
| 324 | 3300047471 | Ga0495684_0009756 | Ga0495684_0009756_2599_3303 | 231 |
| 325 | 3300048918 | Ga0496115_0293825 | Ga0496115_0293825_290_994 | 231 |
| 326 | 3300048919 | Ga0496116_0009306 | Ga0496116_0009306_3916_4620 | 231 |
| 327 | 3300048919 | Ga0496116_0013463 | Ga0496116_0013463_5427_6128 | 231 |
| 328 | 3300048922 | Ga0496119_0059557 | Ga0496119_0059557_653_1354 | 231 |
| 329 | 3300048924 | Ga0496121_0000444 | Ga0496121_0000444_38467_39168 | 231 |
| 330 | 3300048924 | Ga0496121_0023152 | Ga0496121_0023152_2404_3108 | 231 |
| 331 | 3300048925 | Ga0496122_0006772 | Ga0496122_0006772_565_1269 | 231 |
| 332 | 3300048926 | Ga0496123_0001730 | Ga0496123_0001730_16149_16853 | 231 |
| 333 | 3300048926 | Ga0496123_0022278 | Ga0496123_0022278_3584_4285 | 231 |
| 334 | 3300048927 | Ga0496124_0038248 | Ga0496124_0038248_1114_1815 | 231 |
| 335 | 3300048928 | Ga0496125_0203949 | Ga0496125_0203949_299_1000 | 231 |
| 336 | 3300048929 | Ga0496126_0127385 | Ga0496126_0127385_1438_2142 | 231 |
| 337 | 3300049570 | Ga0501033_0165082 | Ga0501033_0165082_786_1511 | 231 |
| 338 | 3300049571 | Ga0501034_0002554 | Ga0501034_0002554_18215_18913 | 231 |
| 339 | 3300049572 | Ga0501036_0007624 | Ga0501036_0007624_3831_4556 | 231 |
| 340 | 3300049574 | Ga0501038_0007405 | Ga0501038_0007405_5170_5895 | 231 |
| 341 | 3300049576 | Ga0501040_0029705 | Ga0501040_0029705_623_1348 | 231 |
| 342 | 3300049576 | Ga0501040_0035020 | Ga0501040_0035020_2013_2738 | 231 |
| 343 | 3300049577 | Ga0501041_0010800 | Ga0501041_0010800_3440_4165 | 231 |
| 344 | 3300049577 | Ga0501041_0119548 | Ga0501041_0119548_812_1537 | 231 |
| 345 | 3300049578 | Ga0501042_0180209 | Ga0501042_0180209_556_1260 | 231 |
| 346 | 3300049579 | Ga0501043_0090508 | Ga0501043_0090508_1043_1768 | 231 |
| 347 | 3300049579 | Ga0501043_0102700 | Ga0501043_0102700_1353_2078 | 231 |
| 348 | 3300049582 | Ga0501048_0021038 | Ga0501048_0021038_3254_3979 | 231 |
| 349 | 3300049587 | Ga0501071_0034529 | Ga0501071_0034529_2369_3094 | 231 |
| 350 | 3300049588 | Ga0501072_0000978 | Ga0501072_0000978_17888_18613 | 231 |
| 351 | 3300049590 | Ga0501074_0040093 | Ga0501074_0040093_1347_2072 | 231 |
| 352 | 3300049591 | Ga0501075_0000016 | Ga0501075_0000016_26848_27573 | 231 |
| 353 | 3300049591 | Ga0501075_0030254 | Ga0501075_0030254_3176_3901 | 231 |
| 354 | 3300049592 | Ga0501076_0000053 | Ga0501076_0000053_42584_43309 | 231 |
| 355 | 3300049741 | Ga0501079_0006500 | Ga0501079_0006500_7291_8016 | 231 |
| 356 | 3300049742 | Ga0501080_0029008 | Ga0501080_0029008_2302_3027 | 231 |
| 357 | 3300049743 | Ga0501081_0015484 | Ga0501081_0015484_790_1515 | 231 |
| 358 | 3300049744 | Ga0501083_0134277 | Ga0501083_0134277_827_1552 | 231 |
| 359 | 3300049822 | Ga0501035_0097702 | Ga0501035_0097702_1405_2130 | 231 |
| 360 | 3300049824 | Ga0501045_0006931 | Ga0501045_0006931_6501_7226 | 231 |
| 361 | 3300050493 | nmdc:mga0k408_12193_c1 | nmdc:mga0k408_12193_c1_643_1341 | 231 |
| 362 | 3300053153 | Ga0500616_0039346 | Ga0500616_0039346_1322_2029 | 231 |
| 363 | 3300054114 | Ga0501084_0007936 | Ga0501084_0007936_3710_4435 | 231 |
| 364 | 3300054114 | Ga0501084_0299783 | Ga0501084_0299783_605_1330 | 231 |
| 365 | 3300060353 | Ga0501082_0007898 | Ga0501082_0007898_3370_4095 | 231 |
| 366 | 3300061734 | Ga0530510_0000002 | Ga0530510_0000002_270623_271348 | 231 |
