F473605

General Info

Members Datasets Scaffolds Average Seq Length
664 376 650 238

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100148431|Ga0070714_1001484311
Length 273
Sequence VGFHCCLVPGIAGCEDILRAGAHAVAITLRRGEGLHLKTELQGYRGPVAGTQPEYLHPAYISSVKRAPTQPLVSIPQTLSEVTGPQFGVDDISPCIVDLTRQHKGAPLGERIIVTGRVLDEDARPMAHTLVEVWQANAAGRYLHTIDQHDAPLDPNFTGCGHTLTDADGHYRFITIKPGCYPWRNHHNAWRPAHIHFSLFGPAFATRLVTQMYFPGDPLLASDPIYNCTADEEARKRLVSVFDWETTVPETALGYRFDIVLRGREQTPMEGSE

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
3 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
4 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
5 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
6 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
7 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
8 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
9 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
10 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
11 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
12 2920879853 Kocuria salina CV6 Isolate Unclassified
13 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
14 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
15 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
110 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
171 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
178 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
179 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
184 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
185 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
186 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
187 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
192 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
193 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
200 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
203 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
204 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
205 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
206 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
207 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
208 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
209 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
210 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
238 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
241 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
242 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
245 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
246 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
247 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
248 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
249 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
254 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
258 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
261 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
264 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
265 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
273 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
280 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
281 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
292 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
293 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
294 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
295 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
296 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
297 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
301 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
334 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
340 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
343 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
356 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
361 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
362 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
363 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
364 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
365 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
366 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
367 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
368 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
371 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
372 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
373 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
374 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
375 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
376 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.75
Isolates 2.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.33
Nodule 0.6
Rhizoplane 3.01
Rhizosphere 84.19
Stem 0
Stem Tuber 0.15
Unclassified 5.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24035J26624_1009571 3300002126 Bacteria 956
2 JGI25156J39149_1006284 3300002705 Bacteria 3268
3 JGI25164J39214_1001746 3300002772 Bacteria 4313
4 JGI25165J46597_1000004 3300003214 Bacteria 667510
5 JGI25160J50197_1008717 3300003354 Bacteria 3840
6 Ga0055540_1042764 3300003792 Bacteria 969
7 Ga0065712_10075868 3300005290 Bacteria 3774
8 Ga0065715_10018959 3300005293 Bacteria 2229
9 Ga0070683_100073554 3300005329 Bacteria 3191
10 Ga0070683_100124624 3300005329 Bacteria 2435
11 Ga0070683_100168185 3300005329 Bacteria 2080
12 Ga0070683_100187069 3300005329 Bacteria 1966
13 Ga0070683_100508717 3300005329 Bacteria 1151
14 Ga0070690_100333068 3300005330 Bacteria 1097
15 Ga0070670_100004072 3300005331 Bacteria 12208
16 Ga0070670_100068491 3300005331 Bacteria 3046
17 Ga0070670_100179243 3300005331 Bacteria 1839
18 Ga0068869_100014092 3300005334 Bacteria 5335
19 Ga0070666_10310826 3300005335 Bacteria 1123
20 Ga0070682_100104356 3300005337 Bacteria 1877
21 Ga0070660_100304047 3300005339 Bacteria 1308
22 Ga0070689_100031317 3300005340 Bacteria 4042
23 Ga0070689_100033349 3300005340 Bacteria 3923
24 Ga0070689_100070580 3300005340 Bacteria 2728
25 Ga0070661_100179530 3300005344 Bacteria 1610
26 Ga0070674_100044539 3300005356 Bacteria 3026
27 Ga0070673_100628555 3300005364 Bacteria 981
28 Ga0070688_100610178 3300005365 Bacteria 836
29 Ga0070667_100086872 3300005367 Bacteria 2684
30 Ga0070709_10026270 3300005434 Bacteria 3449
31 Ga0070714_100034440 3300005435 Bacteria 4241
32 Ga0070714_100148431 3300005435 Bacteria 2110
33 Ga0070714_100662021 3300005435 Bacteria 1006
34 Ga0070714_100733518 3300005435 Bacteria 954
35 Ga0070713_100014911 3300005436 Bacteria 5786
36 Ga0070713_100028199 3300005436 Bacteria 4432
37 Ga0070713_100163342 3300005436 Bacteria 1989
38 Ga0070713_100821324 3300005436 Bacteria 892
39 Ga0070710_10216034 3300005437 Bacteria 1218
40 Ga0070701_10015096 3300005438 Bacteria 3558
41 Ga0070711_100011172 3300005439 Bacteria 5568
42 Ga0070711_100043640 3300005439 Bacteria 3038
43 Ga0070705_100032151 3300005440 Bacteria 2912
44 Ga0070694_100063897 3300005444 Bacteria 2518
45 Ga0070708_100036904 3300005445 Bacteria 4262
46 Ga0070678_100051045 3300005456 Bacteria 2995
47 Ga0070662_100518242 3300005457 Bacteria 996
48 Ga0070681_10000304 3300005458 Bacteria 39863
49 Ga0070681_10000747 3300005458 Bacteria 26992
50 Ga0070681_10021101 3300005458 Bacteria 6526
51 Ga0070681_10021818 3300005458 Bacteria 6422
52 Ga0070681_10024461 3300005458 Bacteria 6080
53 Ga0068867_100006678 3300005459 Bacteria 8158
54 Ga0070706_100798993 3300005467 Bacteria 873
55 Ga0070707_100013355 3300005468 Bacteria 7682
56 Ga0070707_100016015 3300005468 Bacteria 7034
57 Ga0070707_100176507 3300005468 Bacteria 2082
58 Ga0070698_100004028 3300005471 Bacteria 16171
59 Ga0070699_100285020 3300005518 Bacteria 1480
60 Ga0070679_100024816 3300005530 Bacteria 5876
61 Ga0070679_100033468 3300005530 Bacteria 5090
62 Ga0070679_100119756 3300005530 Bacteria 2617
63 Ga0070684_100060840 3300005535 Bacteria 3304
64 Ga0070684_100072504 3300005535 Bacteria 3032
65 Ga0070697_100005154 3300005536 Bacteria 10036
66 Ga0070697_100039013 3300005536 Bacteria 3839
67 Ga0070697_100303087 3300005536 Bacteria 1373
68 Ga0068853_100123859 3300005539 Bacteria 2308
69 Ga0068853_100201020 3300005539 Bacteria 1813
70 Ga0068853_100518421 3300005539 Bacteria 1127
71 Ga0070695_100213026 3300005545 Bacteria 1388
72 Ga0070693_100091312 3300005547 Bacteria 1836
73 Ga0070693_100098984 3300005547 Bacteria 1773
74 Ga0070665_100005312 3300005548 Bacteria 13304
75 Ga0070665_100090631 3300005548 Bacteria 3063
76 Ga0068855_100000563 3300005563 Bacteria 45518
77 Ga0068855_100051557 3300005563 Bacteria 4847
78 Ga0068855_100405070 3300005563 Bacteria 1494
79 Ga0070664_100000879 3300005564 Bacteria 23312
80 Ga0070664_100147124 3300005564 Bacteria 2078
81 Ga0068857_100000022 3300005577 Bacteria 87864
82 Ga0068857_100002691 3300005577 Bacteria 14592
83 Ga0068857_100038259 3300005577 Bacteria 4249
84 Ga0068857_100209430 3300005577 Bacteria 1779
85 Ga0068854_100007043 3300005578 Bacteria 7177
86 Ga0068854_100009020 3300005578 Bacteria 6427
87 Ga0068854_100408437 3300005578 Bacteria 1125
88 Ga0068856_100000448 3300005614 Bacteria 45521
89 Ga0068856_100002645 3300005614 Bacteria 18368
90 Ga0068852_100538622 3300005616 Bacteria 1167
91 Ga0068859_100000885 3300005617 Bacteria 30517
92 Ga0068859_100065693 3300005617 Bacteria 3661
93 Ga0068859_100123537 3300005617 Bacteria 2656
94 Ga0068859_100182041 3300005617 Bacteria 2184
95 Ga0068864_100001248 3300005618 Bacteria 21136
96 Ga0068864_100291991 3300005618 Bacteria 1524
97 Ga0068864_100330612 3300005618 Bacteria 1434
98 Ga0068866_10000934 3300005718 Bacteria 12833
99 Ga0068861_100236334 3300005719 Bacteria 1552
100 Ga0068863_100105879 3300005841 Bacteria 2676
101 Ga0068863_100195737 3300005841 Bacteria 1943
102 Ga0068863_100229718 3300005841 Bacteria 1789
103 Ga0068858_100001352 3300005842 Bacteria 25271
104 Ga0068858_100014743 3300005842 Bacteria 7355
105 Ga0068858_100475468 3300005842 Bacteria 1206
106 Ga0068860_100003736 3300005843 Bacteria 15663
107 Ga0068860_100005346 3300005843 Bacteria 13033
108 Ga0068860_100024758 3300005843 Bacteria 5798
109 Ga0068862_100039154 3300005844 Bacteria 4025
110 Ga0081455_10062033 3300005937 Bacteria 3143
111 Ga0081455_10113916 3300005937 Bacteria 2144
112 Ga0081538_10057902 3300005981 Bacteria 2253
113 Ga0081540_1000873 3300005983 Bacteria 27254
114 Ga0081539_10024363 3300005985 Bacteria 3929
115 Ga0070717_10046226 3300006028 Bacteria 3561
116 Ga0070717_10105767 3300006028 Bacteria 2395
117 Ga0070712_100000897 3300006175 Bacteria 17835
118 Ga0070712_100055596 3300006175 Bacteria 2772
119 Ga0070712_100144569 3300006175 Bacteria 1819
120 Ga0075362_10021997 3300006177 Bacteria 2682
121 Ga0075369_10000896 3300006186 Bacteria 9871
122 Ga0097621_100000279 3300006237 Bacteria 34252
123 Ga0097621_100057804 3300006237 Bacteria 3173
124 Ga0075370_10281585 3300006353 Bacteria 988
125 Ga0068871_100000304 3300006358 Bacteria 34254
126 Ga0068871_100031688 3300006358 Bacteria 4171
127 Ga0068871_100340201 3300006358 Bacteria 1325
128 Ga0075428_100031684 3300006844 Bacteria 5841
129 Ga0075428_100145115 3300006844 Bacteria 2580
130 Ga0075430_100010560 3300006846 Bacteria 7818
131 Ga0075430_100161430 3300006846 Bacteria 1865
132 Ga0075431_100062743 3300006847 Bacteria 3834
133 Ga0075431_100392497 3300006847 Bacteria 1390
134 Ga0075431_100427028 3300006847 Bacteria 1324
135 Ga0075429_100019449 3300006880 Bacteria 5883
136 Ga0075429_100224317 3300006880 Bacteria 1646
137 Ga0097620_100000885 3300006931 Bacteria 30517
138 Ga0097620_100065696 3300006931 Bacteria 3661
139 Ga0097620_100123538 3300006931 Bacteria 2656
140 Ga0097620_100182033 3300006931 Bacteria 2184
141 Ga0099826_10000036 3300006948 Bacteria 104982
142 Ga0075435_100100381 3300007076 Bacteria 2398
143 Ga0105251_10020078 3300009011 Bacteria 3516
144 Ga0105240_10007213 3300009093 Bacteria 16187
145 Ga0105240_10025266 3300009093 Bacteria 7810
146 Ga0105245_10461464 3300009098 Bacteria 1280