| 367 | 3300061734 | Ga0530510_0007581 | Ga0530510_0007581_5115_5840 | 231 |
| 368 | 3300002126 | JGI24035J26624_1009571 | JGI24035J26624_10095711 | 232 |
| 369 | 3300005329 | Ga0070683_100073554 | Ga0070683_1000735543 | 232 |
| 370 | 3300005329 | Ga0070683_100124624 | Ga0070683_1001246243 | 232 |
| 371 | 3300005329 | Ga0070683_100187069 | Ga0070683_1001870693 | 232 |
| 372 | 3300005330 | Ga0070690_100333068 | Ga0070690_1003330682 | 232 |
| 373 | 3300005331 | Ga0070670_100004072 | Ga0070670_10000407211 | 232 |
| 374 | 3300005331 | Ga0070670_100068491 | Ga0070670_1000684913 | 232 |
| 375 | 3300005331 | Ga0070670_100179243 | Ga0070670_1001792433 | 232 |
| 376 | 3300005334 | Ga0068869_100014092 | Ga0068869_1000140924 | 232 |
| 377 | 3300005335 | Ga0070666_10310826 | Ga0070666_103108262 | 232 |
| 378 | 3300005339 | Ga0070660_100304047 | Ga0070660_1003040472 | 232 |
| 379 | 3300005340 | Ga0070689_100033349 | Ga0070689_1000333493 | 232 |
| 380 | 3300005344 | Ga0070661_100179530 | Ga0070661_1001795303 | 232 |
| 381 | 3300005356 | Ga0070674_100044539 | Ga0070674_1000445393 | 232 |
| 382 | 3300005364 | Ga0070673_100628555 | Ga0070673_1006285551 | 232 |
| 383 | 3300005365 | Ga0070688_100610178 | Ga0070688_1006101781 | 232 |
| 384 | 3300005367 | Ga0070667_100086872 | Ga0070667_1000868722 | 232 |
| 385 | 3300005434 | Ga0070709_10026270 | Ga0070709_100262704 | 232 |
| 386 | 3300005435 | Ga0070714_100034440 | Ga0070714_1000344404 | 232 |
| 387 | 3300005435 | Ga0070714_100148431 | Ga0070714_1001484311 | 232 |
| 388 | 3300005435 | Ga0070714_100733518 | Ga0070714_1007335181 | 232 |
| 389 | 3300005436 | Ga0070713_100014911 | Ga0070713_1000149117 | 232 |
| 390 | 3300005436 | Ga0070713_100028199 | Ga0070713_1000281993 | 232 |
| 391 | 3300005436 | Ga0070713_100163342 | Ga0070713_1001633422 | 232 |
| 392 | 3300005437 | Ga0070710_10216034 | Ga0070710_102160342 | 232 |
| 393 | 3300005439 | Ga0070711_100011172 | Ga0070711_1000111727 | 232 |
| 394 | 3300005439 | Ga0070711_100043640 | Ga0070711_1000436403 | 232 |
| 395 | 3300005440 | Ga0070705_100032151 | Ga0070705_1000321513 | 232 |
| 396 | 3300005444 | Ga0070694_100063897 | Ga0070694_1000638972 | 232 |
| 397 | 3300005457 | Ga0070662_100518242 | Ga0070662_1005182422 | 232 |
| 398 | 3300005458 | Ga0070681_10000304 | Ga0070681_1000030434 | 232 |
| 399 | 3300005458 | Ga0070681_10000747 | Ga0070681_1000074711 | 232 |
| 400 | 3300005458 | Ga0070681_10021818 | Ga0070681_100218185 | 232 |
| 401 | 3300005459 | Ga0068867_100006678 | Ga0068867_1000066785 | 232 |
| 402 | 3300005467 | Ga0070706_100798993 | Ga0070706_1007989931 | 232 |
| 403 | 3300005530 | Ga0070679_100024816 | Ga0070679_1000248162 | 232 |
| 404 | 3300005530 | Ga0070679_100033468 | Ga0070679_1000334686 | 232 |
| 405 | 3300005535 | Ga0070684_100060840 | Ga0070684_1000608402 | 232 |
| 406 | 3300005535 | Ga0070684_100072504 | Ga0070684_1000725043 | 232 |
| 407 | 3300005536 | Ga0070697_100039013 | Ga0070697_1000390134 | 232 |
| 408 | 3300005539 | Ga0068853_100123859 | Ga0068853_1001238593 | 232 |
| 409 | 3300005539 | Ga0068853_100201020 | Ga0068853_1002010202 | 232 |
| 410 | 3300005539 | Ga0068853_100518421 | Ga0068853_1005184211 | 232 |
| 411 | 3300005545 | Ga0070695_100213026 | Ga0070695_1002130262 | 232 |
| 412 | 3300005547 | Ga0070693_100091312 | Ga0070693_1000913121 | 232 |
| 413 | 3300005547 | Ga0070693_100098984 | Ga0070693_1000989841 | 232 |
| 414 | 3300005548 | Ga0070665_100005312 | Ga0070665_1000053126 | 232 |
| 415 | 3300005563 | Ga0068855_100000563 | Ga0068855_10000056337 | 232 |
| 416 | 3300005563 | Ga0068855_100051557 | Ga0068855_1000515572 | 232 |
| 417 | 3300005564 | Ga0070664_100000879 | Ga0070664_1000008799 | 232 |
| 418 | 3300005577 | Ga0068857_100000022 | Ga0068857_10000002214 | 232 |
| 419 | 3300005577 | Ga0068857_100002691 | Ga0068857_1000026919 | 232 |
| 420 | 3300005578 | Ga0068854_100007043 | Ga0068854_1000070437 | 232 |
| 421 | 3300005578 | Ga0068854_100009020 | Ga0068854_1000090204 | 232 |
| 422 | 3300005578 | Ga0068854_100408437 | Ga0068854_1004084372 | 232 |
| 423 | 3300005614 | Ga0068856_100000448 | Ga0068856_10000044837 | 232 |
| 424 | 3300005614 | Ga0068856_100002645 | Ga0068856_1000026457 | 232 |
| 425 | 3300005616 | Ga0068852_100538622 | Ga0068852_1005386222 | 232 |
| 426 | 3300005617 | Ga0068859_100000885 | Ga0068859_10000088516 | 232 |
| 427 | 3300005617 | Ga0068859_100065693 | Ga0068859_1000656934 | 232 |
| 428 | 3300005617 | Ga0068859_100123537 | Ga0068859_1001235372 | 232 |
| 429 | 3300005618 | Ga0068864_100001248 | Ga0068864_1000012483 | 232 |
| 430 | 3300005618 | Ga0068864_100291991 | Ga0068864_1002919912 | 232 |
| 431 | 3300005718 | Ga0068866_10000934 | Ga0068866_100009341 | 232 |
| 432 | 3300005719 | Ga0068861_100236334 | Ga0068861_1002363341 | 232 |
| 433 | 3300005841 | Ga0068863_100105879 | Ga0068863_1001058792 | 232 |
| 434 | 3300005841 | Ga0068863_100229718 | Ga0068863_1002297182 | 232 |
| 435 | 3300005842 | Ga0068858_100001352 | Ga0068858_10000135221 | 232 |
| 436 | 3300005842 | Ga0068858_100475468 | Ga0068858_1004754681 | 232 |
| 437 | 3300005843 | Ga0068860_100003736 | Ga0068860_10000373613 | 232 |
| 438 | 3300005843 | Ga0068860_100005346 | Ga0068860_1000053465 | 232 |
| 439 | 3300005843 | Ga0068860_100024758 | Ga0068860_1000247585 | 232 |
| 440 | 3300005844 | Ga0068862_100039154 | Ga0068862_1000391542 | 232 |
| 441 | 3300005983 | Ga0081540_1000873 | Ga0081540_10008733 | 232 |
| 442 | 3300006028 | Ga0070717_10105767 | Ga0070717_101057672 | 232 |
| 443 | 3300006175 | Ga0070712_100000897 | Ga0070712_10000089717 | 232 |
| 444 | 3300006175 | Ga0070712_100055596 | Ga0070712_1000555963 | 232 |
| 445 | 3300006175 | Ga0070712_100144569 | Ga0070712_1001445692 | 232 |
| 446 | 3300006237 | Ga0097621_100000279 | Ga0097621_1000002799 | 232 |
| 447 | 3300006237 | Ga0097621_100057804 | Ga0097621_1000578042 | 232 |
| 448 | 3300006358 | Ga0068871_100000304 | Ga0068871_1000003049 | 232 |
| 449 | 3300006358 | Ga0068871_100031688 | Ga0068871_1000316882 | 232 |
| 450 | 3300006358 | Ga0068871_100340201 | Ga0068871_1003402012 | 232 |
| 451 | 3300006844 | Ga0075428_100031684 | Ga0075428_1000316842 | 232 |
| 452 | 3300006844 | Ga0075428_100145115 | Ga0075428_1001451153 | 232 |
| 453 | 3300006846 | Ga0075430_100010560 | Ga0075430_1000105609 | 232 |
| 454 | 3300006846 | Ga0075430_100161430 | Ga0075430_1001614303 | 232 |
| 455 | 3300006847 | Ga0075431_100062743 | Ga0075431_1000627433 | 232 |
| 456 | 3300006847 | Ga0075431_100427028 | Ga0075431_1004270282 | 232 |
| 457 | 3300006880 | Ga0075429_100019449 | Ga0075429_1000194493 | 232 |
| 458 | 3300006880 | Ga0075429_100224317 | Ga0075429_1002243172 | 232 |
| 459 | 3300006931 | Ga0097620_100000885 | Ga0097620_10000088514 | 232 |