147 Ga0105245_10652617 3300009098 Bacteria 1082
148 Ga0105241_10047938 3300009174 Bacteria 3250
149 Ga0105241_10119796 3300009174 Bacteria 2118
150 Ga0105242_10118424 3300009176 Bacteria 2268
151 Ga0105248_10420181 3300009177 Bacteria 1506
152 Ga0105248_10588625 3300009177 Bacteria 1255
153 Ga0105248_11311793 3300009177 Bacteria 819
154 Ga0105237_10004260 3300009545 Bacteria 16634
155 Ga0105237_10077670 3300009545 Bacteria 3310
156 Ga0105237_10113762 3300009545 Bacteria 2698
157 Ga0105237_10127292 3300009545 Bacteria 2541
158 Ga0105238_10002919 3300009551 Bacteria 17068
159 Ga0105238_10027383 3300009551 Bacteria 5807
160 Ga0105249_10540294 3300009553 Bacteria 1215
161 Ga0105239_10041668 3300010375 Bacteria 5031
162 Ga0105239_10058972 3300010375 Bacteria 4213
163 Ga0105239_10145496 3300010375 Bacteria 2643
164 Ga0105239_10410719 3300010375 Bacteria 1533
165 Ga0105239_10814026 3300010375 Bacteria 1070
166 Ga0105239_10866644 3300010375 Bacteria 1036
167 Ga0157370_10058618 3300013104 Bacteria 3659
168 Ga0157369_10000243 3300013105 Bacteria 75602
169 Ga0157374_10001216 3300013296 Bacteria 22009
170 Ga0157378_10115644 3300013297 Bacteria 2465
171 Ga0157372_10015924 3300013307 Bacteria 8063
172 Ga0157372_10250419 3300013307 Bacteria 2056
173 Ga0157372_10523405 3300013307 Bacteria 1382
174 Ga0157375_11321365 3300013308 Bacteria 848
175 Ga0157380_10095356 3300014326 Bacteria 2465
176 Ga0157379_10348051 3300014968 Bacteria 1356
177 Ga0213876_10035150 3300021384 Bacteria 2643
178 Ga0213876_10042184 3300021384 Bacteria 2411
179 Ga0213876_10095971 3300021384 Unclassified 1571
180 Ga0224571_100778 3300022734 Bacteria 1874
181 Ga0224572_1011723 3300024225 Bacteria 1659
182 Ga0224572_1034160 3300024225 Bacteria 966
183 Ga0228598_1003353 3300024227 Bacteria 3447
184 Ga0207427_100052 3300025231 Bacteria 218228
185 Ga0209437_100588 3300025233 Bacteria 23128
186 Ga0209026_1005874 3300025250 Bacteria 3163
187 Ga0209233_1000001 3300025261 Bacteria 2992747
188 Ga0207426_1001350 3300025302 Bacteria 20814
189 Ga0207426_1010784 3300025302 Bacteria 3527
190 Ga0207426_1039543 3300025302 Bacteria 1476
191 Ga0209051_1069011 3300025303 Bacteria 1073
192 Ga0207697_10002151 3300025315 Bacteria 10326
193 Ga0207713_1059624 3300025735 Bacteria 1463
194 Ga0207692_10032122 3300025898 Unclassified 2520
195 Ga0207688_10009808 3300025901 Bacteria 5210
196 Ga0207680_10467931 3300025903 Bacteria 896
197 Ga0207647_10089517 3300025904 Bacteria 1837
198 Ga0207699_10119581 3300025906 Bacteria 1702
199 Ga0207645_10281917 3300025907 Bacteria 1104
200 Ga0207684_10098467 3300025910 Bacteria 2498
201 Ga0207654_10082024 3300025911 Bacteria 1943
202 Ga0207707_10001814 3300025912 Bacteria 19598
203 Ga0207707_10003521 3300025912 Bacteria 13865
204 Ga0207707_10083323 3300025912 Bacteria 2792
205 Ga0207695_10020070 3300025913 Bacteria 7667
206 Ga0207695_10036559 3300025913 Bacteria 5308
207 Ga0207695_10267520 3300025913 Bacteria 1606
208 Ga0207671_10056312 3300025914 Bacteria 2913
209 Ga0207671_10078067 3300025914 Bacteria 2479
210 Ga0207693_10015053 3300025915 Bacteria 6209
211 Ga0207693_10034939 3300025915 Bacteria 3965
212 Ga0207693_10089856 3300025915 Bacteria 2407
213 Ga0207663_10022626 3300025916 Bacteria 3597
214 Ga0207663_10025717 3300025916 Bacteria 3407
215 Ga0207663_10111069 3300025916 Bacteria 1860
216 Ga0207663_10146180 3300025916 Bacteria 1653
217 Ga0207663_10154977 3300025916 Bacteria 1610
218 Ga0207657_10184221 3300025919 Bacteria 1687
219 Ga0207652_10003767 3300025921 Bacteria 12413
220 Ga0207652_10009905 3300025921 Bacteria 7669
221 Ga0207652_10123612 3300025921 Bacteria 2304
222 Ga0207652_10640565 3300025921 Bacteria 951
223 Ga0207646_10013154 3300025922 Bacteria 7919
224 Ga0207646_10074267 3300025922 Bacteria 3037
225 Ga0207646_10103448 3300025922 Bacteria 2554
226 Ga0207646_10155012 3300025922 Bacteria 2066
227 Ga0207646_10358220 3300025922 Bacteria 1318
228 Ga0207694_10000896 3300025924 Bacteria 26371
229 Ga0207694_10036803 3300025924 Bacteria 3756
230 Ga0207694_10089884 3300025924 Bacteria 2422
231 Ga0207650_10020298 3300025925 Bacteria 4684
232 Ga0207650_10034595 3300025925 Bacteria 3665
233 Ga0207650_10050834 3300025925 Bacteria 3066
234 Ga0207659_10290469 3300025926 Bacteria 1339
235 Ga0207700_10052042 3300025928 Bacteria 3060
236 Ga0207700_10089216 3300025928 Bacteria 2430
237 Ga0207664_10199227 3300025929 Bacteria 1727
238 Ga0207664_10552658 3300025929 Bacteria 1033
239 Ga0207664_10581100 3300025929 Bacteria 1006
240 Ga0207706_10367160 3300025933 Bacteria 1250
241 Ga0207709_10338180 3300025935 Bacteria 1132
242 Ga0207670_10013183 3300025936 Bacteria 4864
243 Ga0207670_10051690 3300025936 Bacteria 2760
244 Ga0207670_10060659 3300025936 Bacteria 2578
245 Ga0207670_10270796 3300025936 Bacteria 1320
246 Ga0207669_10009321 3300025937 Bacteria 4668
247 Ga0207704_10486414 3300025938 Bacteria 992
248 Ga0207665_10000176 3300025939 Bacteria 42953
249 Ga0207665_10058247 3300025939 Bacteria 2611
250 Ga0207665_10098532 3300025939 Bacteria 2037
251 Ga0207691_10387791 3300025940 Bacteria 1192
252 Ga0207711_10096831 3300025941 Bacteria 2604
253 Ga0207711_10260741 3300025941 Bacteria 1593
254 Ga0207689_10065680 3300025942 Bacteria 2984
255 Ga0207689_10447755 3300025942 Bacteria 1079
256 Ga0207661_10348936 3300025944 Bacteria 1335
257 Ga0207679_10001790 3300025945 Bacteria 13372
258 Ga0207679_10880911 3300025945 Bacteria 818
259 Ga0207667_10000302 3300025949 Bacteria 68245
260 Ga0207667_10027794 3300025949 Bacteria 6152
261 Ga0207667_10169733 3300025949 Bacteria 2242
262 Ga0207667_10767741 3300025949 Bacteria 962
263 Ga0207651_10058532 3300025960 Bacteria 2664
264 Ga0207651_10196936 3300025960 Bacteria 1611
265 Ga0207651_10576133 3300025960 Bacteria 981
266 Ga0207640_10002615 3300025981 Bacteria 9649
267 Ga0207658_10613866 3300025986 Bacteria 978
268 Ga0207677_10168654 3300026023 Bacteria 1709
269 Ga0207677_10494213 3300026023 Bacteria 1056
270 Ga0207703_10001842 3300026035 Bacteria 18897
271 Ga0207703_10063941 3300026035 Bacteria 3018
272 Ga0207703_10382842 3300026035 Bacteria 1302
273 Ga0207639_10020277 3300026041 Bacteria 4756
274 Ga0207639_10032909 3300026041 Bacteria 3821
275 Ga0207639_10049051 3300026041 Bacteria 3199
276 Ga0207678_10089478 3300026067 Bacteria 2631
277 Ga0207708_10527882 3300026075 Bacteria 993
278 Ga0207702_10000120 3300026078 Bacteria 91853
279 Ga0207702_10029438 3300026078 Bacteria 4570
280 Ga0207641_10054475 3300026088 Bacteria 3394
281 Ga0207648_10015149 3300026089 Bacteria 7097
282 Ga0207676_10009792 3300026095 Bacteria 6815
283 Ga0207676_10277223 3300026095 Bacteria 1521
284 Ga0207676_10709904 3300026095 Bacteria 975
285 Ga0207674_10000056 3300026116 Bacteria 113265
286 Ga0207674_10010860 3300026116 Bacteria 10264
287 Ga0207674_10017511 3300026116 Bacteria 7816
288 Ga0207674_10230429 3300026116 Bacteria 1800
289 Ga0207675_100411525 3300026118 Bacteria 1334
290 Ga0207683_10303045 3300026121 Bacteria 1462
291 Ga0207698_10349755 3300026142 Bacteria 1395
292 Ga0209983_1024125 3300027665 Bacteria 1279
293 Ga0209282_1000098 3300027666 Bacteria 59778
294 Ga0209971_1007986 3300027682 Bacteria 2511
295 Ga0209971_1011013 3300027682 Bacteria 2142
296 Ga0209974_10089991 3300027876 Bacteria 1063
297 Ga0265354_1000063 3300028016 Bacteria 17788
298 Ga0265354_1000477 3300028016 Bacteria 6956
299 Ga0268266_10000276 3300028379 Bacteria 84981
300 Ga0268266_10088967 3300028379 Bacteria 2703
301 Ga0268265_10025728 3300028380 Bacteria 4181
302 Ga0268264_10003976 3300028381 Bacteria 12651
303 Ga0265337_1000495 3300028556 Bacteria 20897
304 Ga0265323_10009931 3300028653 Bacteria 3872
305 Ga0265322_10016111 3300028654 Bacteria 2159
306 Ga0307515_10006236 3300028794 Bacteria 23940
307 Ga0265770_1003281 3300030878 Bacteria 2196
308 Ga0265760_10004504 3300031090 Bacteria 3997
309 Ga0265760_10030405 3300031090 Bacteria 1590
310 Ga0265760_10092412 3300031090 Bacteria 949
311 Ga0265320_10000103 3300031240 Bacteria 72829
312 Ga0265320_10088363 3300031240 Bacteria 1438
313 Ga0265325_10051040 3300031241 Bacteria 2127
314 Ga0265340_10002512 3300031247 Bacteria 10425
315 Ga0265340_10050806 3300031247 Bacteria 2010
316 Ga0265340_10122830 3300031247 Bacteria 1194
317 Ga0265339_10039977 3300031249 Bacteria 2608
318 Ga0265331_10018561 3300031250 Bacteria 3604
319 Ga0265316_10003477 3300031344 Bacteria 15920
320 Ga0265316_10013849 3300031344 Bacteria 7141
321 Ga0265316_10082071 3300031344 Bacteria 2471
322 Ga0307509_10000007 3300031507 Bacteria 409278
323 Ga0307509_10037472 3300031507 Bacteria 5301
324 Ga0307408_100424901 3300031548 Bacteria 1147
325 Ga0307408_100607909 3300031548 Bacteria 972
326 Ga0265313_10030041 3300031595 Bacteria 2803
327 Ga0265313_10038206 3300031595 Bacteria 2393
328 Ga0307508_10013489 3300031616 Bacteria 7475
329 Ga0316579_10010076 3300031691 Bacteria 3986
330 Ga0265314_10001239 3300031711 Bacteria 29122
331 Ga0265314_10199746 3300031711 Bacteria 1183
332 Ga0265342_10001720 3300031712 Bacteria 20028
333 Ga0265342_10006613 3300031712 Bacteria 8608
334 Ga0265342_10014169 3300031712 Bacteria 5304
335 Ga0316576_10260484 3300031727 Bacteria 1301
336 Ga0316576_10372833 3300031727 Bacteria 1060
337 Ga0316578_10002833 3300031728 Bacteria 7755
338 Ga0307516_10020750 3300031730 Bacteria 6783
339 Ga0307405_10023943 3300031731 Bacteria 3480
340 Ga0307405_10055092 3300031731 Bacteria 2487
341 Ga0307405_10499163 3300031731 Bacteria 975
342 Ga0307410_10019800 3300031852 Bacteria 4102
343 Ga0307410_10274933 3300031852 Bacteria 1319
344 Ga0307406_10012037 3300031901 Bacteria 4922
345 Ga0307406_10075958 3300031901 Bacteria 2218
346 Ga0307406_10190364 3300031901 Bacteria 1501
347 Ga0307407_10169949 3300031903 Bacteria 1435
348 Ga0307412_10000235 3300031911 Bacteria 36152
349 Ga0307412_10034346 3300031911 Bacteria 3232
350 Ga0307412_10051675 3300031911 Bacteria 2717
351 Ga0307412_10176353 3300031911 Bacteria 1603
352 Ga0307412_10369940 3300031911 Bacteria 1157
353 Ga0307412_10449133 3300031911 Bacteria 1062
354 Ga0307409_100135520 3300031995 Bacteria 2112
355 Ga0307409_100539916 3300031995 Bacteria 1143
356 Ga0307409_100643531 3300031995 Bacteria 1053
357 Ga0307416_100002923 3300032002 Bacteria 9956
358 Ga0307416_100158591 3300032002 Bacteria 2087
359 Ga0307416_100625402 3300032002 Bacteria 1159
360 Ga0307414_10451508 3300032004 Bacteria 1127
361 Ga0307411_10114212 3300032005 Bacteria 1940
362 Ga0307415_100118006 3300032126 Bacteria 1983
363 Ga0316583_10014321 3300032133 Bacteria 2860
364 Ga0316593_10003223 3300032168 Bacteria 4012
365 Ga0373949_0016852 3300035090 Bacteria 1642
366 Ga0373923_0021658 3300035111 Bacteria 2512
367 Ga0373945_0150316 3300035116 Bacteria 944
368 Ga0373953_0200678 3300035117 Bacteria 863
369 Ga0373954_0050841 3300035118 Bacteria 1945
370 Ga0373954_0243177 3300035118 Bacteria 885
371 Ga0373956_0161424 3300035119 Bacteria 1056
372 Ga0373943_0155445 3300035170 Bacteria 1242
373 Ga0373946_0118360 3300035171 Bacteria 1207
374 Ga0373961_0000022 3300035241 Bacteria 99478
375 Ga0373931_0044351 3300035691 Bacteria 2345
376 Ga0373935_0136145 3300035692 Bacteria 1655
377 Ga0373935_0332610 3300035692 Bacteria 1080
378 Ga0373927_0212464 3300035695 Bacteria 1271
379 Ga0373947_0009228 3300035725 Bacteria 5670
380 Ga0373947_0374073 3300035725 Bacteria 958
381 Ga0373937_0012388 3300036401 Bacteria 7499
382 Ga0373937_0153780 3300036401 Bacteria 2156
383 Ga0373937_0484964 3300036401 Bacteria 1174
384 Ga0316582_0018694 3300036647 Bacteria 4039
385 Ga0316584_0129768 3300036712 Bacteria 1883
386 Ga0373925_0002554 3300037068 Bacteria 14495
387 Ga0395899_0006462 3300037312 Bacteria 9081
388 Ga0395899_0155719 3300037312 Bacteria 1617
389 Ga0395900_0018716 3300037418 Bacteria 7063
390 Ga0395900_0021784 3300037418 Bacteria 6553
391 Ga0395900_0037480 3300037418 Bacteria 4999
392 Ga0395900_0522234 3300037418 Bacteria 1135
393 Ga0395898_0048364 3300037466 Bacteria 4171
394 Ga0395905_0036015 3300037471 Bacteria 4647
395 Ga0395905_0540977 3300037471 Bacteria 1066
396 Ga0316581_0006167 3300037588 Bacteria 3159
397 Ga0436364_0173605 3300037853 Bacteria 6482