| 460 | 3300006931 | Ga0097620_100065696 | Ga0097620_1000656962 | 232 |
| 461 | 3300006931 | Ga0097620_100123538 | Ga0097620_1001235382 | 232 |
| 462 | 3300009093 | Ga0105240_10007213 | Ga0105240_1000721310 | 232 |
| 463 | 3300009098 | Ga0105245_10461464 | Ga0105245_104614641 | 232 |
| 464 | 3300009174 | Ga0105241_10119796 | Ga0105241_101197962 | 232 |
| 465 | 3300009177 | Ga0105248_10420181 | Ga0105248_104201812 | 232 |
| 466 | 3300009177 | Ga0105248_10588625 | Ga0105248_105886252 | 232 |
| 467 | 3300009177 | Ga0105248_11311793 | Ga0105248_113117931 | 232 |
| 468 | 3300009545 | Ga0105237_10004260 | Ga0105237_1000426010 | 232 |
| 469 | 3300009551 | Ga0105238_10002919 | Ga0105238_1000291915 | 232 |
| 470 | 3300010375 | Ga0105239_10058972 | Ga0105239_100589723 | 232 |
| 471 | 3300010375 | Ga0105239_10814026 | Ga0105239_108140262 | 232 |
| 472 | 3300010375 | Ga0105239_10866644 | Ga0105239_108666441 | 232 |
| 473 | 3300013104 | Ga0157370_10058618 | Ga0157370_100586183 | 232 |
| 474 | 3300013105 | Ga0157369_10000243 | Ga0157369_1000024366 | 232 |
| 475 | 3300013296 | Ga0157374_10001216 | Ga0157374_1000121614 | 232 |
| 476 | 3300013297 | Ga0157378_10115644 | Ga0157378_101156442 | 232 |
| 477 | 3300013307 | Ga0157372_10015924 | Ga0157372_100159248 | 232 |
| 478 | 3300013307 | Ga0157372_10250419 | Ga0157372_102504192 | 232 |
| 479 | 3300013307 | Ga0157372_10523405 | Ga0157372_105234051 | 232 |
| 480 | 3300014968 | Ga0157379_10348051 | Ga0157379_103480512 | 232 |
| 481 | 3300021384 | Ga0213876_10035150 | Ga0213876_100351501 | 232 |
| 482 | 3300021384 | Ga0213876_10042184 | Ga0213876_100421842 | 232 |
| 483 | 3300022734 | Ga0224571_100778 | Ga0224571_1007783 | 232 |
| 484 | 3300024225 | Ga0224572_1011723 | Ga0224572_10117232 | 232 |
| 485 | 3300024225 | Ga0224572_1034160 | Ga0224572_10341601 | 232 |
| 486 | 3300024227 | Ga0228598_1003353 | Ga0228598_10033532 | 232 |
| 487 | 3300025250 | Ga0209026_1005874 | Ga0209026_10058741 | 232 |
| 488 | 3300025315 | Ga0207697_10002151 | Ga0207697_100021515 | 232 |
| 489 | 3300025898 | Ga0207692_10032122 | Ga0207692_100321222 | 232 |
| 490 | 3300025901 | Ga0207688_10009808 | Ga0207688_100098085 | 232 |
| 491 | 3300025903 | Ga0207680_10467931 | Ga0207680_104679311 | 232 |
| 492 | 3300025904 | Ga0207647_10089517 | Ga0207647_100895172 | 232 |
| 493 | 3300025907 | Ga0207645_10281917 | Ga0207645_102819172 | 232 |
| 494 | 3300025911 | Ga0207654_10082024 | Ga0207654_100820243 | 232 |
| 495 | 3300025912 | Ga0207707_10001814 | Ga0207707_100018148 | 232 |
| 496 | 3300025912 | Ga0207707_10003521 | Ga0207707_1000352113 | 232 |
| 497 | 3300025913 | Ga0207695_10020070 | Ga0207695_100200707 | 232 |
| 498 | 3300025915 | Ga0207693_10015053 | Ga0207693_100150535 | 232 |
| 499 | 3300025915 | Ga0207693_10034939 | Ga0207693_100349393 | 232 |
| 500 | 3300025915 | Ga0207693_10089856 | Ga0207693_100898562 | 232 |
| 501 | 3300025916 | Ga0207663_10022626 | Ga0207663_100226264 | 232 |
| 502 | 3300025916 | Ga0207663_10025717 | Ga0207663_100257173 | 232 |
| 503 | 3300025916 | Ga0207663_10111069 | Ga0207663_101110692 | 232 |
| 504 | 3300025916 | Ga0207663_10146180 | Ga0207663_101461801 | 232 |
| 505 | 3300025916 | Ga0207663_10154977 | Ga0207663_101549773 | 232 |
| 506 | 3300025919 | Ga0207657_10184221 | Ga0207657_101842211 | 232 |
| 507 | 3300025921 | Ga0207652_10003767 | Ga0207652_100037678 | 232 |
| 508 | 3300025921 | Ga0207652_10123612 | Ga0207652_101236123 | 232 |
| 509 | 3300025921 | Ga0207652_10640565 | Ga0207652_106405652 | 232 |
| 510 | 3300025924 | Ga0207694_10000896 | Ga0207694_1000089611 | 232 |
| 511 | 3300025925 | Ga0207650_10020298 | Ga0207650_100202982 | 232 |
| 512 | 3300025925 | Ga0207650_10050834 | Ga0207650_100508342 | 232 |
| 513 | 3300025926 | Ga0207659_10290469 | Ga0207659_102904692 | 232 |
| 514 | 3300025928 | Ga0207700_10052042 | Ga0207700_100520422 | 232 |
| 515 | 3300025928 | Ga0207700_10089216 | Ga0207700_100892163 | 232 |
| 516 | 3300025929 | Ga0207664_10199227 | Ga0207664_101992272 | 232 |
| 517 | 3300025929 | Ga0207664_10581100 | Ga0207664_105811001 | 232 |
| 518 | 3300025933 | Ga0207706_10367160 | Ga0207706_103671602 | 232 |
| 519 | 3300025936 | Ga0207670_10060659 | Ga0207670_100606592 | 232 |
| 520 | 3300025937 | Ga0207669_10009321 | Ga0207669_100093213 | 232 |
| 521 | 3300025939 | Ga0207665_10000176 | Ga0207665_1000017616 | 232 |
| 522 | 3300025939 | Ga0207665_10058247 | Ga0207665_100582472 | 232 |
| 523 | 3300025940 | Ga0207691_10387791 | Ga0207691_103877912 | 232 |
| 524 | 3300025941 | Ga0207711_10260741 | Ga0207711_102607413 | 232 |
| 525 | 3300025944 | Ga0207661_10348936 | Ga0207661_103489362 | 232 |
| 526 | 3300025945 | Ga0207679_10001790 | Ga0207679_100017907 | 232 |
| 527 | 3300025949 | Ga0207667_10000302 | Ga0207667_1000030242 | 232 |
| 528 | 3300025949 | Ga0207667_10027794 | Ga0207667_100277944 | 232 |
| 529 | 3300025949 | Ga0207667_10767741 | Ga0207667_107677411 | 232 |
| 530 | 3300025960 | Ga0207651_10576133 | Ga0207651_105761331 | 232 |
| 531 | 3300025981 | Ga0207640_10002615 | Ga0207640_100026159 | 232 |
| 532 | 3300025986 | Ga0207658_10613866 | Ga0207658_106138661 | 232 |
| 533 | 3300026023 | Ga0207677_10168654 | Ga0207677_101686542 | 232 |
| 534 | 3300026023 | Ga0207677_10494213 | Ga0207677_104942131 | 232 |
| 535 | 3300026035 | Ga0207703_10001842 | Ga0207703_1000184211 | 232 |
| 536 | 3300026035 | Ga0207703_10063941 | Ga0207703_100639414 | 232 |
| 537 | 3300026041 | Ga0207639_10020277 | Ga0207639_100202775 | 232 |
| 538 | 3300026041 | Ga0207639_10032909 | Ga0207639_100329092 | 232 |
| 539 | 3300026041 | Ga0207639_10049051 | Ga0207639_100490512 | 232 |
| 540 | 3300026067 | Ga0207678_10089478 | Ga0207678_100894783 | 232 |
| 541 | 3300026078 | Ga0207702_10000120 | Ga0207702_1000012075 | 232 |
| 542 | 3300026078 | Ga0207702_10029438 | Ga0207702_100294383 | 232 |
| 543 | 3300026088 | Ga0207641_10054475 | Ga0207641_100544754 | 232 |
| 544 | 3300026089 | Ga0207648_10015149 | Ga0207648_100151493 | 232 |
| 545 | 3300026095 | Ga0207676_10009792 | Ga0207676_100097922 | 232 |
| 546 | 3300026095 | Ga0207676_10709904 | Ga0207676_107099042 | 232 |
| 547 | 3300026116 | Ga0207674_10000056 | Ga0207674_1000005680 | 232 |
| 548 | 3300026116 | Ga0207674_10010860 | Ga0207674_100108608 | 232 |
| 549 | 3300026121 | Ga0207683_10303045 | Ga0207683_103030452 | 232 |
| 550 | 3300026142 | Ga0207698_10349755 | Ga0207698_103497552 | 232 |
| 551 | 3300027665 | Ga0209983_1024125 | Ga0209983_10241252 | 232 |
| 552 | 3300027682 | Ga0209971_1011013 | Ga0209971_10110133 | 232 |
| 553 | 3300027876 | Ga0209974_10089991 | Ga0209974_100899912 | 232 |
| 554 | 3300028016 | Ga0265354_1000063 | Ga0265354_100006312 | 232 |
| 555 | 3300028016 | Ga0265354_1000477 | Ga0265354_10004776 | 232 |