398 Ga0395901_0003336 3300038443 Bacteria 16173
399 Ga0395901_0458091 3300038443 Bacteria 1303
400 Ga0400483_003250 3300039062 Bacteria 7949
401 Ga0400483_218392 3300039062 Bacteria 1065
402 Ga0436365_0252180 3300039437 Bacteria 6751
403 Ga0436365_0694215 3300039437 Bacteria 3899
404 Ga0436365_1272561 3300039437 Bacteria 17734
405 Ga0436360_0394835 3300039438 Bacteria 1392
406 Ga0436360_0994159 3300039438 Bacteria 1992
407 Ga0436361_0121746 3300039447 Bacteria 1451
408 Ga0436361_0386399 3300039447 Bacteria 1355
409 Ga0436361_1142624 3300039447 Bacteria 3810
410 Ga0436362_0680558 3300039453 Bacteria 831
411 Ga0436362_0870707 3300039453 Bacteria 1015
412 Ga0451797_1494958 3300041453 Bacteria 2026
413 Ga0451837_0363295 3300041494 Bacteria 1002
414 Ga0451843_0385278 3300041509 Bacteria 2082
415 Ga0451853_2377865 3300041512 Bacteria 5550
416 Ga0439451_027425 3300042009 Bacteria 1148
417 Ga0439459_0025286 3300042438 Bacteria 1171
418 Ga0439460_0047890 3300042461 Bacteria 1274
419 Ga0466965_0010250 3300044683 Bacteria 4366
420 Ga0451576_0086375 3300045051 Bacteria 3263
421 Ga0466967_0278983 3300045976 Bacteria 1603
422 Ga0466967_0428636 3300045976 Bacteria 1290
423 Ga0495651_0176181 3300046462 Bacteria 1518
424 Ga0495651_0284323 3300046462 Bacteria 1116
425 Ga0495653_0020662 3300046463 Bacteria 5334
426 Ga0495580_0008165 3300046472 Bacteria 8339
427 Ga0495580_0144653 3300046472 Bacteria 1648
428 Ga0495580_0279016 3300046472 Bacteria 1140
429 Ga0495605_0002172 3300046474 Bacteria 12251
430 Ga0495664_0084305 3300046477 Bacteria 1907
431 Ga0495664_0309053 3300046477 Bacteria 954
432 Ga0495596_0000145 3300046500 Bacteria 48986
433 Ga0495607_0000021 3300046501 Bacteria 164571
434 Ga0495607_0003718 3300046501 Bacteria 11564
435 Ga0495608_0019310 3300046511 Bacteria 4692
436 Ga0495610_0000358 3300046512 Bacteria 47626
437 Ga0495616_0010431 3300046513 Bacteria 5377
438 Ga0495628_0027367 3300046516 Bacteria 4641
439 Ga0495628_0064494 3300046516 Bacteria 2868
440 Ga0495630_0334410 3300046517 Bacteria 1158
441 Ga0495630_0397676 3300046517 Bacteria 1056
442 Ga0495643_0032426 3300046522 Bacteria 2900
443 Ga0495644_0047069 3300046523 Bacteria 1621
444 Ga0495648_0024963 3300046524 Bacteria 4057
445 Ga0495652_0028644 3300046529 Bacteria 4899
446 Ga0495652_0158598 3300046529 Bacteria 1759
447 Ga0495640_0173793 3300046533 Bacteria 1376
448 Ga0495587_0017739 3300046536 Bacteria 4419
449 Ga0495609_0009934 3300046538 Bacteria 4585
450 Ga0495597_0053502 3300046542 Bacteria 1775
451 Ga0495645_0021685 3300046543 Bacteria 4643
452 Ga0495645_0058901 3300046543 Bacteria 2786
453 Ga0495667_0005798 3300046559 Bacteria 8369
454 Ga0495667_0039080 3300046559 Bacteria 3158
455 Ga0495635_0045907 3300046663 Bacteria 3014
456 Ga0495635_0079796 3300046663 Bacteria 2240
457 Ga0495661_0011823 3300046665 Bacteria 5912
458 Ga0495623_0013926 3300046679 Bacteria 5214
459 Ga0495623_0194226 3300046679 Bacteria 1171
460 Ga0495646_0035343 3300046680 Bacteria 3100
461 Ga0495658_0124084 3300046683 Bacteria 1565
462 Ga0495669_0182712 3300046684 Bacteria 1000
463 Ga0495671_0006024 3300046692 Bacteria 7046
464 Ga0495649_0009020 3300046694 Bacteria 5955
465 Ga0495589_0097158 3300046794 Bacteria 1427
466 Ga0495600_0006876 3300046809 Bacteria 6936
467 Ga0495604_0001357 3300047317 Bacteria 20014
468 Ga0495604_0154369 3300047317 Bacteria 1628
469 Ga0495604_0223049 3300047317 Bacteria 1297
470 Ga0495604_0265529 3300047317 Bacteria 1165
471 Ga0495674_0016327 3300047319 Bacteria 6922
472 Ga0495674_0137091 3300047319 Bacteria 2058
473 Ga0495674_0321300 3300047319 Bacteria 1261
474 Ga0495672_0003805 3300047320 Bacteria 12705
475 Ga0495680_0021296 3300047322 Bacteria 5430
476 Ga0495680_0071200 3300047322 Bacteria 2648
477 Ga0495675_0002040 3300047444 Bacteria 12084
478 Ga0495675_0177658 3300047444 Bacteria 1305
479 Ga0495675_0237251 3300047444 Bacteria 1099
480 Ga0495675_0442897 3300047444 Bacteria 752
481 Ga0495685_002240 3300047447 Bacteria 6026
482 Ga0495684_0009756 3300047471 Bacteria 7409
483 Ga0496100_0278906 3300048903 Bacteria 1245
484 Ga0496101_0192624 3300048904 Bacteria 1574
485 Ga0496101_0374066 3300048904 Bacteria 1120
486 Ga0496103_0352455 3300048906 Bacteria 946
487 Ga0496104_0061218 3300048907 Bacteria 3568
488 Ga0496108_0070791 3300048911 Bacteria 2943
489 Ga0496109_0040990 3300048912 Bacteria 4195
490 Ga0496109_0096858 3300048912 Bacteria 2734
491 Ga0496109_0193284 3300048912 Bacteria 1912
492 Ga0496110_0016748 3300048913 Bacteria 6124
493 Ga0496110_0088480 3300048913 Bacteria 2766
494 Ga0496110_0096586 3300048913 Bacteria 2648
495 Ga0496111_0042537 3300048914 Bacteria 3263
496 Ga0496112_0004054 3300048915 Bacteria 12292
497 Ga0496112_0018421 3300048915 Bacteria 6574
498 Ga0496114_0079493 3300048917 Bacteria 2768
499 Ga0496114_0104925 3300048917 Bacteria 2417
500 Ga0496115_0227301 3300048918 Bacteria 1539
501 Ga0496115_0293825 3300048918 Bacteria 1332
502 Ga0496116_0009306 3300048919 Bacteria 8393
503 Ga0496116_0013463 3300048919 Bacteria 6593
504 Ga0496119_0059557 3300048922 Bacteria 2293
505 Ga0496121_0000444 3300048924 Bacteria 81596
506 Ga0496121_0023152 3300048924 Bacteria 5996
507 Ga0496122_0006772 3300048925 Bacteria 13028
508 Ga0496122_0234301 3300048925 Bacteria 1041
509 Ga0496123_0001730 3300048926 Bacteria 28930
510 Ga0496123_0022278 3300048926 Bacteria 4889
511 Ga0496124_0038248 3300048927 Bacteria 4168
512 Ga0496125_0203949 3300048928 Bacteria 1291
513 Ga0496126_0127385 3300048929 Bacteria 2202
514 Ga0501299_046320 3300049522 Bacteria 887
515 Ga0501031_0082131 3300049568 Bacteria 2101
516 Ga0501033_0137498 3300049570 Bacteria 1768
517 Ga0501033_0165082 3300049570 Bacteria 1592
518 Ga0501034_0002554 3300049571 Bacteria 21716
519 Ga0501034_0167837 3300049571 Bacteria 2163
520 Ga0501034_0581888 3300049571 Bacteria 1026
521 Ga0501036_0007624 3300049572 Bacteria 8833
522 Ga0501036_0107404 3300049572 Bacteria 2360
523 Ga0501038_0007405 3300049574 Bacteria 10124
524 Ga0501038_0285638 3300049574 Bacteria 1298
525 Ga0501038_0362381 3300049574 Bacteria 1127
526 Ga0501039_0060821 3300049575 Bacteria 2925
527 Ga0501039_0160290 3300049575 Bacteria 1768
528 Ga0501039_0215325 3300049575 Bacteria 1510
529 Ga0501040_0029705 3300049576 Bacteria 3690
530 Ga0501040_0035020 3300049576 Bacteria 3403
531 Ga0501040_0084392 3300049576 Bacteria 2203
532 Ga0501040_0085010 3300049576 Bacteria 2196
533 Ga0501040_0494333 3300049576 Bacteria 882
534 Ga0501040_0508115 3300049576 Bacteria 869
535 Ga0501041_0010800 3300049577 Bacteria 5386
536 Ga0501041_0119548 3300049577 Bacteria 1637
537 Ga0501041_0139203 3300049577 Bacteria 1513
538 Ga0501042_0030504 3300049578 Bacteria 3808
539 Ga0501042_0180209 3300049578 Bacteria 1524
540 Ga0501043_0090508 3300049579 Bacteria 2406
541 Ga0501043_0102700 3300049579 Bacteria 2247
542 Ga0501043_0158217 3300049579 Bacteria 1771
543 Ga0501046_0148131 3300049580 Bacteria 1772
544 Ga0501046_0180016 3300049580 Bacteria 1581
545 Ga0501046_0273090 3300049580 Bacteria 1240
546 Ga0501047_0012523 3300049581 Bacteria 8033
547 Ga0501048_0021038 3300049582 Bacteria 4779
548 Ga0501048_0049581 3300049582 Bacteria 2992
549 Ga0501048_0116522 3300049582 Bacteria 1887
550 Ga0501067_0139523 3300049583 Bacteria 1350
551 Ga0501067_0235638 3300049583 Bacteria 1018
552 Ga0501068_0035178 3300049584 Bacteria 2989
553 Ga0501069_0407516 3300049585 Bacteria 805
554 Ga0501070_0095803 3300049586 Bacteria 2455
555 Ga0501071_0034529 3300049587 Bacteria 3600
556 Ga0501071_0280674 3300049587 Bacteria 1260
557 Ga0501072_0000978 3300049588 Bacteria 21105
558 Ga0501072_0011768 3300049588 Bacteria 6683
559 Ga0501072_0016152 3300049588 Bacteria 5726
560 Ga0501072_0029570 3300049588 Bacteria 4281
561 Ga0501073_0002116 3300049589 Bacteria 14879
562 Ga0501073_0040672 3300049589 Bacteria 3288
563 Ga0501073_0077868 3300049589 Bacteria 2307
564 Ga0501074_0040093 3300049590 Bacteria 3392
565 Ga0501074_0058878 3300049590 Bacteria 2768
566 Ga0501074_0068939 3300049590 Bacteria 2543
567 Ga0501074_0145349 3300049590 Bacteria 1696
568 Ga0501075_0000016 3300049591 Bacteria 70964
569 Ga0501075_0030254 3300049591 Bacteria 4010
570 Ga0501075_0157761 3300049591 Bacteria 1730
571 Ga0501075_0498687 3300049591 Bacteria 929
572 Ga0501076_0000053 3300049592 Bacteria 56853
573 Ga0501076_0029073 3300049592 Bacteria 4296
574 Ga0501076_0106481 3300049592 Bacteria 2264
575 Ga0501077_0032712 3300049593 Bacteria 3311
576 Ga0501077_0130106 3300049593 Bacteria 1596
577 Ga0501202_060960 3300049652 Bacteria 853
578 Ga0501225_0022612 3300049705 Bacteria 1736
579 Ga0501079_0006500 3300049741 Bacteria 8780
580 Ga0501079_0079549 3300049741 Bacteria 2535
581 Ga0501080_0008305 3300049742 Bacteria 9406
582 Ga0501080_0019084 3300049742 Bacteria 6348
583 Ga0501080_0029008 3300049742 Bacteria 5151
584 Ga0501081_0015484 3300049743 Bacteria 5033
585 Ga0501083_0034475 3300049744 Bacteria 3461
586 Ga0501083_0071378 3300049744 Bacteria 2309
587 Ga0501083_0113371 3300049744 Bacteria 1781
588 Ga0501083_0134277 3300049744 Bacteria 1622
589 Ga0501083_0193302 3300049744 Bacteria 1328
590 Ga0501263_000676 3300049760 Bacteria 2766
591 Ga0501035_0097702 3300049822 Bacteria 2579
592 Ga0501035_0162732 3300049822 Bacteria 1931
593 Ga0501035_0477033 3300049822 Bacteria 1029
594 Ga0501044_0250617 3300049823 Bacteria 1712
595 Ga0501044_0515417 3300049823 Bacteria 1096
596 Ga0501045_0006931 3300049824 Bacteria 7854
597 Ga0501045_0095850 3300049824 Bacteria 2195
598 Ga0501045_0330323 3300049824 Bacteria 1135
599 nmdc:mga03683_1487_c1 3300050489 Bacteria 5363
600 nmdc:mga03683_35731_c1 3300050489 Bacteria 2017
601 nmdc:mga0yw44_41216_c1 3300050492 Bacteria 2748
602 nmdc:mga0yw44_421452_c1 3300050492 Bacteria 904
603 nmdc:mga0k408_12193_c1 3300050493 Bacteria 4696
604 nmdc:mga06z11_92906_c1 3300050494 Bacteria 1641
605 nmdc:mga07m45_238987_c1 3300050496 Bacteria 1057
606 nmdc:mga05p37_440602_c1 3300050507 Bacteria 1511
607 nmdc:mga09592_155995_c1 3300050508 Bacteria 1971
608 nmdc:mga09592_30572_c1 3300050508 Bacteria 4482
609 nmdc:mga0qj67_21225_c1 3300050509 Bacteria 4981
610 nmdc:mga0qj67_7968_c1 3300050509 Bacteria 7832
611 nmdc:mga06r32_11919_c1 3300050510 Bacteria 7832
612 nmdc:mga06r32_306167_c1 3300050510 Bacteria 1574
613 nmdc:mga08y16_173588_c1 3300050511 Bacteria 2238
614 nmdc:mga08y16_246637_c1 3300050511 Bacteria 1845
615 nmdc:mga0rr50_90355_c1 3300050513 Bacteria 2383
616 nmdc:mga0sz30_34794_c1 3300050516 Bacteria 2099
617 nmdc:mga0sz30_5521_c1 3300050516 Bacteria 4644
618 Ga0495655_0007617 3300053083 Bacteria 2021
619 Ga0495619_0064799 3300053085 Bacteria 2437
620 Ga0500646_0020747 3300053090 Bacteria 1747
621 Ga0500647_0110488 3300053091 Bacteria 1307
622 Ga0500651_0312097 3300053093 Bacteria 900
623 Ga0500566_0050094 3300053094 Bacteria 2392
624 Ga0500566_0053384 3300053094 Bacteria 2307
625 Ga0500640_000889 3300053095 Bacteria 8318
626 Ga0500554_002959 3300053102 Bacteria 3409
627 Ga0500572_005566 3300053111 Bacteria 2860
628 Ga0500595_000089 3300053119 Bacteria 63090
629 Ga0500597_005808 3300053120 Bacteria 4027
630 Ga0500597_034137 3300053120 Bacteria 2110
631 Ga0500614_000332 3300053123 Bacteria 12218
632 Ga0500559_0048966 3300053136 Bacteria 1860
633 Ga0500579_185961 3300053143 Bacteria 805
634 Ga0500616_0039346 3300053153 Bacteria 2550
635 Ga0500622_0012471 3300053156 Bacteria 4601
636 Ga0500627_0101327 3300053158 Bacteria 1293
637 Ga0500636_0039454 3300053177 Bacteria 2793
638 Ga0500636_0106683 3300053177 Bacteria 1587
639 Ga0501084_0007936 3300054114 Bacteria 8740
640 Ga0501084_0012556 3300054114 Bacteria 7018
641 Ga0501084_0209126 3300054114 Bacteria 1646
642 Ga0501084_0299783 3300054114 Bacteria 1357
643 Ga0501084_0892605 3300054114 Bacteria 748
644 Ga0501082_0007898 3300060353 Bacteria 9186
645 Ga0501082_0144165 3300060353 Bacteria 2067
646 Ga0501082_0248973 3300060353 Bacteria 1546
647 Ga0530510_0000002 3300061734 Bacteria 284155
648 Ga0530510_0007581 3300061734 Bacteria 7560
649 Ga0530510_0047889 3300061734 Bacteria 3089
650 Ga0530510_0243775 3300061734 Bacteria 1338