| 556 | 3300028379 | Ga0268266_10000276 | Ga0268266_1000027613 | 232 |
| 557 | 3300028379 | Ga0268266_10088967 | Ga0268266_100889673 | 232 |
| 558 | 3300028381 | Ga0268264_10003976 | Ga0268264_100039766 | 232 |
| 559 | 3300028653 | Ga0265323_10009931 | Ga0265323_100099311 | 232 |
| 560 | 3300028654 | Ga0265322_10016111 | Ga0265322_100161113 | 232 |
| 561 | 3300030878 | Ga0265770_1003281 | Ga0265770_10032813 | 232 |
| 562 | 3300031090 | Ga0265760_10004504 | Ga0265760_100045041 | 232 |
| 563 | 3300031090 | Ga0265760_10030405 | Ga0265760_100304053 | 232 |
| 564 | 3300031090 | Ga0265760_10092412 | Ga0265760_100924122 | 232 |
| 565 | 3300031241 | Ga0265325_10051040 | Ga0265325_100510403 | 232 |
| 566 | 3300031247 | Ga0265340_10002512 | Ga0265340_100025126 | 232 |
| 567 | 3300031247 | Ga0265340_10122830 | Ga0265340_101228302 | 232 |
| 568 | 3300031249 | Ga0265339_10039977 | Ga0265339_100399772 | 232 |
| 569 | 3300031250 | Ga0265331_10018561 | Ga0265331_100185614 | 232 |
| 570 | 3300031344 | Ga0265316_10013849 | Ga0265316_100138495 | 232 |
| 571 | 3300031344 | Ga0265316_10082071 | Ga0265316_100820713 | 232 |
| 572 | 3300031595 | Ga0265313_10030041 | Ga0265313_100300412 | 232 |
| 573 | 3300031595 | Ga0265313_10038206 | Ga0265313_100382063 | 232 |
| 574 | 3300031711 | Ga0265314_10001239 | Ga0265314_1000123912 | 232 |
| 575 | 3300031712 | Ga0265342_10001720 | Ga0265342_1000172018 | 232 |
| 576 | 3300031712 | Ga0265342_10006613 | Ga0265342_100066137 | 232 |
| 577 | 3300031712 | Ga0265342_10014169 | Ga0265342_100141694 | 232 |
| 578 | 3300031731 | Ga0307405_10023943 | Ga0307405_100239432 | 232 |
| 579 | 3300031852 | Ga0307410_10019800 | Ga0307410_100198002 | 232 |
| 580 | 3300031901 | Ga0307406_10012037 | Ga0307406_100120376 | 232 |
| 581 | 3300031901 | Ga0307406_10190364 | Ga0307406_101903642 | 232 |
| 582 | 3300031911 | Ga0307412_10176353 | Ga0307412_101763532 | 232 |
| 583 | 3300031911 | Ga0307412_10369940 | Ga0307412_103699402 | 232 |
| 584 | 3300031911 | Ga0307412_10449133 | Ga0307412_104491331 | 232 |
| 585 | 3300031995 | Ga0307409_100135520 | Ga0307409_1001355203 | 232 |
| 586 | 3300031995 | Ga0307409_100539916 | Ga0307409_1005399162 | 232 |
| 587 | 3300032002 | Ga0307416_100002923 | Ga0307416_1000029234 | 232 |
| 588 | 3300032002 | Ga0307416_100158591 | Ga0307416_1001585912 | 232 |
| 589 | 3300032004 | Ga0307414_10451508 | Ga0307414_104515082 | 232 |
| 590 | 3300032005 | Ga0307411_10114212 | Ga0307411_101142123 | 232 |
| 591 | 3300035090 | Ga0373949_0016852 | Ga0373949_0016852_682_1389 | 232 |
| 592 | 3300035118 | Ga0373954_0050841 | Ga0373954_0050841_1041_1766 | 232 |
| 593 | 3300036401 | Ga0373937_0153780 | Ga0373937_0153780_645_1370 | 232 |
| 594 | 3300039437 | Ga0436365_0694215 | Ga0436365_0694215_1284_2045 | 232 |
| 595 | 3300039437 | Ga0436365_1272561 | Ga0436365_1272561_5626_6351 | 232 |
| 596 | 3300039438 | Ga0436360_0994159 | Ga0436360_0994159_674_1378 | 232 |
| 597 | 3300039453 | Ga0436362_0680558 | Ga0436362_0680558_32_757 | 232 |
| 598 | 3300042438 | Ga0439459_0025286 | Ga0439459_0025286_278_985 | 232 |
| 599 | 3300042461 | Ga0439460_0047890 | Ga0439460_0047890_482_1210 | 232 |
| 600 | 3300045051 | Ga0451576_0086375 | Ga0451576_0086375_277_981 | 232 |
| 601 | 3300046472 | Ga0495580_0008165 | Ga0495580_0008165_3067_3786 | 232 |
| 602 | 3300046516 | Ga0495628_0027367 | Ga0495628_0027367_322_1026 | 232 |
| 603 | 3300046517 | Ga0495630_0397676 | Ga0495630_0397676_335_1045 | 232 |
| 604 | 3300046522 | Ga0495643_0032426 | Ga0495643_0032426_2070_2780 | 232 |
| 605 | 3300046543 | Ga0495645_0058901 | Ga0495645_0058901_1819_2568 | 232 |
| 606 | 3300046684 | Ga0495669_0182712 | Ga0495669_0182712_228_932 | 232 |
| 607 | 3300047317 | Ga0495604_0265529 | Ga0495604_0265529_252_956 | 232 |
| 608 | 3300048903 | Ga0496100_0278906 | Ga0496100_0278906_295_1008 | 232 |
| 609 | 3300048904 | Ga0496101_0192624 | Ga0496101_0192624_438_1151 | 232 |
| 610 | 3300048904 | Ga0496101_0374066 | Ga0496101_0374066_208_915 | 232 |
| 611 | 3300048906 | Ga0496103_0352455 | Ga0496103_0352455_208_915 | 232 |
| 612 | 3300048907 | Ga0496104_0061218 | Ga0496104_0061218_2445_3152 | 232 |
| 613 | 3300048911 | Ga0496108_0070791 | Ga0496108_0070791_932_1654 | 232 |
| 614 | 3300048913 | Ga0496110_0088480 | Ga0496110_0088480_1684_2406 | 232 |
| 615 | 3300048915 | Ga0496112_0004054 | Ga0496112_0004054_7121_7828 | 232 |
| 616 | 3300048915 | Ga0496112_0018421 | Ga0496112_0018421_4362_5075 | 232 |
| 617 | 3300048918 | Ga0496115_0227301 | Ga0496115_0227301_574_1281 | 232 |
| 618 | 3300048925 | Ga0496122_0234301 | Ga0496122_0234301_68_778 | 232 |
| 619 | 3300049522 | Ga0501299_046320 | Ga0501299_046320_110_820 | 232 |
| 620 | 3300049571 | Ga0501034_0581888 | Ga0501034_0581888_156_902 | 232 |
| 621 | 3300049574 | Ga0501038_0285638 | Ga0501038_0285638_494_1195 | 232 |
| 622 | 3300049575 | Ga0501039_0160290 | Ga0501039_0160290_993_1694 | 232 |
| 623 | 3300049576 | Ga0501040_0508115 | Ga0501040_0508115_45_749 | 232 |
| 624 | 3300049580 | Ga0501046_0148131 | Ga0501046_0148131_938_1636 | 232 |
| 625 | 3300049580 | Ga0501046_0273090 | Ga0501046_0273090_455_1192 | 232 |
| 626 | 3300049581 | Ga0501047_0012523 | Ga0501047_0012523_1402_2148 | 232 |
| 627 | 3300049582 | Ga0501048_0049581 | Ga0501048_0049581_794_1531 | 232 |
| 628 | 3300049583 | Ga0501067_0235638 | Ga0501067_0235638_134_880 | 232 |
| 629 | 3300049586 | Ga0501070_0095803 | Ga0501070_0095803_86_832 | 232 |
| 630 | 3300049588 | Ga0501072_0011768 | Ga0501072_0011768_892_1629 | 232 |
| 631 | 3300049588 | Ga0501072_0029570 | Ga0501072_0029570_3012_3758 | 232 |
| 632 | 3300049589 | Ga0501073_0040672 | Ga0501073_0040672_839_1585 | 232 |
| 633 | 3300049589 | Ga0501073_0077868 | Ga0501073_0077868_426_1124 | 232 |
| 634 | 3300049590 | Ga0501074_0058878 | Ga0501074_0058878_747_1484 | 232 |
| 635 | 3300049590 | Ga0501074_0068939 | Ga0501074_0068939_1259_2005 | 232 |
| 636 | 3300049592 | Ga0501076_0029073 | Ga0501076_0029073_2108_2845 | 232 |
| 637 | 3300049592 | Ga0501076_0106481 | Ga0501076_0106481_1411_2115 | 232 |
| 638 | 3300049593 | Ga0501077_0032712 | Ga0501077_0032712_1789_2526 | 232 |
| 639 | 3300049652 | Ga0501202_060960 | Ga0501202_060960_113_838 | 232 |
| 640 | 3300049705 | Ga0501225_0022612 | Ga0501225_0022612_32_757 | 232 |
| 641 | 3300049742 | Ga0501080_0008305 | Ga0501080_0008305_157_903 | 232 |
| 642 | 3300049742 | Ga0501080_0019084 | Ga0501080_0019084_3811_4548 | 232 |
| 643 | 3300049744 | Ga0501083_0034475 | Ga0501083_0034475_1857_2612 | 232 |
| 644 | 3300049744 | Ga0501083_0113371 | Ga0501083_0113371_384_1130 | 232 |
| 645 | 3300049760 | Ga0501263_000676 | Ga0501263_000676_872_1582 | 232 |
| 646 | 3300049822 | Ga0501035_0477033 | Ga0501035_0477033_102_839 | 232 |