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025936 Ga0207670_10270796 Ga0207670_102707962 191
2 3300053094 Ga0500566_0053384 Ga0500566_0053384_664_1260 196
3 3300049576 Ga0501040_0494333 Ga0501040_0494333_248_850 198
4 3300049583 Ga0501067_0139523 Ga0501067_0139523_682_1287 198
5 3300035117 Ga0373953_0200678 Ga0373953_0200678_15_782 200
6 3300005458 Ga0070681_10024461 Ga0070681_100244616 216
7 3300053094 Ga0500566_0050094 Ga0500566_0050094_990_1691 216
8 3300053095 Ga0500640_000889 Ga0500640_000889_2433_3134 216
9 3300053102 Ga0500554_002959 Ga0500554_002959_1953_2654 216
10 3300053111 Ga0500572_005566 Ga0500572_005566_489_1190 216
11 3300053119 Ga0500595_000089 Ga0500595_000089_30734_31435 216
12 3300053120 Ga0500597_034137 Ga0500597_034137_454_1155 216
13 3300053123 Ga0500614_000332 Ga0500614_000332_613_1314 216
14 3300053136 Ga0500559_0048966 Ga0500559_0048966_746_1447 216
15 3300005435 Ga0070714_100662021 Ga0070714_1006620212 219
16 3300005436 Ga0070713_100821324 Ga0070713_1008213241 219
17 3300005445 Ga0070708_100036904 Ga0070708_1000369042 219
18 3300005468 Ga0070707_100013355 Ga0070707_1000133554 219
19 3300005468 Ga0070707_100176507 Ga0070707_1001765073 219
20 3300005471 Ga0070698_100004028 Ga0070698_10000402812 219
21 3300005536 Ga0070697_100005154 Ga0070697_1000051548 219
22 3300025922 Ga0207646_10103448 Ga0207646_101034482 219
23 3300025922 Ga0207646_10358220 Ga0207646_103582202 219
24 3300025929 Ga0207664_10552658 Ga0207664_105526582 219
25 3300025939 Ga0207665_10098532 Ga0207665_100985322 219
26 3300031240 Ga0265320_10088363 Ga0265320_100883633 219
27 3300037418 Ga0395900_0522234 Ga0395900_0522234_348_1019 219
28 3300037471 Ga0395905_0540977 Ga0395905_0540977_111_782 219
29 3300005468 Ga0070707_100016015 Ga0070707_1000160157 220
30 3300025910 Ga0207684_10098467 Ga0207684_100984672 220
31 3300025922 Ga0207646_10013154 Ga0207646_100131541 220
32 3300025922 Ga0207646_10074267 Ga0207646_100742673 220
33 3300025922 Ga0207646_10155012 Ga0207646_101550121 220
34 3300035116 Ga0373945_0150316 Ga0373945_0150316_77_832 220
35 3300035170 Ga0373943_0155445 Ga0373943_0155445_274_993 220
36 3300035692 Ga0373935_0332610 Ga0373935_0332610_18_737 220
37 3300035725 Ga0373947_0009228 Ga0373947_0009228_4022_4747 220
38 3300005337 Ga0070682_100104356 Ga0070682_1001043562 221
39 3300037418 Ga0395900_0018716 Ga0395900_0018716_826_1590 221
40 3300049591 Ga0501075_0498687 Ga0501075_0498687_45_764 222
41 3300031995 Ga0307409_100643531 Ga0307409_1006435312 223
42 3300032126 Ga0307415_100118006 Ga0307415_1001180063 223
43 3300005618 Ga0068864_100330612 Ga0068864_1003306122 224
44 3300007076 Ga0075435_100100381 Ga0075435_1001003811 224
45 3300025913 Ga0207695_10267520 Ga0207695_102675202 224
46 3300025941 Ga0207711_10096831 Ga0207711_100968313 224
47 3300025942 Ga0207689_10447755 Ga0207689_104477552 224
48 3300025960 Ga0207651_10196936 Ga0207651_101969362 224
49 3300026035 Ga0207703_10382842 Ga0207703_103828422 224
50 3300026095 Ga0207676_10277223 Ga0207676_102772233 224
51 3300026118 Ga0207675_100411525 Ga0207675_1004115252 224
52 3300028380 Ga0268265_10025728 Ga0268265_100257284 224
53 3300035111 Ga0373923_0021658 Ga0373923_0021658_34_756 224
54 3300035119 Ga0373956_0161424 Ga0373956_0161424_252_974 224
55 3300036401 Ga0373937_0012388 Ga0373937_0012388_1950_2672 224
56 3300037068 Ga0373925_0002554 Ga0373925_0002554_3155_3877 224
57 3300039062 Ga0400483_003250 Ga0400483_003250_4039_4719 224
58 3300046472 Ga0495580_0279016 Ga0495580_0279016_251_973 224
59 3300047322 Ga0495680_0071200 Ga0495680_0071200_1571_2266 224
60 3300048913 Ga0496110_0096586 Ga0496110_0096586_1522_2235 224
61 3300048914 Ga0496111_0042537 Ga0496111_0042537_628_1341 224
62 3300050513 nmdc:mga0rr50_90355_c1 nmdc:mga0rr50_90355_c1_1637_2344 224
63 3300005564 Ga0070664_100147124 Ga0070664_1001471243 225
64 3300006028 Ga0070717_10046226 Ga0070717_100462264 225
65 3300009553 Ga0105249_10540294 Ga0105249_105402942 225
66 3300013308 Ga0157375_11321365 Ga0157375_113213652 225
67 3300025938 Ga0207704_10486414 Ga0207704_104864142 225
68 3300025945 Ga0207679_10880911 Ga0207679_108809111 225
69 3300026075 Ga0207708_10527882 Ga0207708_105278821 225
70 3300035695 Ga0373927_0212464 Ga0373927_0212464_212_919 225
71 3300035725 Ga0373947_0374073 Ga0373947_0374073_213_920 225
72 3300046472 Ga0495580_0144653 Ga0495580_0144653_363_1070 225
73 3300050511 nmdc:mga08y16_246637_c1 nmdc:mga08y16_246637_c1_998_1705 225
74 iso_pu_bacteria 2857479173 2857479175 225
75 iso_pu_bacteria 2870801768 2870804169 225
76 3300005518 Ga0070699_100285020 Ga0070699_1002850202 226
77 3300005340 Ga0070689_100031317 Ga0070689_1000313172 227
78 3300005340 Ga0070689_100070580 Ga0070689_1000705802 227
79 3300005438 Ga0070701_10015096 Ga0070701_100150964 227
80 3300025936 Ga0207670_10013183 Ga0207670_100131834 227
81 3300025936 Ga0207670_10051690 Ga0207670_100516903 227
82 3300025942 Ga0207689_10065680 Ga0207689_100656803 227
83 3300028794 Ga0307515_10006236 Ga0307515_100062364 227
84 3300031507 Ga0307509_10000007 Ga0307509_10000007188 227
85 3300031507 Ga0307509_10037472 Ga0307509_100374723 227
86 3300031616 Ga0307508_10013489 Ga0307508_100134893 227
87 3300031730 Ga0307516_10020750 Ga0307516_100207503 227
88 3300035118 Ga0373954_0243177 Ga0373954_0243177_90_791 227
89 3300035241 Ga0373961_0000022 Ga0373961_0000022_7368_8069 227
90 3300042009 Ga0439451_027425 Ga0439451_027425_296_1009 227
91 3300045976 Ga0466967_0278983 Ga0466967_0278983_15_701 227
92 3300050494 nmdc:mga06z11_92906_c1 nmdc:mga06z11_92906_c1_335_1024 227
93 3300053090 Ga0500646_0020747 Ga0500646_0020747_294_1013 227
94 3300053120 Ga0500597_005808 Ga0500597_005808_2092_2793 227
95 3300053143 Ga0500579_185961 Ga0500579_185961_39_758 227
96 3300053177 Ga0500636_0106683 Ga0500636_0106683_165_866 227
97 3300054114 Ga0501084_0892605 Ga0501084_0892605_13_726 227
98 iso_pu_bacteria 2852677369 2852680604 227
99 iso_pu_bacteria 2904434214 2904435019 227
100 3300002772 JGI25164J39214_1001746 JGI25164J39214_10017462 228
101 3300003214 JGI25165J46597_1000004 JGI25165J46597_1000004590 228
102 3300005329 Ga0070683_100168185 Ga0070683_1001681853 228
103 3300005329 Ga0070683_100508717 Ga0070683_1005087172 228
104 3300005456 Ga0070678_100051045 Ga0070678_1000510453 228
105 3300006177 Ga0075362_10021997 Ga0075362_100219973 228
106 3300009176 Ga0105242_10118424 Ga0105242_101184243 228
107 3300014326 Ga0157380_10095356 Ga0157380_100953563 228
108 3300025231 Ga0207427_100052 Ga0207427_10005210 228
109 3300025233 Ga0209437_100588 Ga0209437_10058817 228
110 3300025261 Ga0209233_1000001 Ga0209233_10000011958 228
111 3300025935 Ga0207709_10338180 Ga0207709_103381801 228
112 3300028556 Ga0265337_1000495 Ga0265337_100049510 228
113 3300031240 Ga0265320_10000103 Ga0265320_1000010352 228
114 3300031548 Ga0307408_100424901 Ga0307408_1004249012 228
115 3300031711 Ga0265314_10199746 Ga0265314_101997462 228
116 3300031852 Ga0307410_10274933 Ga0307410_102749332 228
117 3300031901 Ga0307406_10075958 Ga0307406_100759582 228
118 3300031903 Ga0307407_10169949 Ga0307407_101699492 228
119 3300031911 Ga0307412_10034346 Ga0307412_100343462 228
120 3300031911 Ga0307412_10051675 Ga0307412_100516752 228
121 3300032002 Ga0307416_100625402 Ga0307416_1006254022 228
122 3300037471 Ga0395905_0036015 Ga0395905_0036015_3481_4194 228
123 3300041453 Ga0451797_1494958 Ga0451797_1494958_843_1676 228
124 3300041494 Ga0451837_0363295 Ga0451837_0363295_103_891 228
125 3300041509 Ga0451843_0385278 Ga0451843_0385278_741_1598 228
126 3300041512 Ga0451853_2377865 Ga0451853_2377865_909_1697 228
127 3300044683 Ga0466965_0010250 Ga0466965_0010250_404_1231 228
128 3300045976 Ga0466967_0428636 Ga0466967_0428636_291_1121 228
129 3300046462 Ga0495651_0176181 Ga0495651_0176181_294_1160 228
130 3300046683 Ga0495658_0124084 Ga0495658_0124084_368_1141 228
131 3300048912 Ga0496109_0040990 Ga0496109_0040990_382_1161 228
132 3300048912 Ga0496109_0096858 Ga0496109_0096858_1257_2039 228
133 3300048912 Ga0496109_0193284 Ga0496109_0193284_1103_1876 228
134 3300048913 Ga0496110_0016748 Ga0496110_0016748_986_1765 228
135 3300048917 Ga0496114_0079493 Ga0496114_0079493_286_1086 228
136 3300048917 Ga0496114_0104925 Ga0496114_0104925_795_1568 228
137 3300053083 Ga0495655_0007617 Ga0495655_0007617_54_899 228
138 3300053085 Ga0495619_0064799 Ga0495619_0064799_560_1333 228
139 iso_pu_bacteria 2537561592 2537900337 228
140 iso_pu_bacteria 2554235227 2555230265 228
141 iso_pu_bacteria 2654587600 2655031283 228
142 iso_pu_bacteria 2841911363 2841915247 228
143 iso_pu_bacteria 2841917233 2841922144 228
144 iso_pu_bacteria 2884763398 2884765546 228
145 iso_pu_bacteria 2897561785 2897562802 228
146 iso_pu_bacteria 2920879853 2920882803 228
147 iso_pu_bacteria 642555113 642617788 228
148 3300005536 Ga0070697_100303087 Ga0070697_1003030872 229
149 3300005841 Ga0068863_100195737 Ga0068863_1001957373 229
150 3300009098 Ga0105245_10652617 Ga0105245_106526172 229
151 3300021384 Ga0213876_10095971 Ga0213876_100959713 229
152 3300031548 Ga0307408_100607909 Ga0307408_1006079091 229
153 3300031727 Ga0316576_10260484 Ga0316576_102604842 229
154 3300031727 Ga0316576_10372833 Ga0316576_103728331 229
155 3300031731 Ga0307405_10055092 Ga0307405_100550923 229
156 3300032168 Ga0316593_10003223 Ga0316593_100032234 229
157 3300036712 Ga0316584_0129768 Ga0316584_0129768_119_814 229
158 3300037853 Ga0436364_0173605 Ga0436364_0173605_3947_4657 229
159 3300039062 Ga0400483_218392 Ga0400483_218392_148_843 229
160 3300039437 Ga0436365_0252180 Ga0436365_0252180_5012_5713 229
161 3300039438 Ga0436360_0394835 Ga0436360_0394835_431_1147 229
162 3300049589 Ga0501073_0002116 Ga0501073_0002116_3216_3923 229
163 3300049744 Ga0501083_0193302 Ga0501083_0193302_437_1144 229
164 3300050507 nmdc:mga05p37_440602_c1 nmdc:mga05p37_440602_c1_715_1458 229
165 iso_pu_bacteria 2941479691 2941482696 229
166 3300002705 JGI25156J39149_1006284 JGI25156J39149_10062842 230
167 3300003354 JGI25160J50197_1008717 JGI25160J50197_10087172 230
168 3300005458 Ga0070681_10021101 Ga0070681_100211017 230
169 3300005530 Ga0070679_100119756 Ga0070679_1001197562 230
170 3300005563 Ga0068855_100405070 Ga0068855_1004050702 230
171 3300005577 Ga0068857_100209430 Ga0068857_1002094302 230
172 3300005842 Ga0068858_100014743 Ga0068858_1000147434 230
173 3300005937 Ga0081455_10062033 Ga0081455_100620333 230
174 3300005937 Ga0081455_10113916 Ga0081455_101139162 230
175 3300005981 Ga0081538_10057902 Ga0081538_100579022 230
176 3300005985 Ga0081539_10024363 Ga0081539_100243633 230
177 3300006186 Ga0075369_10000896 Ga0075369_100008966 230
178 3300006353 Ga0075370_10281585 Ga0075370_102815851 230
179 3300009093 Ga0105240_10025266 Ga0105240_100252667 230
180 3300025302 Ga0207426_1001350 Ga0207426_100135010 230
181 3300025912 Ga0207707_10083323 Ga0207707_100833233 230
182 3300025913 Ga0207695_10036559 Ga0207695_100365597 230
183 3300025921 Ga0207652_10009905 Ga0207652_100099054 230
184 3300025925 Ga0207650_10034595 Ga0207650_100345954 230
185 3300025949 Ga0207667_10169733 Ga0207667_101697333 230
186 3300026116 Ga0207674_10230429 Ga0207674_102304293 230
187 3300031731 Ga0307405_10499163 Ga0307405_104991631 230
188 3300035171 Ga0373946_0118360 Ga0373946_0118360_119_814 230
189 3300036401 Ga0373937_0484964 Ga0373937_0484964_337_1029 230
190 3300037312 Ga0395899_0006462 Ga0395899_0006462_5647_6342 230
191 3300037312 Ga0395899_0155719 Ga0395899_0155719_670_1365 230
192 3300037418 Ga0395900_0021784 Ga0395900_0021784_581_1276 230
193 3300037418 Ga0395900_0037480 Ga0395900_0037480_991_1686 230
194 3300037466 Ga0395898_0048364 Ga0395898_0048364_891_1586 230
195 3300038443 Ga0395901_0003336 Ga0395901_0003336_11999_12694 230
196 3300038443 Ga0395901_0458091 Ga0395901_0458091_332_1027 230
197 3300039447 Ga0436361_0121746 Ga0436361_0121746_696_1391 230
198 3300039447 Ga0436361_0386399 Ga0436361_0386399_582_1295 230
199 3300039447 Ga0436361_1142624 Ga0436361_1142624_510_1220 230
200 3300049568 Ga0501031_0082131 Ga0501031_0082131_1246_1965 230
201 3300049570 Ga0501033_0137498 Ga0501033_0137498_989_1708 230
202 3300049571 Ga0501034_0167837 Ga0501034_0167837_1245_1949 230
203 3300049572 Ga0501036_0107404 Ga0501036_0107404_1012_1731 230
204 3300049574 Ga0501038_0362381 Ga0501038_0362381_317_1036 230
205 3300049575 Ga0501039_0060821 Ga0501039_0060821_1889_2590 230
206 3300049575 Ga0501039_0215325 Ga0501039_0215325_115_834 230
207 3300049576 Ga0501040_0084392 Ga0501040_0084392_1153_1872 230
208 3300049576 Ga0501040_0085010 Ga0501040_0085010_761_1462 230
209 3300049577 Ga0501041_0139203 Ga0501041_0139203_230_949 230
210 3300049578 Ga0501042_0030504 Ga0501042_0030504_363_1082 230
211 3300049579 Ga0501043_0158217 Ga0501043_0158217_547_1266 230
212 3300049580 Ga0501046_0180016 Ga0501046_0180016_116_835 230
213 3300049582 Ga0501048_0116522 Ga0501048_0116522_581_1300 230
214 3300049584 Ga0501068_0035178 Ga0501068_0035178_738_1457 230
215 3300049585 Ga0501069_0407516 Ga0501069_0407516_13_732 230
216 3300049587 Ga0501071_0280674 Ga0501071_0280674_503_1222 230
217 3300049588 Ga0501072_0016152 Ga0501072_0016152_1139_1858 230
218 3300049590 Ga0501074_0145349 Ga0501074_0145349_341_1060 230
219 3300049591 Ga0501075_0157761 Ga0501075_0157761_121_840 230
220 3300049593 Ga0501077_0130106 Ga0501077_0130106_213_932 230
221 3300049741 Ga0501079_0079549 Ga0501079_0079549_1500_2219 230
222 3300049744 Ga0501083_0071378 Ga0501083_0071378_568_1287 230
223 3300049822 Ga0501035_0162732 Ga0501035_0162732_1183_1902 230
224 3300050489 nmdc:mga03683_1487_c1 nmdc:mga03683_1487_c1_351_1046 230
225 3300050489 nmdc:mga03683_35731_c1 nmdc:mga03683_35731_c1_973_1668 230
226 3300050492 nmdc:mga0yw44_41216_c1 nmdc:mga0yw44_41216_c1_1602_2297 230
227 3300050496 nmdc:mga07m45_238987_c1 nmdc:mga07m45_238987_c1_221_916 230
228 3300050511 nmdc:mga08y16_173588_c1 nmdc:mga08y16_173588_c1_1438_2133 230
229 3300050516 nmdc:mga0sz30_5521_c1 nmdc:mga0sz30_5521_c1_648_1343 230
230 3300053091 Ga0500647_0110488 Ga0500647_0110488_453_1148 230
231 3300053093 Ga0500651_0312097 Ga0500651_0312097_85_780 230
232 3300054114 Ga0501084_0209126 Ga0501084_0209126_138_857 230
233 3300060353 Ga0501082_0144165 Ga0501082_0144165_452_1171 230
234 3300061734 Ga0530510_0243775 Ga0530510_0243775_310_1029 230
235 3300003792 Ga0055540_1042764 Ga0055540_10427642 231
236 3300005290 Ga0065712_10075868 Ga0065712_100758685 231
237 3300005293 Ga0065715_10018959 Ga0065715_100189593 231
238 3300005548 Ga0070665_100090631 Ga0070665_1000906312 231
239 3300005577 Ga0068857_100038259 Ga0068857_1000382593 231
240 3300005617 Ga0068859_100182041 Ga0068859_1001820413 231
241 3300006847 Ga0075431_100392497 Ga0075431_1003924973 231
242 3300006931 Ga0097620_100182033 Ga0097620_1001820333 231
243 3300006948 Ga0099826_10000036 Ga0099826_1000003658 231
244 3300009011 Ga0105251_10020078 Ga0105251_100200782 231
245 3300009174 Ga0105241_10047938 Ga0105241_100479382 231
246 3300009545 Ga0105237_10077670 Ga0105237_100776703 231
247 3300009545 Ga0105237_10113762 Ga0105237_101137622 231
248 3300009545 Ga0105237_10127292 Ga0105237_101272923 231
249 3300009551 Ga0105238_10027383 Ga0105238_100273834 231
250 3300010375 Ga0105239_10041668 Ga0105239_100416684 231
251 3300010375 Ga0105239_10145496 Ga0105239_101454963 231
252 3300010375 Ga0105239_10410719 Ga0105239_104107192 231
253 3300025302 Ga0207426_1010784 Ga0207426_10107842 231
254 3300025302 Ga0207426_1039543 Ga0207426_10395433 231
255 3300025303 Ga0209051_1069011 Ga0209051_10690112 231
256 3300025735 Ga0207713_1059624 Ga0207713_10596242 231
257 3300025906 Ga0207699_10119581 Ga0207699_101195812 231
258 3300025914 Ga0207671_10056312 Ga0207671_100563123 231
259 3300025914 Ga0207671_10078067 Ga0207671_100780673 231
260 3300025924 Ga0207694_10036803 Ga0207694_100368033 231
261 3300025924 Ga0207694_10089884 Ga0207694_100898843 231
262 3300025960 Ga0207651_10058532 Ga0207651_100585323 231
263 3300026116 Ga0207674_10017511 Ga0207674_100175116 231
264 3300027666 Ga0209282_1000098 Ga0209282_100009824 231
265 3300027682 Ga0209971_1007986 Ga0209971_10079863 231
266 3300031247 Ga0265340_10050806 Ga0265340_100508062 231
267 3300031344 Ga0265316_10003477 Ga0265316_100034778 231
268 3300031691 Ga0316579_10010076 Ga0316579_100100764 231
269 3300031728 Ga0316578_10002833 Ga0316578_100028337 231
270 3300031911 Ga0307412_10000235 Ga0307412_1000023528 231
271 3300032133 Ga0316583_10014321 Ga0316583_100143214 231
272 3300035691 Ga0373931_0044351 Ga0373931_0044351_241_939 231
273 3300035692 Ga0373935_0136145 Ga0373935_0136145_31_729 231
274 3300036647 Ga0316582_0018694 Ga0316582_0018694_957_1670 231
275 3300037588 Ga0316581_0006167 Ga0316581_0006167_429_1169 231
276 3300039453 Ga0436362_0870707 Ga0436362_0870707_279_977 231
277 3300046462 Ga0495651_0284323 Ga0495651_0284323_353_1057 231
278 3300046463 Ga0495653_0020662 Ga0495653_0020662_2268_2972 231
279 3300046474 Ga0495605_0002172 Ga0495605_0002172_5701_6405 231
280 3300046477 Ga0495664_0084305 Ga0495664_0084305_772_1476 231
281 3300046477 Ga0495664_0309053 Ga0495664_0309053_47_751 231
282 3300046500 Ga0495596_0000145 Ga0495596_0000145_12451_13155 231
283 3300046501 Ga0495607_0000021 Ga0495607_0000021_144998_145699 231
284 3300046501 Ga0495607_0003718 Ga0495607_0003718_7865_8569 231
285 3300046511 Ga0495608_0019310 Ga0495608_0019310_2514_3218 231
286 3300046512 Ga0495610_0000358 Ga0495610_0000358_4034_4738 231
287 3300046513 Ga0495616_0010431 Ga0495616_0010431_2280_2984 231
288 3300046516 Ga0495628_0064494 Ga0495628_0064494_2100_2804 231
289 3300046517 Ga0495630_0334410 Ga0495630_0334410_171_875 231
290 3300046523 Ga0495644_0047069 Ga0495644_0047069_103_807 231
291 3300046524 Ga0495648_0024963 Ga0495648_0024963_1079_1783 231
292 3300046529 Ga0495652_0028644 Ga0495652_0028644_1951_2655 231
293 3300046529 Ga0495652_0158598 Ga0495652_0158598_1042_1746 231
294 3300046533 Ga0495640_0173793 Ga0495640_0173793_298_1002 231
295 3300046536 Ga0495587_0017739 Ga0495587_0017739_432_1136 231
296 3300046538 Ga0495609_0009934 Ga0495609_0009934_2394_3098 231
297 3300046542 Ga0495597_0053502 Ga0495597_0053502_54_758 231
298 3300046543 Ga0495645_0021685 Ga0495645_0021685_2495_3199 231
299 3300046559 Ga0495667_0005798 Ga0495667_0005798_1433_2137 231
300 3300046559 Ga0495667_0039080 Ga0495667_0039080_2418_3122 231
301 3300046663 Ga0495635_0045907 Ga0495635_0045907_799_1503 231
302 3300046663 Ga0495635_0079796 Ga0495635_0079796_990_1694 231
303 3300046665 Ga0495661_0011823 Ga0495661_0011823_1672_2376 231
304 3300046679 Ga0495623_0013926 Ga0495623_0013926_2088_2792 231
305 3300046679 Ga0495623_0194226 Ga0495623_0194226_252_956 231
306 3300046680 Ga0495646_0035343 Ga0495646_0035343_239_943 231
307 3300046692 Ga0495671_0006024 Ga0495671_0006024_4982_5686 231
308 3300046694 Ga0495649_0009020 Ga0495649_0009020_3229_3933 231
309 3300046794 Ga0495589_0097158 Ga0495589_0097158_513_1217 231
310 3300046809 Ga0495600_0006876 Ga0495600_0006876_3925_4629 231
311 3300047317 Ga0495604_0001357 Ga0495604_0001357_3660_4364 231
312 3300047317 Ga0495604_0154369 Ga0495604_0154369_600_1304 231
313 3300047317 Ga0495604_0223049 Ga0495604_0223049_255_959 231
314 3300047319 Ga0495674_0016327 Ga0495674_0016327_1468_2172 231
315 3300047319 Ga0495674_0137091 Ga0495674_0137091_938_1642 231
316 3300047319 Ga0495674_0321300 Ga0495674_0321300_187_891 231
317 3300047320 Ga0495672_0003805 Ga0495672_0003805_7866_8570 231
318 3300047322 Ga0495680_0021296 Ga0495680_0021296_800_1504 231
319 3300047444 Ga0495675_0002040 Ga0495675_0002040_781_1485 231
320 3300047444 Ga0495675_0177658 Ga0495675_0177658_82_786 231
321 3300047444 Ga0495675_0237251 Ga0495675_0237251_76_780 231
322 3300047444 Ga0495675_0442897 Ga0495675_0442897_18_722 231
323 3300047447 Ga0495685_002240 Ga0495685_002240_3647_4351 231
324 3300047471 Ga0495684_0009756 Ga0495684_0009756_2599_3303 231
325 3300048918 Ga0496115_0293825 Ga0496115_0293825_290_994 231
326 3300048919 Ga0496116_0009306 Ga0496116_0009306_3916_4620 231
327 3300048919 Ga0496116_0013463 Ga0496116_0013463_5427_6128 231
328 3300048922 Ga0496119_0059557 Ga0496119_0059557_653_1354 231
329 3300048924 Ga0496121_0000444 Ga0496121_0000444_38467_39168 231
330 3300048924 Ga0496121_0023152 Ga0496121_0023152_2404_3108 231
331 3300048925 Ga0496122_0006772 Ga0496122_0006772_565_1269 231
332 3300048926 Ga0496123_0001730 Ga0496123_0001730_16149_16853 231
333 3300048926 Ga0496123_0022278 Ga0496123_0022278_3584_4285 231
334 3300048927 Ga0496124_0038248 Ga0496124_0038248_1114_1815 231
335 3300048928 Ga0496125_0203949 Ga0496125_0203949_299_1000 231
336 3300048929 Ga0496126_0127385 Ga0496126_0127385_1438_2142 231
337 3300049570 Ga0501033_0165082 Ga0501033_0165082_786_1511 231
338 3300049571 Ga0501034_0002554 Ga0501034_0002554_18215_18913 231
339 3300049572 Ga0501036_0007624 Ga0501036_0007624_3831_4556 231
340 3300049574 Ga0501038_0007405 Ga0501038_0007405_5170_5895 231
341 3300049576 Ga0501040_0029705 Ga0501040_0029705_623_1348 231
342 3300049576 Ga0501040_0035020 Ga0501040_0035020_2013_2738 231
343 3300049577 Ga0501041_0010800 Ga0501041_0010800_3440_4165 231
344 3300049577 Ga0501041_0119548 Ga0501041_0119548_812_1537 231
345 3300049578 Ga0501042_0180209 Ga0501042_0180209_556_1260 231
346 3300049579 Ga0501043_0090508 Ga0501043_0090508_1043_1768 231
347 3300049579 Ga0501043_0102700 Ga0501043_0102700_1353_2078 231
348 3300049582 Ga0501048_0021038 Ga0501048_0021038_3254_3979 231
349 3300049587 Ga0501071_0034529 Ga0501071_0034529_2369_3094 231
350 3300049588 Ga0501072_0000978 Ga0501072_0000978_17888_18613 231
351 3300049590 Ga0501074_0040093 Ga0501074_0040093_1347_2072 231
352 3300049591 Ga0501075_0000016 Ga0501075_0000016_26848_27573 231
353 3300049591 Ga0501075_0030254 Ga0501075_0030254_3176_3901 231
354 3300049592 Ga0501076_0000053 Ga0501076_0000053_42584_43309 231
355 3300049741 Ga0501079_0006500 Ga0501079_0006500_7291_8016 231
356 3300049742 Ga0501080_0029008 Ga0501080_0029008_2302_3027 231
357 3300049743 Ga0501081_0015484 Ga0501081_0015484_790_1515 231
358 3300049744 Ga0501083_0134277 Ga0501083_0134277_827_1552 231
359 3300049822 Ga0501035_0097702 Ga0501035_0097702_1405_2130 231
360 3300049824 Ga0501045_0006931 Ga0501045_0006931_6501_7226 231
361 3300050493 nmdc:mga0k408_12193_c1 nmdc:mga0k408_12193_c1_643_1341 231
362 3300053153 Ga0500616_0039346 Ga0500616_0039346_1322_2029 231
363 3300054114 Ga0501084_0007936 Ga0501084_0007936_3710_4435 231
364 3300054114 Ga0501084_0299783 Ga0501084_0299783_605_1330 231
365 3300060353 Ga0501082_0007898 Ga0501082_0007898_3370_4095 231
366 3300061734 Ga0530510_0000002 Ga0530510_0000002_270623_271348 231
367 3300061734 Ga0530510_0007581 Ga0530510_0007581_5115_5840 231
368 3300002126 JGI24035J26624_1009571 JGI24035J26624_10095711 232
369 3300005329 Ga0070683_100073554 Ga0070683_1000735543 232
370 3300005329 Ga0070683_100124624 Ga0070683_1001246243 232
371 3300005329 Ga0070683_100187069 Ga0070683_1001870693 232
372 3300005330 Ga0070690_100333068 Ga0070690_1003330682 232
373 3300005331 Ga0070670_100004072 Ga0070670_10000407211 232
374 3300005331 Ga0070670_100068491 Ga0070670_1000684913 232
375 3300005331 Ga0070670_100179243 Ga0070670_1001792433 232
376 3300005334 Ga0068869_100014092 Ga0068869_1000140924 232
377 3300005335 Ga0070666_10310826 Ga0070666_103108262 232
378 3300005339 Ga0070660_100304047 Ga0070660_1003040472 232
379 3300005340 Ga0070689_100033349 Ga0070689_1000333493 232
380 3300005344 Ga0070661_100179530 Ga0070661_1001795303 232
381 3300005356 Ga0070674_100044539 Ga0070674_1000445393 232
382 3300005364 Ga0070673_100628555 Ga0070673_1006285551 232
383 3300005365 Ga0070688_100610178 Ga0070688_1006101781 232
384 3300005367 Ga0070667_100086872 Ga0070667_1000868722 232
385 3300005434 Ga0070709_10026270 Ga0070709_100262704 232
386 3300005435 Ga0070714_100034440 Ga0070714_1000344404 232
387 3300005435 Ga0070714_100148431 Ga0070714_1001484311 232
388 3300005435 Ga0070714_100733518 Ga0070714_1007335181 232
389 3300005436 Ga0070713_100014911 Ga0070713_1000149117 232
390 3300005436 Ga0070713_100028199 Ga0070713_1000281993 232
391 3300005436 Ga0070713_100163342 Ga0070713_1001633422 232
392 3300005437 Ga0070710_10216034 Ga0070710_102160342 232
393 3300005439 Ga0070711_100011172 Ga0070711_1000111727 232
394 3300005439 Ga0070711_100043640 Ga0070711_1000436403 232
395 3300005440 Ga0070705_100032151 Ga0070705_1000321513 232
396 3300005444 Ga0070694_100063897 Ga0070694_1000638972 232
397 3300005457 Ga0070662_100518242 Ga0070662_1005182422 232
398 3300005458 Ga0070681_10000304 Ga0070681_1000030434 232
399 3300005458 Ga0070681_10000747 Ga0070681_1000074711 232
400 3300005458 Ga0070681_10021818 Ga0070681_100218185 232
401 3300005459 Ga0068867_100006678 Ga0068867_1000066785 232
402 3300005467 Ga0070706_100798993 Ga0070706_1007989931 232
403 3300005530 Ga0070679_100024816 Ga0070679_1000248162 232
404 3300005530 Ga0070679_100033468 Ga0070679_1000334686 232
405 3300005535 Ga0070684_100060840 Ga0070684_1000608402 232
406 3300005535 Ga0070684_100072504 Ga0070684_1000725043 232
407 3300005536 Ga0070697_100039013 Ga0070697_1000390134 232
408 3300005539 Ga0068853_100123859 Ga0068853_1001238593 232
409 3300005539 Ga0068853_100201020 Ga0068853_1002010202 232
410 3300005539 Ga0068853_100518421 Ga0068853_1005184211 232
411 3300005545 Ga0070695_100213026 Ga0070695_1002130262 232
412 3300005547 Ga0070693_100091312 Ga0070693_1000913121 232
413 3300005547 Ga0070693_100098984 Ga0070693_1000989841 232
414 3300005548 Ga0070665_100005312 Ga0070665_1000053126 232
415 3300005563 Ga0068855_100000563 Ga0068855_10000056337 232
416 3300005563 Ga0068855_100051557 Ga0068855_1000515572 232
417 3300005564 Ga0070664_100000879 Ga0070664_1000008799 232
418 3300005577 Ga0068857_100000022 Ga0068857_10000002214 232
419 3300005577 Ga0068857_100002691 Ga0068857_1000026919 232
420 3300005578 Ga0068854_100007043 Ga0068854_1000070437 232
421 3300005578 Ga0068854_100009020 Ga0068854_1000090204 232
422 3300005578 Ga0068854_100408437 Ga0068854_1004084372 232
423 3300005614 Ga0068856_100000448 Ga0068856_10000044837 232
424 3300005614 Ga0068856_100002645 Ga0068856_1000026457 232
425 3300005616 Ga0068852_100538622 Ga0068852_1005386222 232
426 3300005617 Ga0068859_100000885 Ga0068859_10000088516 232
427 3300005617 Ga0068859_100065693 Ga0068859_1000656934 232
428 3300005617 Ga0068859_100123537 Ga0068859_1001235372 232
429 3300005618 Ga0068864_100001248 Ga0068864_1000012483 232
430 3300005618 Ga0068864_100291991 Ga0068864_1002919912 232
431 3300005718 Ga0068866_10000934 Ga0068866_100009341 232
432 3300005719 Ga0068861_100236334 Ga0068861_1002363341 232
433 3300005841 Ga0068863_100105879 Ga0068863_1001058792 232
434 3300005841 Ga0068863_100229718 Ga0068863_1002297182 232
435 3300005842 Ga0068858_100001352 Ga0068858_10000135221 232
436 3300005842 Ga0068858_100475468 Ga0068858_1004754681 232
437 3300005843 Ga0068860_100003736 Ga0068860_10000373613 232
438 3300005843 Ga0068860_100005346 Ga0068860_1000053465 232
439 3300005843 Ga0068860_100024758 Ga0068860_1000247585 232
440 3300005844 Ga0068862_100039154 Ga0068862_1000391542 232
441 3300005983 Ga0081540_1000873 Ga0081540_10008733 232
442 3300006028 Ga0070717_10105767 Ga0070717_101057672 232
443 3300006175 Ga0070712_100000897 Ga0070712_10000089717 232
444 3300006175 Ga0070712_100055596 Ga0070712_1000555963 232
445 3300006175 Ga0070712_100144569 Ga0070712_1001445692 232
446 3300006237 Ga0097621_100000279 Ga0097621_1000002799 232
447 3300006237 Ga0097621_100057804 Ga0097621_1000578042 232
448 3300006358 Ga0068871_100000304 Ga0068871_1000003049 232
449 3300006358 Ga0068871_100031688 Ga0068871_1000316882 232
450 3300006358 Ga0068871_100340201 Ga0068871_1003402012 232
451 3300006844 Ga0075428_100031684 Ga0075428_1000316842 232
452 3300006844 Ga0075428_100145115 Ga0075428_1001451153 232
453 3300006846 Ga0075430_100010560 Ga0075430_1000105609 232
454 3300006846 Ga0075430_100161430 Ga0075430_1001614303 232
455 3300006847 Ga0075431_100062743 Ga0075431_1000627433 232
456 3300006847 Ga0075431_100427028 Ga0075431_1004270282 232
457 3300006880 Ga0075429_100019449 Ga0075429_1000194493 232
458 3300006880 Ga0075429_100224317 Ga0075429_1002243172 232
459 3300006931 Ga0097620_100000885 Ga0097620_10000088514 232
460 3300006931 Ga0097620_100065696 Ga0097620_1000656962 232
461 3300006931 Ga0097620_100123538 Ga0097620_1001235382 232
462 3300009093 Ga0105240_10007213 Ga0105240_1000721310 232
463 3300009098 Ga0105245_10461464 Ga0105245_104614641 232
464 3300009174 Ga0105241_10119796 Ga0105241_101197962 232
465 3300009177 Ga0105248_10420181 Ga0105248_104201812 232
466 3300009177 Ga0105248_10588625 Ga0105248_105886252 232
467 3300009177 Ga0105248_11311793 Ga0105248_113117931 232
468 3300009545 Ga0105237_10004260 Ga0105237_1000426010 232
469 3300009551 Ga0105238_10002919 Ga0105238_1000291915 232
470 3300010375 Ga0105239_10058972 Ga0105239_100589723 232
471 3300010375 Ga0105239_10814026 Ga0105239_108140262 232
472 3300010375 Ga0105239_10866644 Ga0105239_108666441 232
473 3300013104 Ga0157370_10058618 Ga0157370_100586183 232
474 3300013105 Ga0157369_10000243 Ga0157369_1000024366 232
475 3300013296 Ga0157374_10001216 Ga0157374_1000121614 232
476 3300013297 Ga0157378_10115644 Ga0157378_101156442 232
477 3300013307 Ga0157372_10015924 Ga0157372_100159248 232
478 3300013307 Ga0157372_10250419 Ga0157372_102504192 232
479 3300013307 Ga0157372_10523405 Ga0157372_105234051 232
480 3300014968 Ga0157379_10348051 Ga0157379_103480512 232
481 3300021384 Ga0213876_10035150 Ga0213876_100351501 232
482 3300021384 Ga0213876_10042184 Ga0213876_100421842 232
483 3300022734 Ga0224571_100778 Ga0224571_1007783 232
484 3300024225 Ga0224572_1011723 Ga0224572_10117232 232
485 3300024225 Ga0224572_1034160 Ga0224572_10341601 232
486 3300024227 Ga0228598_1003353 Ga0228598_10033532 232
487 3300025250 Ga0209026_1005874 Ga0209026_10058741 232
488 3300025315 Ga0207697_10002151 Ga0207697_100021515 232
489 3300025898 Ga0207692_10032122 Ga0207692_100321222 232
490 3300025901 Ga0207688_10009808 Ga0207688_100098085 232
491 3300025903 Ga0207680_10467931 Ga0207680_104679311 232
492 3300025904 Ga0207647_10089517 Ga0207647_100895172 232
493 3300025907 Ga0207645_10281917 Ga0207645_102819172 232
494 3300025911 Ga0207654_10082024 Ga0207654_100820243 232
495 3300025912 Ga0207707_10001814 Ga0207707_100018148 232
496 3300025912 Ga0207707_10003521 Ga0207707_1000352113 232
497 3300025913 Ga0207695_10020070 Ga0207695_100200707 232
498 3300025915 Ga0207693_10015053 Ga0207693_100150535 232
499 3300025915 Ga0207693_10034939 Ga0207693_100349393 232
500 3300025915 Ga0207693_10089856 Ga0207693_100898562 232
501 3300025916 Ga0207663_10022626 Ga0207663_100226264 232
502 3300025916 Ga0207663_10025717 Ga0207663_100257173 232
503 3300025916 Ga0207663_10111069 Ga0207663_101110692 232
504 3300025916 Ga0207663_10146180 Ga0207663_101461801 232
505 3300025916 Ga0207663_10154977 Ga0207663_101549773 232
506 3300025919 Ga0207657_10184221 Ga0207657_101842211 232
507 3300025921 Ga0207652_10003767 Ga0207652_100037678 232
508 3300025921 Ga0207652_10123612 Ga0207652_101236123 232
509 3300025921 Ga0207652_10640565 Ga0207652_106405652 232
510 3300025924 Ga0207694_10000896 Ga0207694_1000089611 232
511 3300025925 Ga0207650_10020298 Ga0207650_100202982 232
512 3300025925 Ga0207650_10050834 Ga0207650_100508342 232
513 3300025926 Ga0207659_10290469 Ga0207659_102904692 232
514 3300025928 Ga0207700_10052042 Ga0207700_100520422 232
515 3300025928 Ga0207700_10089216 Ga0207700_100892163 232
516 3300025929 Ga0207664_10199227 Ga0207664_101992272 232
517 3300025929 Ga0207664_10581100 Ga0207664_105811001 232
518 3300025933 Ga0207706_10367160 Ga0207706_103671602 232
519 3300025936 Ga0207670_10060659 Ga0207670_100606592 232
520 3300025937 Ga0207669_10009321 Ga0207669_100093213 232
521 3300025939 Ga0207665_10000176 Ga0207665_1000017616 232
522 3300025939 Ga0207665_10058247 Ga0207665_100582472 232
523 3300025940 Ga0207691_10387791 Ga0207691_103877912 232
524 3300025941 Ga0207711_10260741 Ga0207711_102607413 232
525 3300025944 Ga0207661_10348936 Ga0207661_103489362 232
526 3300025945 Ga0207679_10001790 Ga0207679_100017907 232
527 3300025949 Ga0207667_10000302 Ga0207667_1000030242 232
528 3300025949 Ga0207667_10027794 Ga0207667_100277944 232
529 3300025949 Ga0207667_10767741 Ga0207667_107677411 232
530 3300025960 Ga0207651_10576133 Ga0207651_105761331 232
531 3300025981 Ga0207640_10002615 Ga0207640_100026159 232
532 3300025986 Ga0207658_10613866 Ga0207658_106138661 232
533 3300026023 Ga0207677_10168654 Ga0207677_101686542 232
534 3300026023 Ga0207677_10494213 Ga0207677_104942131 232
535 3300026035 Ga0207703_10001842 Ga0207703_1000184211 232
536 3300026035 Ga0207703_10063941 Ga0207703_100639414 232
537 3300026041 Ga0207639_10020277 Ga0207639_100202775 232
538 3300026041 Ga0207639_10032909 Ga0207639_100329092 232
539 3300026041 Ga0207639_10049051 Ga0207639_100490512 232
540 3300026067 Ga0207678_10089478 Ga0207678_100894783 232
541 3300026078 Ga0207702_10000120 Ga0207702_1000012075 232
542 3300026078 Ga0207702_10029438 Ga0207702_100294383 232
543 3300026088 Ga0207641_10054475 Ga0207641_100544754 232
544 3300026089 Ga0207648_10015149 Ga0207648_100151493 232
545 3300026095 Ga0207676_10009792 Ga0207676_100097922 232
546 3300026095 Ga0207676_10709904 Ga0207676_107099042 232
547 3300026116 Ga0207674_10000056 Ga0207674_1000005680 232
548 3300026116 Ga0207674_10010860 Ga0207674_100108608 232
549 3300026121 Ga0207683_10303045 Ga0207683_103030452 232
550 3300026142 Ga0207698_10349755 Ga0207698_103497552 232
551 3300027665 Ga0209983_1024125 Ga0209983_10241252 232
552 3300027682 Ga0209971_1011013 Ga0209971_10110133 232
553 3300027876 Ga0209974_10089991 Ga0209974_100899912 232
554 3300028016 Ga0265354_1000063 Ga0265354_100006312 232
555 3300028016 Ga0265354_1000477 Ga0265354_10004776 232
556 3300028379 Ga0268266_10000276 Ga0268266_1000027613 232
557 3300028379 Ga0268266_10088967 Ga0268266_100889673 232
558 3300028381 Ga0268264_10003976 Ga0268264_100039766 232
559 3300028653 Ga0265323_10009931 Ga0265323_100099311 232
560 3300028654 Ga0265322_10016111 Ga0265322_100161113 232
561 3300030878 Ga0265770_1003281 Ga0265770_10032813 232
562 3300031090 Ga0265760_10004504 Ga0265760_100045041 232
563 3300031090 Ga0265760_10030405 Ga0265760_100304053 232
564 3300031090 Ga0265760_10092412 Ga0265760_100924122 232
565 3300031241 Ga0265325_10051040 Ga0265325_100510403 232
566 3300031247 Ga0265340_10002512 Ga0265340_100025126 232
567 3300031247 Ga0265340_10122830 Ga0265340_101228302 232
568 3300031249 Ga0265339_10039977 Ga0265339_100399772 232
569 3300031250 Ga0265331_10018561 Ga0265331_100185614 232
570 3300031344 Ga0265316_10013849 Ga0265316_100138495 232
571 3300031344 Ga0265316_10082071 Ga0265316_100820713 232
572 3300031595 Ga0265313_10030041 Ga0265313_100300412 232
573 3300031595 Ga0265313_10038206 Ga0265313_100382063 232
574 3300031711 Ga0265314_10001239 Ga0265314_1000123912 232
575 3300031712 Ga0265342_10001720 Ga0265342_1000172018 232
576 3300031712 Ga0265342_10006613 Ga0265342_100066137 232
577 3300031712 Ga0265342_10014169 Ga0265342_100141694 232
578 3300031731 Ga0307405_10023943 Ga0307405_100239432 232
579 3300031852 Ga0307410_10019800 Ga0307410_100198002 232
580 3300031901 Ga0307406_10012037 Ga0307406_100120376 232
581 3300031901 Ga0307406_10190364 Ga0307406_101903642 232
582 3300031911 Ga0307412_10176353 Ga0307412_101763532 232
583 3300031911 Ga0307412_10369940 Ga0307412_103699402 232
584 3300031911 Ga0307412_10449133 Ga0307412_104491331 232
585 3300031995 Ga0307409_100135520 Ga0307409_1001355203 232
586 3300031995 Ga0307409_100539916 Ga0307409_1005399162 232
587 3300032002 Ga0307416_100002923 Ga0307416_1000029234 232
588 3300032002 Ga0307416_100158591 Ga0307416_1001585912 232
589 3300032004 Ga0307414_10451508 Ga0307414_104515082 232
590 3300032005 Ga0307411_10114212 Ga0307411_101142123 232
591 3300035090 Ga0373949_0016852 Ga0373949_0016852_682_1389 232
592 3300035118 Ga0373954_0050841 Ga0373954_0050841_1041_1766 232
593 3300036401 Ga0373937_0153780 Ga0373937_0153780_645_1370 232
594 3300039437 Ga0436365_0694215 Ga0436365_0694215_1284_2045 232
595 3300039437 Ga0436365_1272561 Ga0436365_1272561_5626_6351 232
596 3300039438 Ga0436360_0994159 Ga0436360_0994159_674_1378 232
597 3300039453 Ga0436362_0680558 Ga0436362_0680558_32_757 232
598 3300042438 Ga0439459_0025286 Ga0439459_0025286_278_985 232
599 3300042461 Ga0439460_0047890 Ga0439460_0047890_482_1210 232
600 3300045051 Ga0451576_0086375 Ga0451576_0086375_277_981 232
601 3300046472 Ga0495580_0008165 Ga0495580_0008165_3067_3786 232
602 3300046516 Ga0495628_0027367 Ga0495628_0027367_322_1026 232
603 3300046517 Ga0495630_0397676 Ga0495630_0397676_335_1045 232
604 3300046522 Ga0495643_0032426 Ga0495643_0032426_2070_2780 232
605 3300046543 Ga0495645_0058901 Ga0495645_0058901_1819_2568 232
606 3300046684 Ga0495669_0182712 Ga0495669_0182712_228_932 232
607 3300047317 Ga0495604_0265529 Ga0495604_0265529_252_956 232
608 3300048903 Ga0496100_0278906 Ga0496100_0278906_295_1008 232
609 3300048904 Ga0496101_0192624 Ga0496101_0192624_438_1151 232
610 3300048904 Ga0496101_0374066 Ga0496101_0374066_208_915 232
611 3300048906 Ga0496103_0352455 Ga0496103_0352455_208_915 232
612 3300048907 Ga0496104_0061218 Ga0496104_0061218_2445_3152 232
613 3300048911 Ga0496108_0070791 Ga0496108_0070791_932_1654 232
614 3300048913 Ga0496110_0088480 Ga0496110_0088480_1684_2406 232
615 3300048915 Ga0496112_0004054 Ga0496112_0004054_7121_7828 232
616 3300048915 Ga0496112_0018421 Ga0496112_0018421_4362_5075 232
617 3300048918 Ga0496115_0227301 Ga0496115_0227301_574_1281 232
618 3300048925 Ga0496122_0234301 Ga0496122_0234301_68_778 232
619 3300049522 Ga0501299_046320 Ga0501299_046320_110_820 232
620 3300049571 Ga0501034_0581888 Ga0501034_0581888_156_902 232
621 3300049574 Ga0501038_0285638 Ga0501038_0285638_494_1195 232
622 3300049575 Ga0501039_0160290 Ga0501039_0160290_993_1694 232
623 3300049576 Ga0501040_0508115 Ga0501040_0508115_45_749 232
624 3300049580 Ga0501046_0148131 Ga0501046_0148131_938_1636 232
625 3300049580 Ga0501046_0273090 Ga0501046_0273090_455_1192 232
626 3300049581 Ga0501047_0012523 Ga0501047_0012523_1402_2148 232
627 3300049582 Ga0501048_0049581 Ga0501048_0049581_794_1531 232
628 3300049583 Ga0501067_0235638 Ga0501067_0235638_134_880 232
629 3300049586 Ga0501070_0095803 Ga0501070_0095803_86_832 232
630 3300049588 Ga0501072_0011768 Ga0501072_0011768_892_1629 232
631 3300049588 Ga0501072_0029570 Ga0501072_0029570_3012_3758 232
632 3300049589 Ga0501073_0040672 Ga0501073_0040672_839_1585 232
633 3300049589 Ga0501073_0077868 Ga0501073_0077868_426_1124 232
634 3300049590 Ga0501074_0058878 Ga0501074_0058878_747_1484 232
635 3300049590 Ga0501074_0068939 Ga0501074_0068939_1259_2005 232
636 3300049592 Ga0501076_0029073 Ga0501076_0029073_2108_2845 232
637 3300049592 Ga0501076_0106481 Ga0501076_0106481_1411_2115 232
638 3300049593 Ga0501077_0032712 Ga0501077_0032712_1789_2526 232
639 3300049652 Ga0501202_060960 Ga0501202_060960_113_838 232
640 3300049705 Ga0501225_0022612 Ga0501225_0022612_32_757 232
641 3300049742 Ga0501080_0008305 Ga0501080_0008305_157_903 232
642 3300049742 Ga0501080_0019084 Ga0501080_0019084_3811_4548 232
643 3300049744 Ga0501083_0034475 Ga0501083_0034475_1857_2612 232
644 3300049744 Ga0501083_0113371 Ga0501083_0113371_384_1130 232
645 3300049760 Ga0501263_000676 Ga0501263_000676_872_1582 232
646 3300049822 Ga0501035_0477033 Ga0501035_0477033_102_839 232
647 3300049823 Ga0501044_0250617 Ga0501044_0250617_677_1378 232
648 3300049823 Ga0501044_0515417 Ga0501044_0515417_299_1045 232
649 3300049824 Ga0501045_0095850 Ga0501045_0095850_731_1468 232
650 3300049824 Ga0501045_0330323 Ga0501045_0330323_14_721 232
651 3300050492 nmdc:mga0yw44_421452_c1 nmdc:mga0yw44_421452_c1_51_776 232
652 3300050508 nmdc:mga09592_155995_c1 nmdc:mga09592_155995_c1_817_1524 232
653 3300050508 nmdc:mga09592_30572_c1 nmdc:mga09592_30572_c1_2759_3466 232
654 3300050509 nmdc:mga0qj67_21225_c1 nmdc:mga0qj67_21225_c1_1158_1877 232
655 3300050509 nmdc:mga0qj67_7968_c1 nmdc:mga0qj67_7968_c1_1045_1752 232
656 3300050510 nmdc:mga06r32_11919_c1 nmdc:mga06r32_11919_c1_1045_1752 232
657 3300050510 nmdc:mga06r32_306167_c1 nmdc:mga06r32_306167_c1_480_1184 232
658 3300050516 nmdc:mga0sz30_34794_c1 nmdc:mga0sz30_34794_c1_396_1097 232
659 3300053156 Ga0500622_0012471 Ga0500622_0012471_3387_4097 232
660 3300053158 Ga0500627_0101327 Ga0500627_0101327_22_732 232
661 3300053177 Ga0500636_0039454 Ga0500636_0039454_373_1083 232
662 3300054114 Ga0501084_0012556 Ga0501084_0012556_1046_1783 232
663 3300060353 Ga0501082_0248973 Ga0501082_0248973_440_1186 232
664 3300061734 Ga0530510_0047889 Ga0530510_0047889_1045_1782 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

82

263

0.96

PF12391

PCDO_beta_N

Protocatechuate 3,4-dioxygenase beta subunit N terminal

44

78

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pcd-assembly1.cif.gz_M protocatechuate 3,4-dioxygenase y447h mutant 0.9536 5 224
3t63-assembly1.cif.gz_N axial ligand swapping in double mutant maintains intradiol-cleavage chemistry in protocatechuate 3,4-dioxygenase 0.953 5 224
3lkt-assembly1.cif.gz_M tyrosine 447 of protocatechuate 3,4-dioxygenase controls efficient progress through catalysis 0.9527 5 224
4whp-assembly1.cif.gz_D resting protocatechuate 3,4-dioxygenase (pseudomonas putida) at ph 6.5 0.9521 5 224
2pcd-assembly1.cif.gz_N-2 structure of protocatechuate 3,4-dioxygenase from pseudomonas aeruginosa at 2.15 angstroms resolution 0.9518 5 224
ID Description Score Start End Superfamily
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.9189 5 232 2.60.130.10
1eo2B00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8998 5 232 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7951 44 224 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7755 44 224 2.60.130.10
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.7621 70 221 2.60.130.10
ID Description Score Start End GO Terms
AF-F5YYG0-F1-model_v4 Protocatechuate 34-dioxygenase beta subunit 0.9836 54 232 GO:0008199
GO:0018578
GO:0019619
AF-A0A7H4ML90-F1-model_v4 Protocatechuate 34-dioxygenase subunit beta (EC 1.13.11.3) 0.978 87 162 GO:0008199
GO:0018578
AF-A0A382J2N4-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.9767 92 232 GO:0008199
GO:0016702
AF-A0A838J6Y4-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta (EC 1.13.11.3) 0.9752 14 221 GO:0008199
GO:0018578
GO:0019619
AF-A0A7W1AXQ8-F1-model_v4 Protocatechuate 3,4-dioxygenase subunit beta 0.9747 52 231 GO:0008199
GO:0016702

Feature Viewer

pLDDT pTM Quality
86.54 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map