| 647 | 3300049823 | Ga0501044_0250617 | Ga0501044_0250617_677_1378 | 232 |
| 648 | 3300049823 | Ga0501044_0515417 | Ga0501044_0515417_299_1045 | 232 |
| 649 | 3300049824 | Ga0501045_0095850 | Ga0501045_0095850_731_1468 | 232 |
| 650 | 3300049824 | Ga0501045_0330323 | Ga0501045_0330323_14_721 | 232 |
| 651 | 3300050492 | nmdc:mga0yw44_421452_c1 | nmdc:mga0yw44_421452_c1_51_776 | 232 |
| 652 | 3300050508 | nmdc:mga09592_155995_c1 | nmdc:mga09592_155995_c1_817_1524 | 232 |
| 653 | 3300050508 | nmdc:mga09592_30572_c1 | nmdc:mga09592_30572_c1_2759_3466 | 232 |
| 654 | 3300050509 | nmdc:mga0qj67_21225_c1 | nmdc:mga0qj67_21225_c1_1158_1877 | 232 |
| 655 | 3300050509 | nmdc:mga0qj67_7968_c1 | nmdc:mga0qj67_7968_c1_1045_1752 | 232 |
| 656 | 3300050510 | nmdc:mga06r32_11919_c1 | nmdc:mga06r32_11919_c1_1045_1752 | 232 |
| 657 | 3300050510 | nmdc:mga06r32_306167_c1 | nmdc:mga06r32_306167_c1_480_1184 | 232 |
| 658 | 3300050516 | nmdc:mga0sz30_34794_c1 | nmdc:mga0sz30_34794_c1_396_1097 | 232 |
| 659 | 3300053156 | Ga0500622_0012471 | Ga0500622_0012471_3387_4097 | 232 |
| 660 | 3300053158 | Ga0500627_0101327 | Ga0500627_0101327_22_732 | 232 |
| 661 | 3300053177 | Ga0500636_0039454 | Ga0500636_0039454_373_1083 | 232 |
| 662 | 3300054114 | Ga0501084_0012556 | Ga0501084_0012556_1046_1783 | 232 |
| 663 | 3300060353 | Ga0501082_0248973 | Ga0501082_0248973_440_1186 | 232 |
| 664 | 3300061734 | Ga0530510_0047889 | Ga0530510_0047889_1045_1782 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3pcd-assembly1.cif.gz_M | protocatechuate 3,4-dioxygenase y447h mutant | 0.9536 | 5 | 224 |
| 3t63-assembly1.cif.gz_N | axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase | 0.953 | 5 | 224 |
| 3lkt-assembly1.cif.gz_M | tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis | 0.9527 | 5 | 224 |
| 4whp-assembly1.cif.gz_D | resting protocatechuate 3,4-dioxygenase (pseudomonas putida) at ph 6.5 | 0.9521 | 5 | 224 |
| 2pcd-assembly1.cif.gz_N-2 | structure of protocatechuate 3,4-dioxygenase from pseudomonas aeruginosa at 2.15 angstroms resolution | 0.9518 | 5 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1eo2B00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.9189 | 5 | 232 | 2.60.130.10 |
| 1eo2B00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.8998 | 5 | 232 | 2.60.130.10 |
| 4iltA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7951 | 44 | 224 | 2.60.130.10 |
| 4iltA00 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7755 | 44 | 224 | 2.60.130.10 |
| 3hhyA02 | Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase | 0.7621 | 70 | 221 | 2.60.130.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F5YYG0-F1-model_v4 | Protocatechuate 34-dioxygenase beta subunit | 0.9836 | 54 | 232 |
GO:0008199
GO:0018578 GO:0019619 |
| AF-A0A7H4ML90-F1-model_v4 | Protocatechuate 34-dioxygenase subunit beta (EC 1.13.11.3) | 0.978 | 87 | 162 |
GO:0008199
GO:0018578 |
| AF-A0A382J2N4-F1-model_v4 | Intradiol ring-cleavage dioxygenases domain-containing protein | 0.9767 | 92 | 232 |
GO:0008199
GO:0016702 |
| AF-A0A838J6Y4-F1-model_v4 | Protocatechuate 3,4-dioxygenase subunit beta (EC 1.13.11.3) | 0.9752 | 14 | 221 |
GO:0008199
GO:0018578 GO:0019619 |
| AF-A0A7W1AXQ8-F1-model_v4 | Protocatechuate 3,4-dioxygenase subunit beta | 0.9747 | 52 | 231 |
GO:0008199
GO:0016702 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar