F473418

General Info

Members Datasets Scaffolds Average Seq Length
661 370 661 114

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_11446630|Ga0307410_114466302
Length 125
Sequence VDAAGEGFRRQAELGVPGISIHVVDVSRGLVGAGMRIELRQGAKALLSGRASGKGLVELNEKVAAGTYEAVFHVAEWYREQRVTLPPTPFLDVVTYRFGISDPEQHYHLPFKCTPWGYSCFRGGA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
214 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
226 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
227 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
228 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
229 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
230 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
231 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
232 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
235 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
236 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
244 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
245 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
257 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
258 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
259 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
260 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
261 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
262 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
263 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
264 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
265 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
266 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
267 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
268 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
281 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
287 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
288 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
293 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
294 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
311 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
312 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
313 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
314 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
324 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
325 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
326 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
327 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
328 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
329 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
330 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
331 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
332 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
333 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
334 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
354 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
355 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
356 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
357 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
358 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
359 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
360 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
361 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
362 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
363 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
364 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
367 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
368 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
369 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.55
Metatranscriptomes 0.45
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.02
Nodule 0
Rhizoplane 3.78
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10158448 3300001979 Unclassified 562
2 JGI24738J21930_10123452 3300002075 Unclassified 563
3 JGI25406J46586_10064461 3300003203 Bacteria 1170
4 JGI25153J46596_10000326 3300003215 Bacteria 34486
5 JGI25153J46596_10031146 3300003215 Unclassified 1801
6 rootH1_10076163 3300003323 Bacteria 1040
7 Ga0065707_10095642 3300005295 Bacteria 3354
8 Ga0070658_10002078 3300005327 Bacteria 16808
9 Ga0070658_10328272 3300005327 Bacteria 1307
10 Ga0070676_10062667 3300005328 Bacteria 2213
11 Ga0070683_100001436 3300005329 Bacteria 18293
12 Ga0070690_101692375 3300005330 Unclassified 514
13 Ga0070670_100203174 3300005331 Bacteria 1722
14 Ga0070670_101552672 3300005331 Bacteria 608
15 Ga0068869_100000251 3300005334 Bacteria 28247
16 Ga0068869_100134410 3300005334 Bacteria 1904
17 Ga0068869_100734395 3300005334 Bacteria 844
18 Ga0070666_10025642 3300005335 Bacteria 3845
19 Ga0070680_100028969 3300005336 Bacteria 4445
20 Ga0070680_100037534 3300005336 Bacteria 3915
21 Ga0070680_100048610 3300005336 Bacteria 3457
22 Ga0070680_100519708 3300005336 Unclassified 1019
23 Ga0070682_100001570 3300005337 Bacteria 12755
24 Ga0068868_100000323 3300005338 Bacteria 32212
25 Ga0068868_100226386 3300005338 Bacteria 1567
26 Ga0068868_101307054 3300005338 Unclassified 674
27 Ga0070660_100004203 3300005339 Bacteria 9944
28 Ga0070660_100006164 3300005339 Bacteria 8298
29 Ga0070660_100015529 3300005339 Bacteria 5502
30 Ga0070660_100066787 3300005339 Bacteria 2801
31 Ga0070689_100000549 3300005340 Bacteria 22423
32 Ga0070689_100008057 3300005340 Bacteria 7399
33 Ga0070689_100345986 3300005340 Bacteria 1246
34 Ga0070691_10001307 3300005341 Bacteria 10580
35 Ga0070691_10299294 3300005341 Bacteria 878
36 Ga0070687_100000059 3300005343 Bacteria 35532
37 Ga0070661_100002685 3300005344 Bacteria 12177
38 Ga0070661_100005262 3300005344 Bacteria 8912
39 Ga0070661_100127394 3300005344 Bacteria 1911
40 Ga0070661_100468553 3300005344 Bacteria 1004
41 Ga0070692_10133525 3300005345 Bacteria 1398
42 Ga0070692_10343719 3300005345 Bacteria 925
43 Ga0070668_100424206 3300005347 Bacteria 1139
44 Ga0070669_100328277 3300005353 Unclassified 1237
45 Ga0070669_100796148 3300005353 Unclassified 803
46 Ga0070675_100070101 3300005354 Bacteria 2905
47 Ga0070675_100133138 3300005354 Bacteria 2120
48 Ga0070671_100028448 3300005355 Bacteria 4603
49 Ga0070671_100127703 3300005355 Bacteria 2141
50 Ga0070673_100032966 3300005364 Bacteria 3906
51 Ga0070673_100616129 3300005364 Bacteria 991
52 Ga0070688_100292239 3300005365 Bacteria 1175
53 Ga0070688_100344786 3300005365 Bacteria 1089
54 Ga0070659_100001376 3300005366 Bacteria 17521
55 Ga0070659_100007839 3300005366 Bacteria 7772
56 Ga0070659_100093581 3300005366 Bacteria 2412
57 Ga0070659_100355407 3300005366 Bacteria 1230
58 Ga0070709_10002761 3300005434 Bacteria 9496
59 Ga0070709_10183793 3300005434 Bacteria 1470
60 Ga0070714_100003230 3300005435 Bacteria 12133
61 Ga0070714_100008916 3300005435 Bacteria 7848
62 Ga0070713_100000399 3300005436 Bacteria 27898
63 Ga0070713_100104933 3300005436 Bacteria 2454
64 Ga0070710_10009602 3300005437 Bacteria 4738
65 Ga0070710_10454976 3300005437 Bacteria 868
66 Ga0070710_10621513 3300005437 Bacteria 754
67 Ga0070701_10000194 3300005438 Bacteria 18862
68 Ga0070701_10197462 3300005438 Bacteria 1187
69 Ga0070711_100006108 3300005439 Bacteria 7241
70 Ga0070711_100258782 3300005439 Bacteria 1368
71 Ga0070711_100713172 3300005439 Bacteria 845
72 Ga0070705_100000370 3300005440 Bacteria 26351
73 Ga0070705_100001756 3300005440 Bacteria 11250
74 Ga0070705_100150062 3300005440 Bacteria 1545
75 Ga0070705_100995563 3300005440 Bacteria 680
76 Ga0070700_100000391 3300005441 Bacteria 22586
77 Ga0070694_100000813 3300005444 Bacteria 17488
78 Ga0070694_100019804 3300005444 Bacteria 4283
79 Ga0070694_101376060 3300005444 Bacteria 595
80 Ga0070708_100124028 3300005445 Bacteria 2386
81 Ga0070708_100303879 3300005445 Bacteria 1502
82 Ga0070663_100007228 3300005455 Bacteria 6747
83 Ga0070678_100034110 3300005456 Bacteria 3541
84 Ga0070678_100459062 3300005456 Bacteria 1117
85 Ga0070662_100008096 3300005457 Bacteria 6843
86 Ga0070662_100307183 3300005457 Bacteria 1290
87 Ga0070681_10082306 3300005458 Bacteria 3174
88 Ga0070681_10143996 3300005458 Bacteria 2313
89 Ga0070681_10702541 3300005458 Bacteria 927
90 Ga0068867_100000514 3300005459 Bacteria 25802
91 Ga0070685_10892951 3300005466 Bacteria 661
92 Ga0070706_101108506 3300005467 Unclassified 728
93 Ga0070707_100545657 3300005468 Unclassified 1121
94 Ga0070707_100998507 3300005468 Unclassified 802
95 Ga0070698_100113777 3300005471 Bacteria 2671
96 Ga0070698_100294330 3300005471 Bacteria 1554
97 Ga0070698_100484920 3300005471 Unclassified 1173
98 Ga0070698_101155537 3300005471 Bacteria 723
99 Ga0070699_100006127 3300005518 Bacteria 10519
100 Ga0070699_100029629 3300005518 Bacteria 4720
101 Ga0070699_100040010 3300005518 Bacteria 4060
102 Ga0070699_100046239 3300005518 Bacteria 3767
103 Ga0070699_101261050 3300005518 Bacteria 678
104 Ga0070679_100005870 3300005530 Bacteria 11402
105 Ga0070679_102111494 3300005530 Unclassified 513
106 Ga0070684_100008755 3300005535 Bacteria 7935
107 Ga0070697_100117509 3300005536 Bacteria 2222
108 Ga0068853_100001556 3300005539 Bacteria 16698
109 Ga0068853_100002165 3300005539 Bacteria 14625
110 Ga0068853_100021931 3300005539 Bacteria 5327
111 Ga0068853_100380533 3300005539 Bacteria 1318
112 Ga0070672_100365488 3300005543 Bacteria 1232
113 Ga0070686_100000243 3300005544 Bacteria 37165
114 Ga0070695_100000141 3300005545 Bacteria 33296
115 Ga0070695_100060007 3300005545 Bacteria 2464
116 Ga0070696_100000253 3300005546 Bacteria 32345
117 Ga0070696_100002444 3300005546 Bacteria 12314
118 Ga0070696_100042788 3300005546 Bacteria 3131
119 Ga0070693_100000009 3300005547 Bacteria 77783
120 Ga0070665_100557841 3300005548 Unclassified 1158
121 Ga0070704_100000076 3300005549 Bacteria 33631
122 Ga0070704_100017240 3300005549 Bacteria 4588
123 Ga0068855_100000832 3300005563 Bacteria 38157
124 Ga0068855_100004666 3300005563 Bacteria 16737
125 Ga0068855_100287727 3300005563 Bacteria 1823
126 Ga0068855_100484402 3300005563 Bacteria 1346
127 Ga0070664_100013427 3300005564 Bacteria 6672
128 Ga0070664_100080265 3300005564 Bacteria 2809
129 Ga0068857_100005743 3300005577 Bacteria 10611
130 Ga0068854_100001580 3300005578 Bacteria 13853
131 Ga0068854_100006194 3300005578 Bacteria 7596
132 Ga0068854_100195011 3300005578 Bacteria 1589
133 Ga0068856_100000679 3300005614 Bacteria 36874
134 Ga0068856_100012570 3300005614 Bacteria 8195
135 Ga0068856_100024817 3300005614 Bacteria 5840
136 Ga0070702_100000075 3300005615 Bacteria 28434
137 Ga0068852_100002542 3300005616 Bacteria 12563
138 Ga0068852_100172372 3300005616 Bacteria 2029
139 Ga0068859_100001974 3300005617 Bacteria 20936
140 Ga0068864_100611897 3300005618 Bacteria 1058
141 Ga0068866_10000347 3300005718 Bacteria 21827
142 Ga0068866_10295210 3300005718 Bacteria 1010
143 Ga0068861_100000106 3300005719 Bacteria 41730
144 Ga0068861_100669004 3300005719 Bacteria 961
145 Ga0068851_10000367 3300005834 Bacteria 20365
146 Ga0068863_100472136 3300005841 Bacteria 1233
147 Ga0068863_101376880 3300005841 Bacteria 713
148 Ga0068858_100137412 3300005842 Bacteria 2294
149 Ga0068858_100188129 3300005842 Bacteria 1951
150 Ga0068860_100000484 3300005843 Bacteria 49078
151 Ga0068860_100061096 3300005843 Bacteria 3580
152 Ga0068862_100001748 3300005844 Bacteria 19665
153 Ga0081455_10210009 3300005937 Bacteria 1451
154 Ga0081538_10128292 3300005981 Unclassified 1199
155 Ga0081539_10000803 3300005985 Bacteria 61113
156 Ga0070717_10009273 3300006028 Bacteria 7396
157 Ga0070717_10223331 3300006028 Unclassified 1656
158 Ga0070717_10531729 3300006028 Bacteria 1064
159 Ga0075365_10027914 3300006038 Bacteria 3595
160 Ga0075365_10834265 3300006038 Bacteria 650
161 Ga0075368_10043143 3300006042 Bacteria 1776
162 Ga0075363_100025133 3300006048 Bacteria 3034
163 Ga0075364_10086396 3300006051 Bacteria 2078
164 Ga0070715_10001341 3300006163 Bacteria 7098
165 Ga0070716_100616749 3300006173 Bacteria 818
166 Ga0070712_100177005 3300006175 Bacteria 1659
167 Ga0070712_100418950 3300006175 Bacteria 1109
168 Ga0070712_100690685 3300006175 Bacteria 869
169 Ga0075362_10253044 3300006177 Bacteria 866
170 Ga0075362_10319652 3300006177 Bacteria 773
171 Ga0075367_10097879 3300006178 Bacteria 1790
172 Ga0075367_10111996 3300006178 Bacteria 1676
173 Ga0075366_10096506 3300006195 Bacteria 1772
174 Ga0075366_10325502 3300006195 Bacteria 942
175 Ga0097621_100012458 3300006237 Bacteria 6305
176 Ga0075370_10136465 3300006353 Bacteria 1433
177 Ga0068871_100017622 3300006358 Bacteria 5409
178 Ga0075428_100000615 3300006844 Bacteria 36398
179 Ga0075428_100083015 3300006844 Bacteria 3496
180 Ga0075428_100208444 3300006844 Bacteria 2112
181 Ga0075428_100342414 3300006844 Bacteria 1605
182 Ga0075428_101213397 3300006844 Bacteria 795
183 Ga0075428_102523842 3300006844 Bacteria 526
184 Ga0075430_100068421 3300006846 Bacteria 2979
185 Ga0075430_100101040 3300006846 Bacteria 2408
186 Ga0075430_100337992 3300006846 Bacteria 1244
187 Ga0075430_100401392 3300006846 Bacteria 1132
188 Ga0075430_100834499 3300006846 Bacteria 759
189 Ga0075431_100047993 3300006847 Bacteria 4404
190 Ga0075431_100219568 3300006847 Bacteria 1939
191 Ga0075431_100240397 3300006847 Bacteria 1842
192 Ga0075431_100481334 3300006847 Bacteria 1234
193 Ga0075431_100497262 3300006847 Bacteria 1211
194 Ga0075431_100867239 3300006847 Bacteria 873
195 Ga0075433_10001240 3300006852 Bacteria 18606
196 Ga0075433_10221170 3300006852 Bacteria 1682
197 Ga0075433_11035065 3300006852 Bacteria 715
198 Ga0075434_100499273 3300006871 Bacteria 1238
199 Ga0075429_100000506 3300006880 Bacteria 29418
200 Ga0075429_100226441 3300006880 Bacteria 1638
201 Ga0075429_100234264 3300006880 Bacteria 1608
202 Ga0075429_100326289 3300006880 Bacteria 1343
203 Ga0075429_101662242 3300006880 Bacteria 555
204 Ga0075436_100000896 3300006914 Bacteria 19786
205 Ga0075436_100010510 3300006914 Bacteria 6349
206 Ga0097620_100001974 3300006931 Bacteria 20936
207 Ga0075435_100656015 3300007076 Bacteria 911
208 Ga0099794_10008683 3300007265 Bacteria 4232
209 Ga0099794_10568206 3300007265 Bacteria 599
210 Ga0105250_10622271 3300009092 Bacteria 502
211 Ga0105240_10012947 3300009093 Bacteria 11489
212 Ga0105240_10069698 3300009093 Bacteria 4351
213 Ga0111539_10046625 3300009094 Bacteria 5183
214 Ga0111539_10388342 3300009094 Bacteria 1625
215 Ga0111539_11298927 3300009094 Bacteria 844
216 Ga0111539_12222517 3300009094 Unclassified 636
217 Ga0105245_10000329 3300009098 Bacteria 44773
218 Ga0114129_10000534 3300009147 Bacteria 46594
219 Ga0114129_10154576 3300009147 Bacteria 3138
220 Ga0114129_10213431 3300009147 Bacteria 2608
221 Ga0114129_10295662 3300009147 Bacteria 2160
222 Ga0114129_10796389 3300009147 Bacteria 1206
223 Ga0114129_11399935 3300009147 Bacteria 863
224 Ga0114129_12577334 3300009147 Unclassified 607
225 Ga0105243_10000590 3300009148 Bacteria 36363
226 Ga0105241_10120966 3300009174 Bacteria 2108
227 Ga0105241_10579476 3300009174 Bacteria 1011
228 Ga0105242_10000243 3300009176 Bacteria 42938
229 Ga0105242_12847243 3300009176 Bacteria 534
230 Ga0105237_10111265 3300009545 Bacteria 2730
231 Ga0105238_10001480 3300009551 Bacteria 23574
232 Ga0105249_10000832 3300009553 Bacteria 27782
233 Ga0105249_12931582 3300009553 Unclassified 548
234 Ga0099796_10300680 3300010159 Bacteria 680
235 Ga0105239_10023448 3300010375 Bacteria 6797
236 Ga0105246_10940927 3300011119 Bacteria 778
237 Ga0105246_11097290 3300011119 Unclassified 726
238 Ga0157316_1014179 3300012510 Bacteria 790
239 Ga0157373_10003033 3300013100 Bacteria 12664
240 Ga0157373_10005270 3300013100 Bacteria 9711
241 Ga0157371_10000273 3300013102 Bacteria 70036
242 Ga0157371_10034452 3300013102 Bacteria 3631
243 Ga0157371_10505573 3300013102 Bacteria 893
244 Ga0157371_10521335 3300013102 Bacteria 879
245 Ga0157370_10004474 3300013104 Bacteria 16013
246 Ga0157370_10007899 3300013104 Bacteria 11527
247 Ga0157370_10020330 3300013104 Bacteria 6631
248 Ga0157370_10050276 3300013104 Bacteria 3985
249 Ga0157370_10395943 3300013104 Bacteria 1271
250 Ga0157369_10014597 3300013105 Bacteria 8861
251 Ga0157369_10282973 3300013105 Bacteria 1727
252 Ga0157369_10444709 3300013105 Bacteria 1342
253 Ga0157369_10448430 3300013105 Bacteria 1336
254 Ga0157378_12828762 3300013297 Bacteria 538
255 Ga0163162_10239328 3300013306 Bacteria 1946
256 Ga0157372_10031649 3300013307 Bacteria 5792
257 Ga0157372_10036492 3300013307 Bacteria 5418
258 Ga0157372_10257205 3300013307 Bacteria 2027
259 Ga0157372_11363442 3300013307 Bacteria 818
260 Ga0157372_11782347 3300013307 Bacteria 708
261 Ga0157375_13268001 3300013308 Bacteria 540
262 Ga0157380_10151548 3300014326 Bacteria 2005
263 Ga0157380_12194765 3300014326 Bacteria 616
264 Ga0182008_10031251 3300014497 Bacteria 2681
265 Ga0157377_10102982 3300014745 Bacteria 1704
266 Ga0157379_10046402 3300014968 Bacteria 3875
267 Ga0157376_10001360 3300014969 Bacteria 16077
268 Ga0157376_10943628 3300014969 Bacteria 883
269 Ga0157376_11772440 3300014969 Unclassified 653
270 Ga0163161_10184992 3300017792 Bacteria 1599
271 Ga0197907_11214187 3300020069 Bacteria 761
272 Ga0206354_10304488 3300020081 Bacteria 707
273 Ga0206353_10254265 3300020082 Bacteria 4083
274 Ga0213872_10377523 3300021361 Unclassified 578
275 Ga0209758_1000267 3300025297 Bacteria 103340
276 Ga0209758_1002898 3300025297 Bacteria 16560
277 Ga0209758_1018476 3300025297 Bacteria 3413
278 Ga0207656_10004688 3300025321 Bacteria 4793
279 Ga0207692_10003963 3300025898 Bacteria 5813
280 Ga0207692_10338154 3300025898 Unclassified 925
281 Ga0207642_10000839 3300025899 Bacteria 9538
282 Ga0207642_10554649 3300025899 Unclassified 710
283 Ga0207688_10566670 3300025901 Bacteria 714
284 Ga0207685_10005558 3300025905 Bacteria 3340
285 Ga0207699_10039510 3300025906 Bacteria 2712
286 Ga0207699_10243798 3300025906 Bacteria 1236
287 Ga0207699_11112258 3300025906 Unclassified 585
288 Ga0207645_10014464 3300025907 Bacteria 5280
289 Ga0207705_10004340 3300025909 Bacteria 10729
290 Ga0207684_10010039 3300025910 Bacteria 8341
291 Ga0207684_10627603 3300025910 Bacteria 916
292 Ga0207684_11351376 3300025910 Bacteria 585
293 Ga0207707_10001205 3300025912 Bacteria 24338
294 Ga0207707_10045954 3300025912 Bacteria 3803
295 Ga0207695_10004595 3300025913 Bacteria 18758
296 Ga0207695_10103624 3300025913 Bacteria 2836
297 Ga0207671_10170896 3300025914 Bacteria 1688
298 Ga0207693_10037062 3300025915 Bacteria 3843
299 Ga0207693_10500713 3300025915 Bacteria 948
300 Ga0207693_10729495 3300025915 Bacteria 766
301 Ga0207663_10027809 3300025916 Bacteria 3301
302 Ga0207663_10209846 3300025916 Bacteria 1411
303 Ga0207660_10001740 3300025917 Bacteria 14595
304 Ga0207660_10248337 3300025917 Bacteria 1404
305 Ga0207660_10264678 3300025917 Bacteria 1361
306 Ga0207660_10351805 3300025917 Bacteria 1181
307 Ga0207660_10456093 3300025917 Bacteria 1034
308 Ga0207662_10000081 3300025918 Bacteria 44149
309 Ga0207657_10000151 3300025919 Bacteria 70697
310 Ga0207657_10000751 3300025919 Bacteria 34386
311 Ga0207657_10003042 3300025919 Bacteria 17950
312 Ga0207649_10000967 3300025920 Bacteria 17795
313 Ga0207649_10109528 3300025920 Bacteria 1843
314 Ga0207649_10179429 3300025920 Bacteria 1481
315 Ga0207652_10003455 3300025921 Bacteria 13032
316 Ga0207694_10001041 3300025924 Bacteria 24125
317 Ga0207650_10634172 3300025925 Bacteria 900
318 Ga0207650_11139120 3300025925 Bacteria 664
319 Ga0207650_11180982 3300025925 Unclassified 651
320 Ga0207659_10687151 3300025926 Bacteria 876
321 Ga0207687_10000540 3300025927 Bacteria 25312
322 Ga0207700_10002081 3300025928 Bacteria 11427
323 Ga0207700_10131462 3300025928 Bacteria 2044
324 Ga0207664_10001164 3300025929 Bacteria 17490
325 Ga0207664_10016398 3300025929 Bacteria 5405
326 Ga0207644_10019099 3300025931 Bacteria 4647
327 Ga0207644_10058785 3300025931 Bacteria 2780
328 Ga0207690_10003450 3300025932 Bacteria 9433
329 Ga0207690_10067771 3300025932 Bacteria 2449
330 Ga0207690_10131510 3300025932 Bacteria 1832
331 Ga0207690_10134615 3300025932 Bacteria 1813
332 Ga0207706_10001691 3300025933 Bacteria 21750
333 Ga0207706_10478907 3300025933 Bacteria 1076
334 Ga0207686_10013213 3300025934 Bacteria 4564
335 Ga0207709_10003797 3300025935 Bacteria 8872
336 Ga0207670_10007113 3300025936 Bacteria 6233
337 Ga0207670_10496135 3300025936 Bacteria 991
338 Ga0207704_10050142 3300025938 Bacteria 2516
339 Ga0207704_10946845 3300025938 Unclassified 726
340 Ga0207665_10063563 3300025939 Bacteria 2507
341 Ga0207691_10075261 3300025940 Bacteria 3044
342 Ga0207689_10000238 3300025942 Bacteria 49163
343 Ga0207689_10368883 3300025942 Bacteria 1194
344 Ga0207661_10010838 3300025944 Bacteria 6577
345 Ga0207679_10010286 3300025945 Bacteria 6021
346 Ga0207679_10010391 3300025945 Bacteria 5991
347 Ga0207679_10053817 3300025945 Bacteria 2960
348 Ga0207667_10000460 3300025949 Bacteria 54739
349 Ga0207667_10035932 3300025949 Bacteria 5314
350 Ga0207667_10042563 3300025949 Bacteria 4826
351 Ga0207651_10022708 3300025960 Bacteria 3843
352 Ga0207651_10564108 3300025960 Bacteria 991
353 Ga0207712_10238085 3300025961 Unclassified 1465
354 Ga0207640_10002366 3300025981 Bacteria 10108
355 Ga0207640_10059013 3300025981 Bacteria 2530
356 Ga0207640_10890466 3300025981 Unclassified 777
357 Ga0207658_10049976 3300025986 Bacteria 3075
358 Ga0207677_10006636 3300026023 Bacteria 6350
359 Ga0207677_10296566 3300026023 Bacteria 1334
360 Ga0207677_12084391 3300026023 Unclassified 527
361 Ga0207703_10004524 3300026035 Bacteria 11404
362 Ga0207703_10190894 3300026035 Bacteria 1814
363 Ga0207639_10001340 3300026041 Bacteria 16630
364 Ga0207639_10015684 3300026041 Bacteria 5347
365 Ga0207639_10040346 3300026041 Bacteria 3483
366 Ga0207639_10178609 3300026041 Bacteria 1804
367 Ga0207639_10856860 3300026041 Bacteria 848
368 Ga0207678_10003830 3300026067 Bacteria 13532
369 Ga0207678_10025800 3300026067 Bacteria 5128
370 Ga0207708_10000276 3300026075 Bacteria 40264
371 Ga0207702_10003088 3300026078 Bacteria 15441
372 Ga0207702_10028377 3300026078 Bacteria 4652
373 Ga0207702_10835270 3300026078 Bacteria 911
374 Ga0207641_11984541 3300026088 Bacteria 583
375 Ga0207648_10005355 3300026089 Bacteria 12937
376 Ga0207648_10452984 3300026089 Bacteria 1169
377 Ga0207676_11128752 3300026095 Bacteria 776
378 Ga0207674_10000248 3300026116 Bacteria 67145
379 Ga0207675_100000120 3300026118 Bacteria 64416
380 Ga0207675_100468266 3300026118 Bacteria 1251
381 Ga0207698_10000475 3300026142 Bacteria 23321
382 Ga0207698_10002920 3300026142 Bacteria 10213
383 Ga0207698_10049343 3300026142 Bacteria 3203
384 Ga0207698_10088122 3300026142 Bacteria 2530
385 Ga0209967_1004667 3300027364 Bacteria 1827
386 Ga0209967_1031179 3300027364 Bacteria 798
387 Ga0209981_1006167 3300027378 Bacteria 1601
388 Ga0209981_1011592 3300027378 Bacteria 1216
389 Ga0209981_1014001 3300027378 Bacteria 1117
390 Ga0209996_1012299 3300027395 Bacteria 1149
391 Ga0209996_1024199 3300027395 Bacteria 864
392 Ga0210000_1001117 3300027462 Bacteria 3762
393 Ga0210000_1026843 3300027462 Bacteria 894
394 Ga0210000_1035697 3300027462 Bacteria 783
395 Ga0209968_1004771 3300027526 Bacteria 2031
396 Ga0209999_1014765 3300027543 Bacteria 1419
397 Ga0209999_1030822 3300027543 Bacteria 995
398 Ga0209999_1068066 3300027543 Bacteria 681
399 Ga0209982_1060182 3300027552 Bacteria 618
400 Ga0210002_1062964 3300027617 Bacteria 649
401 Ga0209983_1001705 3300027665 Bacteria 4855
402 Ga0209983_1068722 3300027665 Bacteria 788
403 Ga0209588_1009034 3300027671 Bacteria 2968
404 Ga0209971_1014026 3300027682 Bacteria 1899
405 Ga0209974_10001930 3300027876 Bacteria 7570
406 Ga0209974_10006944 3300027876 Bacteria 3920
407 Ga0207428_10000758 3300027907 Bacteria 36770
408 Ga0207428_10163958 3300027907 Bacteria 1686
409 Ga0268266_10878761 3300028379 Unclassified 867
410 Ga0268265_10002989 3300028380 Bacteria 12351
411 Ga0268264_10005363 3300028381 Bacteria 10865
412 Ga0268264_10048316 3300028381 Bacteria 3540
413 Ga0268264_10444908 3300028381 Bacteria 1254
414 Ga0265338_10395628 3300028800 Bacteria 986
415 Ga0265338_10949630 3300028800 Bacteria 584
416 Ga0307511_10000001 3300030521 Bacteria 206079
417 Ga0265340_10263704 3300031247 Bacteria 767
418 Ga0265327_10041581 3300031251 Bacteria 2476
419 Ga0307408_100356741 3300031548 Bacteria 1242
420 Ga0307408_100899272 3300031548 Bacteria 810
421 Ga0307508_10212658 3300031616 Bacteria 1534
422 Ga0307508_10676021 3300031616 Bacteria 640
423 Ga0307516_10242509 3300031730 Bacteria 1500
424 Ga0307405_10176508 3300031731 Unclassified 1529
425 Ga0307405_11571117 3300031731 Bacteria 580
426 Ga0307413_10006689 3300031824 Bacteria 5290
427 Ga0307410_10091464 3300031852 Bacteria 2160
428 Ga0307410_10462552 3300031852 Bacteria 1037
429 Ga0307410_11446630 3300031852 Bacteria 604
430 Ga0307406_10136962 3300031901 Bacteria 1727
431 Ga0307406_10515969 3300031901 Bacteria 972
432 Ga0307407_10091013 3300031903 Bacteria 1870
433 Ga0307416_100131617 3300032002 Bacteria 2253
434 Ga0307416_100499716 3300032002 Bacteria 1280
435 Ga0307416_100680726 3300032002 Bacteria 1116
436 Ga0307416_100810547 3300032002 Bacteria 1032
437 Ga0307416_100822242 3300032002 Bacteria 1026
438 Ga0307416_101323355 3300032002 Bacteria 826
439 Ga0307416_103122657 3300032002 Bacteria 554
440 Ga0307414_10709444 3300032004 Bacteria 911
441 Ga0307411_10001330 3300032005 Bacteria 9960
442 Ga0307411_10089040 3300032005 Bacteria 2149
443 Ga0307411_11201414 3300032005 Bacteria 687
444 Ga0307415_100085261 3300032126 Bacteria 2269
445 Ga0307415_100832573 3300032126 Bacteria 845
446 Ga0307507_10228255 3300033179 Bacteria 1239
447 Ga0307510_10156035 3300033180 Bacteria 1889
448 Ga0373930_0016991 3300034816 Bacteria 1382
449 Ga0373948_0002718 3300034817 Bacteria 2646
450 Ga0373959_0021659 3300034820 Bacteria 1236
451 Ga0373938_0015847 3300034957 Bacteria 1466
452 Ga0373926_0007399 3300035083 Bacteria 3657
453 Ga0373926_0197660 3300035083 Bacteria 773
454 Ga0373929_0009222 3300035085 Bacteria 1827
455 Ga0373940_0081569 3300035088 Bacteria 957
456 Ga0373944_0047295 3300035089 Bacteria 1347
457 Ga0373949_0014387 3300035090 Bacteria 1761
458 Ga0373952_0093073 3300035092 Bacteria 785
459 Ga0373932_0001387 3300035112 Bacteria 6796
460 Ga0373932_0351945 3300035112 Unclassified 560
461 Ga0373936_0006678 3300035113 Bacteria 4343
462 Ga0373936_0094679 3300035113 Bacteria 1255
463 Ga0373936_0173901 3300035113 Bacteria 942
464 Ga0373939_0002376 3300035114 Bacteria 4445
465 Ga0373945_0013405 3300035116 Bacteria 2734
466 Ga0373960_0030486 3300035121 Bacteria 1503
467 Ga0373960_0036457 3300035121 Bacteria 1401
468 Ga0373943_0002540 3300035170 Bacteria 8297
469 Ga0373943_0023215 3300035170 Bacteria 2882
470 Ga0373946_0078003 3300035171 Bacteria 1444
471 Ga0373942_0007911 3300035207 Bacteria 2471
472 Ga0373961_0018294 3300035241 Bacteria 1828
473 Ga0373962_0008923 3300035242 Bacteria 2476
474 Ga0373931_0000248 3300035691 Bacteria 22945
475 Ga0373935_0007685 3300035692 Bacteria 6462
476 Ga0373935_0197554 3300035692 Bacteria 1388
477 Ga0373927_0000238 3300035695 Bacteria 43099
478 Ga0373927_0141391 3300035695 Bacteria 1574
479 Ga0373947_0004553 3300035725 Bacteria 8125
480 Ga0373947_0108738 3300035725 Bacteria 1749
481 Ga0373925_0028100 3300037068 Bacteria 4119
482 Ga0373925_0191834 3300037068 Bacteria 1621
483 Ga0373925_1106627 3300037068 Bacteria 652
484 Ga0395899_0229336 3300037312 Bacteria 1283
485 Ga0395900_0082980 3300037418 Bacteria 3293
486 Ga0395898_1052577 3300037466 Bacteria 748
487 Ga0395905_0074000 3300037471 Bacteria 3193
488 Ga0395901_0187834 3300038443 Bacteria 2167
489 Ga0436361_0330901 3300039447 Bacteria 1885
490 Ga0439453_0022869 3300041408 Bacteria 1137
491 Ga0439441_000038 3300042001 Bacteria 9490
492 Ga0439443_001039 3300042003 Bacteria 2879
493 Ga0439443_009608 3300042003 Bacteria 1389
494 Ga0439451_008889 3300042009 Bacteria 2036
495 Ga0439456_043978 3300042013 Bacteria 971
496 Ga0439434_0031302 3300042435 Bacteria 1617
497 Ga0439435_0000706 3300042436 Bacteria 5562
498 Ga0439435_0003425 3300042436 Bacteria 3296
499 Ga0439444_0000748 3300042437 Bacteria 3861
500 Ga0439464_0077555 3300042439 Bacteria 989
501 Ga0439460_0000034 3300042461 Bacteria 19622
502 Ga0439460_0023721 3300042461 Bacteria 1694
503 Ga0451577_1185101 3300042876 Unclassified 682
504 Ga0453683_0460860 3300044673 Bacteria 823
505 Ga0466963_0648945 3300044694 Bacteria 745
506 Ga0451576_0000814 3300045051 Bacteria 61027
507 Ga0451576_0515557 3300045051 Bacteria 1256
508 Ga0451576_0667369 3300045051 Bacteria 1092
509 Ga0451576_1094189 3300045051 Unclassified 834
510 Ga0466967_1162543 3300045976 Bacteria 769
511 Ga0495603_0064976 3300046455 Bacteria 2150
512 Ga0495580_0000129 3300046472 Bacteria 52542
513 Ga0495639_0265725 3300046475 Bacteria 850
514 Ga0495584_0199542 3300046491 Bacteria 1017
515 Ga0495618_0855944 3300046514 Bacteria 527
516 Ga0495666_0009163 3300046526 Bacteria 4950
517 Ga0495642_0131433 3300046528 Bacteria 1078
518 Ga0495665_0291869 3300046531 Bacteria 836
519 Ga0495586_0001200 3300046535 Bacteria 14559
520 Ga0495598_0074706 3300046537 Bacteria 1075
521 Ga0495598_0120954 3300046537 Bacteria 887
522 Ga0495645_0290404 3300046543 Bacteria 1072
523 Ga0495622_0100878 3300046557 Bacteria 1323
524 Ga0495659_0009046 3300046664 Bacteria 3175
525 Ga0495659_0252927 3300046664 Bacteria 735
526 Ga0495588_0032491 3300046674 Bacteria 2631
527 Ga0495647_0002864 3300046681 Bacteria 5478
528 Ga0495658_0127347 3300046683 Bacteria 1547
529 Ga0495669_0273030 3300046684 Bacteria 813
530 Ga0495624_0118544 3300046690 Bacteria 1626
531 Ga0495581_0027084 3300047315 Bacteria 3325
532 Ga0495604_0946898 3300047317 Unclassified 536
533 Ga0495636_0006014 3300047318 Bacteria 4762
534 Ga0496100_0201405 3300048903 Bacteria 1451
535 Ga0496100_0902023 3300048903 Bacteria 694
536 Ga0496100_1065610 3300048903 Bacteria 637
537 Ga0496101_0204305 3300048904 Bacteria 1528
538 Ga0496102_1422187 3300048905 Unclassified 612
539 Ga0496103_0122691 3300048906 Bacteria 1656
540 Ga0496104_0014252 3300048907 Bacteria 7176
541 Ga0496104_0045650 3300048907 Bacteria 4122
542 Ga0496104_0595475 3300048907 Bacteria 1016
543 Ga0496105_0074052 3300048908 Bacteria 2813
544 Ga0496106_0008137 3300048909 Bacteria 7745
545 Ga0496106_0170702 3300048909 Bacteria 1724
546 Ga0496106_0543484 3300048909 Bacteria 932
547 Ga0496107_0054257 3300048910 Bacteria 2892
548 Ga0496107_1274388 3300048910 Unclassified 526
549 Ga0496108_1750898 3300048911 Unclassified 510
550 Ga0496109_0050662 3300048912 Bacteria 3781
551 Ga0496110_0073828 3300048913 Bacteria 3027
552 Ga0496110_0688929 3300048913 Bacteria 923
553 Ga0496111_1032988 3300048914 Unclassified 588
554 Ga0496113_0846665 3300048916 Bacteria 725
555 Ga0496114_0154005 3300048917 Bacteria 1995
556 Ga0496114_0375646 3300048917 Bacteria 1258
557 Ga0496115_0058786 3300048918 Bacteria 3095
558 Ga0496115_0986921 3300048918 Bacteria 644
559 Ga0496118_0157700 3300048921 Bacteria 1409
560 Ga0496119_0062434 3300048922 Bacteria 2220
561 Ga0501291_016415 3300049514 Bacteria 1131
562 Ga0501291_056472 3300049514 Bacteria 728
563 Ga0501293_010562 3300049516 Bacteria 800
564 Ga0501297_050169 3300049520 Bacteria 612
565 Ga0501298_152254 3300049521 Bacteria 566
566 Ga0501299_071211 3300049522 Bacteria 755
567 Ga0501299_075979 3300049522 Bacteria 738
568 Ga0501299_085396 3300049522 Bacteria 708
569 Ga0501039_0161926 3300049575 Bacteria 1759
570 Ga0501040_0932879 3300049576 Bacteria 629
571 Ga0501042_0133153 3300049578 Bacteria 1792
572 Ga0501042_0891418 3300049578 Bacteria 648
573 Ga0501048_0324147 3300049582 Bacteria 1097
574 Ga0501068_0613210 3300049584 Bacteria 709
575 Ga0501071_0228030 3300049587 Bacteria 1403
576 Ga0501071_1598304 3300049587 Unclassified 503
577 Ga0501072_0080016 3300049588 Bacteria 2588
578 Ga0501072_0203660 3300049588 Bacteria 1578
579 Ga0501072_0666873 3300049588 Bacteria 818
580 Ga0501072_0683277 3300049588 Bacteria 807
581 Ga0501072_0725910 3300049588 Bacteria 780
582 Ga0501075_0138293 3300049591 Bacteria 1855
583 Ga0501076_0271727 3300049592 Bacteria 1388
584 Ga0501076_0806923 3300049592 Unclassified 774
585 Ga0501198_083977 3300049649 Unclassified 621
586 Ga0501209_243591 3300049656 Bacteria 561
587 Ga0501214_016652 3300049659 Bacteria 891
588 Ga0501216_070548 3300049660 Bacteria 721
589 Ga0501227_072439 3300049665 Bacteria 896
590 Ga0501228_012888 3300049666 Bacteria 865
591 Ga0501230_045416 3300049667 Bacteria 861
592 Ga0501233_187973 3300049668 Unclassified 595
593 Ga0501235_219733 3300049669 Bacteria 521
594 Ga0501225_0113008 3300049705 Bacteria 802
595 Ga0501229_071413 3300049706 Bacteria 544
596 Ga0501081_0215408 3300049743 Bacteria 1396
597 Ga0501283_015624 3300049779 Bacteria 1170
598 Ga0501045_0277675 3300049824 Bacteria 1247
599 nmdc:mga03683_245660_c1 3300050489 Bacteria 830
600 nmdc:mga03n38_552297_c1 3300050490 Bacteria 652
601 nmdc:mga00v17_327952_c1 3300050491 Bacteria 995
602 nmdc:mga00v17_621869_c1 3300050491 Bacteria 696
603 nmdc:mga00v17_77928_c1 3300050491 Bacteria 2064
604 nmdc:mga0yw44_22437_c1 3300050492 Bacteria 3540
605 nmdc:mga0yw44_449181_c1 3300050492 Bacteria 874
606 nmdc:mga0k408_65206_c1 3300050493 Bacteria 2120
607 nmdc:mga06z11_39682_c1 3300050494 Bacteria 2345
608 nmdc:mga04h51_124786_c1 3300050495 Bacteria 963
609 nmdc:mga07m45_139518_c1 3300050496 Bacteria 1404
610 nmdc:mga07m45_35974_c2 3300050496 Bacteria 2396
611 nmdc:mga05p37_1349522_c1 3300050507 Bacteria 722
612 nmdc:mga05p37_2242280_c1 3300050507 Unclassified 505
613 nmdc:mga05p37_233794_c1 3300050507 Bacteria 2213
614 nmdc:mga05p37_381285_c1 3300050507 Bacteria 1652
615 nmdc:mga05p37_453_c1 3300050507 Bacteria 44606
616 nmdc:mga05p37_688374_c1 3300050507 Bacteria 1138
617 nmdc:mga05p37_940686_c1 3300050507 Bacteria 926
618 nmdc:mga09592_148654_c1 3300050508 Bacteria 2021
619 nmdc:mga09592_2521_c1 3300050508 Bacteria 14819
620 nmdc:mga09592_316333_c1 3300050508 Bacteria 1353
621 nmdc:mga09592_610553_c1 3300050508 Bacteria 934
622 nmdc:mga0qj67_19850_c1 3300050509 Bacteria 5141
623 nmdc:mga0qj67_284626_c1 3300050509 Bacteria 1340
624 nmdc:mga06r32_1164781_c1 3300050510 Bacteria 718
625 nmdc:mga06r32_119414_c1 3300050510 Bacteria 2600
626 nmdc:mga06r32_171041_c1 3300050510 Bacteria 2157
627 nmdc:mga06r32_229875_c1 3300050510 Bacteria 1843
628 nmdc:mga06r32_452194_c1 3300050510 Bacteria 1264
629 nmdc:mga08y16_1018957_c1 3300050511 Bacteria 807
630 nmdc:mga08y16_43257_c1 3300050511 Bacteria 4720
631 nmdc:mga08y16_71997_c1 3300050511 Bacteria 3602
632 nmdc:mga0n895_1496506_c1 3300050512 Bacteria 641
633 nmdc:mga0n895_396549_c1 3300050512 Bacteria 1396
634 nmdc:mga0rr50_624195_c1 3300050513 Bacteria 919
635 nmdc:mga0a205_160961_c1 3300050515 Bacteria 2141
636 nmdc:mga0a205_255009_c1 3300050515 Bacteria 1633
637 nmdc:mga0sz30_378100_c1 3300050516 Unclassified 634
638 nmdc:mga0sz30_81081_c1 3300050516 Bacteria 1404
639 Ga0500643_003071 3300053087 Bacteria 8206
640 Ga0500644_0313433 3300053088 Bacteria 673
641 Ga0500646_0000184 3300053090 Bacteria 18721
642 Ga0500583_0005384 3300053092 Bacteria 4285
643 Ga0500583_0124688 3300053092 Bacteria 1275
644 Ga0500651_0421426 3300053093 Unclassified 747
645 Ga0500641_0004864 3300053096 Bacteria 4755
646 Ga0500641_0249765 3300053096 Bacteria 744
647 Ga0500650_0036589 3300053098 Bacteria 2253
648 Ga0500650_0166244 3300053098 Bacteria 1016
649 Ga0500595_000003 3300053119 Bacteria 419332
650 Ga0500595_002937 3300053119 Bacteria 8144
651 Ga0500595_054026 3300053119 Bacteria 1234
652 Ga0500642_0085297 3300053130 Bacteria 1455
653 Ga0500642_0174774 3300053130 Bacteria 1005
654 Ga0500655_000967 3300053133 Bacteria 5534
655 Ga0500568_0045198 3300053139 Bacteria 1754
656 Ga0500568_0050545 3300053139 Bacteria 1638
657 Ga0500588_0221381 3300053146 Bacteria 706
658 Ga0500604_0000501 3300053151 Bacteria 10800
659 Ga0500627_0186692 3300053158 Bacteria 932
660 Ga0500637_0108147 3300053178 Bacteria 1613
661 Ga0530510_0238418 3300061734 Bacteria 1354

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005981 Ga0081538_10128292 Ga0081538_101282921 91
2 3300031548 Ga0307408_100356741 Ga0307408_1003567412 92
3 3300037068 Ga0373925_1106627 Ga0373925_1106627_157_441 92
4 3300049522 Ga0501299_075979 Ga0501299_075979_283_567 92
5 3300049667 Ga0501230_045416 Ga0501230_045416_333_611 92
6 3300049576 Ga0501040_0932879 Ga0501040_0932879_22_318 96
7 3300050509 nmdc:mga0qj67_284626_c1 nmdc:mga0qj67_284626_c1_24_317 96
8 3300005563 Ga0068855_100287727 Ga0068855_1002877272 97
9 3300005578 Ga0068854_100195011 Ga0068854_1001950112 97
10 3300025932 Ga0207690_10067771 Ga0207690_100677712 97
11 3300026041 Ga0207639_10178609 Ga0207639_101786092 97
12 3300048914 Ga0496111_1032988 Ga0496111_1032988_258_557 97
13 3300031852 Ga0307410_10462552 Ga0307410_104625522 102
14 3300032002 Ga0307416_101323355 Ga0307416_1013233552 102
15 3300032005 Ga0307411_11201414 Ga0307411_112014142 102
16 3300032126 Ga0307415_100832573 Ga0307415_1008325732 102
17 3300050511 nmdc:mga08y16_71997_c1 nmdc:mga08y16_71997_c1_18_329 103
18 3300046528 Ga0495642_0131433 Ga0495642_0131433_569_883 104
19 3300007076 Ga0075435_100656015 Ga0075435_1006560152 108
20 3300049582 Ga0501048_0324147 Ga0501048_0324147_324_653 109
21 3300049588 Ga0501072_0666873 Ga0501072_0666873_112_441 109
22 3300049591 Ga0501075_0138293 Ga0501075_0138293_1228_1557 109
23 3300049592 Ga0501076_0271727 Ga0501076_0271727_561_890 109
24 3300049824 Ga0501045_0277675 Ga0501045_0277675_491_820 109
25 3300005334 Ga0068869_100000251 Ga0068869_10000025119 110
26 3300005335 Ga0070666_10025642 Ga0070666_100256424 110
27 3300005336 Ga0070680_100028969 Ga0070680_1000289696 110
28 3300005336 Ga0070680_100519708 Ga0070680_1005197082 110
29 3300005337 Ga0070682_100001570 Ga0070682_1000015702 110
30 3300005338 Ga0068868_100000323 Ga0068868_10000032321 110
31 3300005338 Ga0068868_100226386 Ga0068868_1002263861 110
32 3300005340 Ga0070689_100000549 Ga0070689_10000054919 110
33 3300005340 Ga0070689_100008057 Ga0070689_1000080577 110
34 3300005340 Ga0070689_100345986 Ga0070689_1003459862 110
35 3300005341 Ga0070691_10001307 Ga0070691_1000130710 110
36 3300005343 Ga0070687_100000059 Ga0070687_10000005918 110
37 3300005355 Ga0070671_100127703 Ga0070671_1001277032 110
38 3300005364 Ga0070673_100616129 Ga0070673_1006161292 110
39 3300005365 Ga0070688_100292239 Ga0070688_1002922392 110
40 3300005365 Ga0070688_100344786 Ga0070688_1003447862 110
41 3300005438 Ga0070701_10000194 Ga0070701_1000019420 110
42 3300005438 Ga0070701_10197462 Ga0070701_101974622 110
43 3300005439 Ga0070711_100713172 Ga0070711_1007131722 110
44 3300005440 Ga0070705_100000370 Ga0070705_1000003704 110
45 3300005440 Ga0070705_100150062 Ga0070705_1001500622 110
46 3300005441 Ga0070700_100000391 Ga0070700_1000003914 110
47 3300005444 Ga0070694_100000813 Ga0070694_10000081317 110
48 3300005444 Ga0070694_101376060 Ga0070694_1013760602 110
49 3300005445 Ga0070708_100124028 Ga0070708_1001240282 110
50 3300005456 Ga0070678_100459062 Ga0070678_1004590622 110
51 3300005457 Ga0070662_100307183 Ga0070662_1003071832 110
52 3300005458 Ga0070681_10143996 Ga0070681_101439962 110
53 3300005459 Ga0068867_100000514 Ga0068867_1000005149 110
54 3300005466 Ga0070685_10892951 Ga0070685_108929512 110
55 3300005530 Ga0070679_102111494 Ga0070679_1021114942 110
56 3300005539 Ga0068853_100021931 Ga0068853_1000219314 110
57 3300005544 Ga0070686_100000243 Ga0070686_1000002434 110
58 3300005545 Ga0070695_100000141 Ga0070695_10000014128 110
59 3300005546 Ga0070696_100000253 Ga0070696_10000025317 110
60 3300005547 Ga0070693_100000009 Ga0070693_10000000929 110
61 3300005549 Ga0070704_100000076 Ga0070704_10000007631 110
62 3300005563 Ga0068855_100004666 Ga0068855_1000046664 110
63 3300005578 Ga0068854_100001580 Ga0068854_1000015801 110
64 3300005614 Ga0068856_100024817 Ga0068856_1000248172 110
65 3300005615 Ga0070702_100000075 Ga0070702_10000007519 110
66 3300005617 Ga0068859_100001974 Ga0068859_1000019745 110
67 3300005618 Ga0068864_100611897 Ga0068864_1006118972 110
68 3300005718 Ga0068866_10000347 Ga0068866_1000034716 110
69 3300005719 Ga0068861_100000106 Ga0068861_10000010613 110
70 3300005841 Ga0068863_100472136 Ga0068863_1004721362 110
71 3300005841 Ga0068863_101376880 Ga0068863_1013768801 110
72 3300005842 Ga0068858_100137412 Ga0068858_1001374122 110
73 3300005842 Ga0068858_100188129 Ga0068858_1001881292 110
74 3300005843 Ga0068860_100000484 Ga0068860_10000048429 110
75 3300005843 Ga0068860_100061096 Ga0068860_1000610964 110
76 3300005844 Ga0068862_100001748 Ga0068862_1000017482 110
77 3300006173 Ga0070716_100616749 Ga0070716_1006167491 110
78 3300006237 Ga0097621_100012458 Ga0097621_1000124587 110
79 3300006358 Ga0068871_100017622 Ga0068871_1000176227 110
80 3300006844 Ga0075428_101213397 Ga0075428_1012133972 110
81 3300006846 Ga0075430_100068421 Ga0075430_1000684215 110
82 3300006846 Ga0075430_100834499 Ga0075430_1008344991 110
83 3300006847 Ga0075431_100047993 Ga0075431_1000479936 110
84 3300006847 Ga0075431_100240397 Ga0075431_1002403972 110
85 3300006852 Ga0075433_10001240 Ga0075433_1000124015 110
86 3300006880 Ga0075429_100326289 Ga0075429_1003262892 110
87 3300006880 Ga0075429_101662242 Ga0075429_1016622422 110
88 3300006914 Ga0075436_100000896 Ga0075436_10000089612 110
89 3300006931 Ga0097620_100001974 Ga0097620_1000019745 110
90 3300009098 Ga0105245_10000329 Ga0105245_1000032916 110
91 3300009147 Ga0114129_10796389 Ga0114129_107963892 110
92 3300009148 Ga0105243_10000590 Ga0105243_1000059021 110
93 3300009174 Ga0105241_10579476 Ga0105241_105794761 110
94 3300009176 Ga0105242_10000243 Ga0105242_1000024312 110
95 3300009553 Ga0105249_10000832 Ga0105249_1000083212 110
96 3300010375 Ga0105239_10023448 Ga0105239_100234488 110
97 3300011119 Ga0105246_11097290 Ga0105246_110972901 110
98 3300013102 Ga0157371_10521335 Ga0157371_105213352 110
99 3300013306 Ga0163162_10239328 Ga0163162_102393282 110
100 3300013307 Ga0157372_11363442 Ga0157372_113634422 110
101 3300013308 Ga0157375_13268001 Ga0157375_132680011 110
102 3300014326 Ga0157380_10151548 Ga0157380_101515482 110
103 3300014326 Ga0157380_12194765 Ga0157380_121947651 110
104 3300014745 Ga0157377_10102982 Ga0157377_101029822 110
105 3300014968 Ga0157379_10046402 Ga0157379_100464025 110
106 3300014969 Ga0157376_10001360 Ga0157376_1000136012 110
107 3300017792 Ga0163161_10184992 Ga0163161_101849921 110
108 3300025899 Ga0207642_10000839 Ga0207642_100008399 110
109 3300025901 Ga0207688_10566670 Ga0207688_105666702 110
110 3300025912 Ga0207707_10045954 Ga0207707_100459542 110
111 3300025917 Ga0207660_10248337 Ga0207660_102483372 110
112 3300025918 Ga0207662_10000081 Ga0207662_1000008114 110
113 3300025927 Ga0207687_10000540 Ga0207687_1000054022 110
114 3300025931 Ga0207644_10058785 Ga0207644_100587851 110
115 3300025934 Ga0207686_10013213 Ga0207686_100132134 110
116 3300025935 Ga0207709_10003797 Ga0207709_100037979 110
117 3300025936 Ga0207670_10007113 Ga0207670_100071135 110
118 3300025936 Ga0207670_10496135 Ga0207670_104961352 110
119 3300025938 Ga0207704_10050142 Ga0207704_100501424 110
120 3300025942 Ga0207689_10000238 Ga0207689_1000023821 110
121 3300025960 Ga0207651_10564108 Ga0207651_105641082 110
122 3300025981 Ga0207640_10059013 Ga0207640_100590135 110
123 3300026023 Ga0207677_10006636 Ga0207677_100066367 110
124 3300026023 Ga0207677_10296566 Ga0207677_102965662 110
125 3300026035 Ga0207703_10004524 Ga0207703_100045242 110
126 3300026035 Ga0207703_10190894 Ga0207703_101908942 110
127 3300026041 Ga0207639_10015684 Ga0207639_100156842 110
128 3300026075 Ga0207708_10000276 Ga0207708_1000027622 110
129 3300026078 Ga0207702_10835270 Ga0207702_108352702 110
130 3300026089 Ga0207648_10005355 Ga0207648_100053557 110
131 3300026118 Ga0207675_100000120 Ga0207675_10000012021 110
132 3300026142 Ga0207698_10049343 Ga0207698_100493434 110
133 3300027364 Ga0209967_1004667 Ga0209967_10046673 110
134 3300027364 Ga0209967_1031179 Ga0209967_10311792 110
135 3300027378 Ga0209981_1006167 Ga0209981_10061672 110
136 3300027378 Ga0209981_1011592 Ga0209981_10115922 110
137 3300027395 Ga0209996_1012299 Ga0209996_10122992 110
138 3300027462 Ga0210000_1001117 Ga0210000_10011173 110
139 3300027462 Ga0210000_1026843 Ga0210000_10268432 110
140 3300027526 Ga0209968_1004771 Ga0209968_10047712 110
141 3300027543 Ga0209999_1030822 Ga0209999_10308222 110
142 3300027543 Ga0209999_1068066 Ga0209999_10680662 110
143 3300027552 Ga0209982_1060182 Ga0209982_10601821 110
144 3300027665 Ga0209983_1068722 Ga0209983_10687222 110
145 3300027876 Ga0209974_10006944 Ga0209974_100069443 110
146 3300027907 Ga0207428_10163958 Ga0207428_101639582 110
147 3300028380 Ga0268265_10002989 Ga0268265_1000298914 110
148 3300028381 Ga0268264_10005363 Ga0268264_100053632 110
149 3300028381 Ga0268264_10048316 Ga0268264_100483162 110
150 3300031852 Ga0307410_11446630 Ga0307410_114466302 110
151 3300031901 Ga0307406_10515969 Ga0307406_105159692 110
152 3300032002 Ga0307416_100131617 Ga0307416_1001316172 110
153 3300032002 Ga0307416_100680726 Ga0307416_1006807262 110
154 3300032005 Ga0307411_10089040 Ga0307411_100890402 110
155 3300035083 Ga0373926_0007399 Ga0373926_0007399_668_1000 110
156 3300035083 Ga0373926_0197660 Ga0373926_0197660_413_745 110
157 3300035088 Ga0373940_0081569 Ga0373940_0081569_33_365 110
158 3300035089 Ga0373944_0047295 Ga0373944_0047295_636_968 110
159 3300035112 Ga0373932_0351945 Ga0373932_0351945_133_465 110
160 3300035113 Ga0373936_0006678 Ga0373936_0006678_2655_2987 110
161 3300035113 Ga0373936_0173901 Ga0373936_0173901_379_711 110
162 3300035116 Ga0373945_0013405 Ga0373945_0013405_632_964 110
163 3300035121 Ga0373960_0030486 Ga0373960_0030486_1086_1418 110
164 3300035170 Ga0373943_0002540 Ga0373943_0002540_568_900 110
165 3300035170 Ga0373943_0023215 Ga0373943_0023215_1902_2234 110
166 3300035171 Ga0373946_0078003 Ga0373946_0078003_663_995 110
167 3300035692 Ga0373935_0007685 Ga0373935_0007685_4209_4541 110
168 3300035692 Ga0373935_0197554 Ga0373935_0197554_780_1112 110
169 3300035695 Ga0373927_0000238 Ga0373927_0000238_3147_3479 110
170 3300035695 Ga0373927_0141391 Ga0373927_0141391_746_1078 110
171 3300035725 Ga0373947_0004553 Ga0373947_0004553_5968_6300 110
172 3300035725 Ga0373947_0108738 Ga0373947_0108738_755_1087 110
173 3300037068 Ga0373925_0028100 Ga0373925_0028100_1962_2294 110
174 3300037068 Ga0373925_0191834 Ga0373925_0191834_663_995 110
175 3300041408 Ga0439453_0022869 Ga0439453_0022869_728_1060 110
176 3300042003 Ga0439443_009608 Ga0439443_009608_1000_1332 110
177 3300042013 Ga0439456_043978 Ga0439456_043978_300_632 110
178 3300042435 Ga0439434_0031302 Ga0439434_0031302_809_1141 110
179 3300042436 Ga0439435_0003425 Ga0439435_0003425_457_789 110
180 3300042461 Ga0439460_0023721 Ga0439460_0023721_941_1273 110
181 3300045051 Ga0451576_0000814 Ga0451576_0000814_44404_44736 110
182 3300045051 Ga0451576_0667369 Ga0451576_0667369_611_943 110
183 3300046455 Ga0495603_0064976 Ga0495603_0064976_680_1012 110
184 3300046472 Ga0495580_0000129 Ga0495580_0000129_6051_6383 110
185 3300046475 Ga0495639_0265725 Ga0495639_0265725_42_374 110
186 3300046526 Ga0495666_0009163 Ga0495666_0009163_4460_4792 110
187 3300046535 Ga0495586_0001200 Ga0495586_0001200_6460_6792 110
188 3300046557 Ga0495622_0100878 Ga0495622_0100878_747_1079 110
189 3300046674 Ga0495588_0032491 Ga0495588_0032491_587_919 110
190 3300046681 Ga0495647_0002864 Ga0495647_0002864_425_757 110
191 3300046683 Ga0495658_0127347 Ga0495658_0127347_629_961 110
192 3300046690 Ga0495624_0118544 Ga0495624_0118544_924_1256 110
193 3300047315 Ga0495581_0027084 Ga0495581_0027084_1491_1823 110
194 3300047318 Ga0495636_0006014 Ga0495636_0006014_403_735 110
195 3300049520 Ga0501297_050169 Ga0501297_050169_194_526 110
196 3300049521 Ga0501298_152254 Ga0501298_152254_182_514 110
197 3300049522 Ga0501299_071211 Ga0501299_071211_221_553 110
198 3300049522 Ga0501299_085396 Ga0501299_085396_170_502 110
199 3300049578 Ga0501042_0133153 Ga0501042_0133153_336_668 110
200 3300049587 Ga0501071_1598304 Ga0501071_1598304_63_395 110
201 3300049588 Ga0501072_0725910 Ga0501072_0725910_328_660 110
202 3300049659 Ga0501214_016652 Ga0501214_016652_485_817 110
203 3300049666 Ga0501228_012888 Ga0501228_012888_510_842 110
204 3300049669 Ga0501235_219733 Ga0501235_219733_71_403 110
205 3300049705 Ga0501225_0113008 Ga0501225_0113008_23_355 110
206 3300049706 Ga0501229_071413 Ga0501229_071413_157_489 110
207 3300049779 Ga0501283_015624 Ga0501283_015624_398_730 110
208 3300050507 nmdc:mga05p37_381285_c1 nmdc:mga05p37_381285_c1_276_608 110
209 3300050507 nmdc:mga05p37_940686_c1 nmdc:mga05p37_940686_c1_83_415 110
210 3300050508 nmdc:mga09592_316333_c1 nmdc:mga09592_316333_c1_377_709 110
211 3300050509 nmdc:mga0qj67_19850_c1 nmdc:mga0qj67_19850_c1_1896_2228 110
212 3300050510 nmdc:mga06r32_171041_c1 nmdc:mga06r32_171041_c1_58_390 110
213 3300005295 Ga0065707_10095642 Ga0065707_100956425 111
214 3300005336 Ga0070680_100048610 Ga0070680_1000486105 111
215 3300005345 Ga0070692_10133525 Ga0070692_101335252 111
216 3300005440 Ga0070705_100001756 Ga0070705_1000017562 111
217 3300005444 Ga0070694_100019804 Ga0070694_1000198045 111
218 3300005545 Ga0070695_100060007 Ga0070695_1000600074 111
219 3300005546 Ga0070696_100002444 Ga0070696_10000244411 111
220 3300005546 Ga0070696_100042788 Ga0070696_1000427885 111
221 3300005549 Ga0070704_100017240 Ga0070704_1000172405 111
222 3300006844 Ga0075428_100000615 Ga0075428_10000061533 111
223 3300006844 Ga0075428_100083015 Ga0075428_1000830154 111
224 3300006844 Ga0075428_100208444 Ga0075428_1002084444 111
225 3300006846 Ga0075430_100337992 Ga0075430_1003379922 111
226 3300006846 Ga0075430_100401392 Ga0075430_1004013922 111
227 3300006847 Ga0075431_100497262 Ga0075431_1004972622 111
228 3300006847 Ga0075431_100867239 Ga0075431_1008672392 111
229 3300006852 Ga0075433_11035065 Ga0075433_110350652 111
230 3300006880 Ga0075429_100000506 Ga0075429_10000050611 111
231 3300006880 Ga0075429_100226441 Ga0075429_1002264412 111
232 3300009094 Ga0111539_10046625 Ga0111539_100466254 111
233 3300009094 Ga0111539_10388342 Ga0111539_103883423 111
234 3300009147 Ga0114129_10000534 Ga0114129_1000053425 111
235 3300009147 Ga0114129_10154576 Ga0114129_101545764 111
236 3300009176 Ga0105242_12847243 Ga0105242_128472431 111
237 3300012510 Ga0157316_1014179 Ga0157316_10141792 111
238 3300014969 Ga0157376_11772440 Ga0157376_117724401 111
239 3300025917 Ga0207660_10456093 Ga0207660_104560932 111
240 3300027907 Ga0207428_10000758 Ga0207428_1000075819 111
241 3300031731 Ga0307405_11571117 Ga0307405_115711172 111
242 3300032002 Ga0307416_100499716 Ga0307416_1004997162 111
243 3300033179 Ga0307507_10228255 Ga0307507_102282552 111
244 3300034816 Ga0373930_0016991 Ga0373930_0016991_651_992 111
245 3300034817 Ga0373948_0002718 Ga0373948_0002718_375_716 111
246 3300034820 Ga0373959_0021659 Ga0373959_0021659_186_527 111
247 3300034957 Ga0373938_0015847 Ga0373938_0015847_741_1082 111
248 3300035085 Ga0373929_0009222 Ga0373929_0009222_840_1181 111
249 3300035090 Ga0373949_0014387 Ga0373949_0014387_419_760 111
250 3300035092 Ga0373952_0093073 Ga0373952_0093073_298_639 111
251 3300035112 Ga0373932_0001387 Ga0373932_0001387_2714_3055 111
252 3300035114 Ga0373939_0002376 Ga0373939_0002376_121_462 111
253 3300035121 Ga0373960_0036457 Ga0373960_0036457_690_1031 111
254 3300035207 Ga0373942_0007911 Ga0373942_0007911_138_479 111
255 3300035241 Ga0373961_0018294 Ga0373961_0018294_228_569 111
256 3300035242 Ga0373962_0008923 Ga0373962_0008923_942_1283 111
257 3300035691 Ga0373931_0000248 Ga0373931_0000248_2131_2472 111
258 3300042001 Ga0439441_000038 Ga0439441_000038_1222_1557 111
259 3300042003 Ga0439443_001039 Ga0439443_001039_908_1243 111
260 3300042009 Ga0439451_008889 Ga0439451_008889_975_1310 111
261 3300042436 Ga0439435_0000706 Ga0439435_0000706_643_978 111
262 3300042437 Ga0439444_0000748 Ga0439444_0000748_1920_2255 111
263 3300042439 Ga0439464_0077555 Ga0439464_0077555_392_727 111
264 3300042461 Ga0439460_0000034 Ga0439460_0000034_14819_15154 111
265 3300044673 Ga0453683_0460860 Ga0453683_0460860_253_594 111
266 3300046491 Ga0495584_0199542 Ga0495584_0199542_274_609 111
267 3300046537 Ga0495598_0120954 Ga0495598_0120954_384_725 111
268 3300046664 Ga0495659_0009046 Ga0495659_0009046_673_1014 111
269 3300046664 Ga0495659_0252927 Ga0495659_0252927_165_500 111
270 3300046684 Ga0495669_0273030 Ga0495669_0273030_238_573 111
271 3300049575 Ga0501039_0161926 Ga0501039_0161926_454_795 111
272 3300049578 Ga0501042_0891418 Ga0501042_0891418_203_538 111
273 3300049584 Ga0501068_0613210 Ga0501068_0613210_217_558 111
274 3300049588 Ga0501072_0080016 Ga0501072_0080016_1551_1892 111
275 3300049588 Ga0501072_0203660 Ga0501072_0203660_1219_1560 111
276 3300049592 Ga0501076_0806923 Ga0501076_0806923_389_724 111
277 3300049649 Ga0501198_083977 Ga0501198_083977_188_523 111
278 3300049660 Ga0501216_070548 Ga0501216_070548_21_356 111
279 3300049743 Ga0501081_0215408 Ga0501081_0215408_932_1273 111
280 3300050507 nmdc:mga05p37_233794_c1 nmdc:mga05p37_233794_c1_410_745 111
281 3300050507 nmdc:mga05p37_453_c1 nmdc:mga05p37_453_c1_28369_28710 111
282 3300050508 nmdc:mga09592_2521_c1 nmdc:mga09592_2521_c1_1820_2161 111
283 3300050508 nmdc:mga09592_610553_c1 nmdc:mga09592_610553_c1_365_700 111
284 3300050510 nmdc:mga06r32_119414_c1 nmdc:mga06r32_119414_c1_1663_1998 111
285 3300050510 nmdc:mga06r32_452194_c1 nmdc:mga06r32_452194_c1_192_533 111
286 3300050511 nmdc:mga08y16_43257_c1 nmdc:mga08y16_43257_c1_2527_2868 111
287 3300050515 nmdc:mga0a205_160961_c1 nmdc:mga0a205_160961_c1_1076_1417 111
288 3300061734 Ga0530510_0238418 Ga0530510_0238418_903_1244 111
289 3300046531 Ga0495665_0291869 Ga0495665_0291869_86_430 112
290 3300003203 JGI25406J46586_10064461 JGI25406J46586_100644612 113
291 3300005985 Ga0081539_10000803 Ga0081539_1000080313 113
292 3300053119 Ga0500595_054026 Ga0500595_054026_58_405 113
293 3300005354 Ga0070675_100133138 Ga0070675_1001331381 114
294 3300005468 Ga0070707_100998507 Ga0070707_1009985072 114
295 3300005471 Ga0070698_101155537 Ga0070698_1011555371 114
296 3300005518 Ga0070699_100029629 Ga0070699_1000296292 114
297 3300005518 Ga0070699_101261050 Ga0070699_1012610501 114
298 3300006914 Ga0075436_100010510 Ga0075436_1000105105 114
299 3300007265 Ga0099794_10568206 Ga0099794_105682061 114
300 3300025926 Ga0207659_10687151 Ga0207659_106871512 114
301 3300031548 Ga0307408_100899272 Ga0307408_1008992722 114
302 3300032002 Ga0307416_103122657 Ga0307416_1031226571 114
303 3300045976 Ga0466967_1162543 Ga0466967_1162543_374_721 114
304 3300046537 Ga0495598_0074706 Ga0495598_0074706_42_389 114
305 3300049514 Ga0501291_056472 Ga0501291_056472_183_530 114
306 3300049516 Ga0501293_010562 Ga0501293_010562_357_704 114
307 3300049656 Ga0501209_243591 Ga0501209_243591_31_378 114
308 3300049668 Ga0501233_187973 Ga0501233_187973_28_375 114
309 3300050507 nmdc:mga05p37_1349522_c1 nmdc:mga05p37_1349522_c1_93_440 114
310 3300005330 Ga0070690_101692375 Ga0070690_1016923751 115
311 3300005331 Ga0070670_100203174 Ga0070670_1002031742 115
312 3300005353 Ga0070669_100328277 Ga0070669_1003282772 115
313 3300005437 Ga0070710_10454976 Ga0070710_104549762 115
314 3300005437 Ga0070710_10621513 Ga0070710_106215131 115
315 3300005445 Ga0070708_100303879 Ga0070708_1003038792 115
316 3300005468 Ga0070707_100545657 Ga0070707_1005456572 115
317 3300005471 Ga0070698_100294330 Ga0070698_1002943302 115
318 3300005471 Ga0070698_100484920 Ga0070698_1004849202 115
319 3300005719 Ga0068861_100669004 Ga0068861_1006690042 115
320 3300006038 Ga0075365_10834265 Ga0075365_108342652 115
321 3300006175 Ga0070712_100690685 Ga0070712_1006906852 115
322 3300006844 Ga0075428_100342414 Ga0075428_1003424142 115
323 3300006846 Ga0075430_100101040 Ga0075430_1001010403 115
324 3300006847 Ga0075431_100219568 Ga0075431_1002195682 115
325 3300006880 Ga0075429_100234264 Ga0075429_1002342643 115
326 3300007265 Ga0099794_10008683 Ga0099794_100086833 115
327 3300009147 Ga0114129_11399935 Ga0114129_113999351 115
328 3300009553 Ga0105249_12931582 Ga0105249_129315821 115
329 3300021361 Ga0213872_10377523 Ga0213872_103775231 115
330 3300025898 Ga0207692_10338154 Ga0207692_103381542 115
331 3300025915 Ga0207693_10500713 Ga0207693_105007132 115
332 3300025925 Ga0207650_10634172 Ga0207650_106341722 115
333 3300025925 Ga0207650_11180982 Ga0207650_111809822 115
334 3300025961 Ga0207712_10238085 Ga0207712_102380851 115
335 3300026088 Ga0207641_11984541 Ga0207641_119845412 115
336 3300026118 Ga0207675_100468266 Ga0207675_1004682662 115
337 3300027671 Ga0209588_1009034 Ga0209588_10090343 115
338 3300031903 Ga0307407_10091013 Ga0307407_100910132 115
339 3300032002 Ga0307416_100810547 Ga0307416_1008105472 115
340 3300039447 Ga0436361_0330901 Ga0436361_0330901_1371_1724 115
341 3300042876 Ga0451577_1185101 Ga0451577_1185101_194_544 115
342 3300045051 Ga0451576_1094189 Ga0451576_1094189_451_801 115
343 3300046514 Ga0495618_0855944 Ga0495618_0855944_86_439 115
344 3300048903 Ga0496100_0902023 Ga0496100_0902023_113_466 115
345 3300048910 Ga0496107_1274388 Ga0496107_1274388_42_395 115
346 3300048921 Ga0496118_0157700 Ga0496118_0157700_194_547 115
347 3300048922 Ga0496119_0062434 Ga0496119_0062434_1651_2004 115
348 3300049514 Ga0501291_016415 Ga0501291_016415_273_623 115
349 3300049587 Ga0501071_0228030 Ga0501071_0228030_789_1139 115
350 3300049588 Ga0501072_0683277 Ga0501072_0683277_275_625 115
351 3300049665 Ga0501227_072439 Ga0501227_072439_422_772 115
352 3300050508 nmdc:mga09592_148654_c1 nmdc:mga09592_148654_c1_56_406 115
353 3300050510 nmdc:mga06r32_1164781_c1 nmdc:mga06r32_1164781_c1_304_654 115
354 3300050510 nmdc:mga06r32_229875_c1 nmdc:mga06r32_229875_c1_1360_1710 115
355 3300050512 nmdc:mga0n895_1496506_c1 nmdc:mga0n895_1496506_c1_43_396 115
356 3300053093 Ga0500651_0421426 Ga0500651_0421426_56_409 115
357 3300053098 Ga0500650_0166244 Ga0500650_0166244_57_410 115
358 3300053130 Ga0500642_0174774 Ga0500642_0174774_87_440 115
359 3300053139 Ga0500568_0045198 Ga0500568_0045198_566_919 115
360 3300053158 Ga0500627_0186692 Ga0500627_0186692_436_789 115
361 3300001979 JGI24740J21852_10158448 JGI24740J21852_101584481 116
362 3300002075 JGI24738J21930_10123452 JGI24738J21930_101234522 116
363 3300003215 JGI25153J46596_10000326 JGI25153J46596_1000032621 116
364 3300003215 JGI25153J46596_10031146 JGI25153J46596_100311463 116
365 3300003323 rootH1_10076163 rootH1_100761632 116
366 3300005327 Ga0070658_10002078 Ga0070658_100020789 116
367 3300005327 Ga0070658_10328272 Ga0070658_103282722 116
368 3300005328 Ga0070676_10062667 Ga0070676_100626672 116
369 3300005329 Ga0070683_100001436 Ga0070683_10000143610 116
370 3300005331 Ga0070670_101552672 Ga0070670_1015526722 116
371 3300005334 Ga0068869_100134410 Ga0068869_1001344103 116
372 3300005334 Ga0068869_100734395 Ga0068869_1007343952 116
373 3300005336 Ga0070680_100037534 Ga0070680_1000375343 116
374 3300005338 Ga0068868_101307054 Ga0068868_1013070541 116
375 3300005339 Ga0070660_100004203 Ga0070660_1000042032 116
376 3300005339 Ga0070660_100006164 Ga0070660_1000061648 116
377 3300005339 Ga0070660_100015529 Ga0070660_1000155292 116
378 3300005339 Ga0070660_100066787 Ga0070660_1000667873 116
379 3300005341 Ga0070691_10299294 Ga0070691_102992942 116
380 3300005344 Ga0070661_100002685 Ga0070661_10000268510 116
381 3300005344 Ga0070661_100005262 Ga0070661_1000052622 116
382 3300005344 Ga0070661_100127394 Ga0070661_1001273942 116
383 3300005344 Ga0070661_100468553 Ga0070661_1004685531 116
384 3300005345 Ga0070692_10343719 Ga0070692_103437192 116
385 3300005347 Ga0070668_100424206 Ga0070668_1004242061 116
386 3300005353 Ga0070669_100796148 Ga0070669_1007961482 116
387 3300005354 Ga0070675_100070101 Ga0070675_1000701014 116
388 3300005355 Ga0070671_100028448 Ga0070671_1000284482 116
389 3300005364 Ga0070673_100032966 Ga0070673_1000329662 116
390 3300005366 Ga0070659_100001376 Ga0070659_10000137610 116
391 3300005366 Ga0070659_100007839 Ga0070659_1000078398 116
392 3300005366 Ga0070659_100093581 Ga0070659_1000935812 116
393 3300005366 Ga0070659_100355407 Ga0070659_1003554071 116
394 3300005434 Ga0070709_10002761 Ga0070709_100027617 116
395 3300005434 Ga0070709_10183793 Ga0070709_101837932 116
396 3300005435 Ga0070714_100003230 Ga0070714_10000323010 116
397 3300005435 Ga0070714_100008916 Ga0070714_1000089165 116
398 3300005436 Ga0070713_100000399 Ga0070713_10000039920 116
399 3300005436 Ga0070713_100104933 Ga0070713_1001049332 116
400 3300005437 Ga0070710_10009602 Ga0070710_100096022 116
401 3300005439 Ga0070711_100006108 Ga0070711_1000061084 116
402 3300005439 Ga0070711_100258782 Ga0070711_1002587822 116
403 3300005440 Ga0070705_100995563 Ga0070705_1009955631 116
404 3300005455 Ga0070663_100007228 Ga0070663_1000072284 116
405 3300005456 Ga0070678_100034110 Ga0070678_1000341104 116
406 3300005457 Ga0070662_100008096 Ga0070662_1000080962 116
407 3300005458 Ga0070681_10082306 Ga0070681_100823062 116
408 3300005458 Ga0070681_10702541 Ga0070681_107025412 116
409 3300005467 Ga0070706_101108506 Ga0070706_1011085062 116
410 3300005471 Ga0070698_100113777 Ga0070698_1001137772 116
411 3300005518 Ga0070699_100006127 Ga0070699_10000612711 116
412 3300005518 Ga0070699_100040010 Ga0070699_1000400105 116
413 3300005518 Ga0070699_100046239 Ga0070699_1000462394 116
414 3300005530 Ga0070679_100005870 Ga0070679_1000058709 116
415 3300005535 Ga0070684_100008755 Ga0070684_1000087558 116
416 3300005536 Ga0070697_100117509 Ga0070697_1001175092 116
417 3300005539 Ga0068853_100001556 Ga0068853_10000155614 116
418 3300005539 Ga0068853_100002165 Ga0068853_1000021658 116
419 3300005539 Ga0068853_100380533 Ga0068853_1003805332 116
420 3300005543 Ga0070672_100365488 Ga0070672_1003654881 116
421 3300005548 Ga0070665_100557841 Ga0070665_1005578411 116
422 3300005563 Ga0068855_100000832 Ga0068855_10000083235 116
423 3300005563 Ga0068855_100484402 Ga0068855_1004844022 116
424 3300005564 Ga0070664_100013427 Ga0070664_1000134274 116
425 3300005564 Ga0070664_100080265 Ga0070664_1000802652 116
426 3300005577 Ga0068857_100005743 Ga0068857_1000057437 116
427 3300005578 Ga0068854_100006194 Ga0068854_1000061945 116
428 3300005614 Ga0068856_100000679 Ga0068856_10000067915 116
429 3300005614 Ga0068856_100012570 Ga0068856_1000125703 116
430 3300005616 Ga0068852_100002542 Ga0068852_1000025429 116
431 3300005616 Ga0068852_100172372 Ga0068852_1001723722 116
432 3300005718 Ga0068866_10295210 Ga0068866_102952101 116
433 3300005834 Ga0068851_10000367 Ga0068851_1000036711 116
434 3300005937 Ga0081455_10210009 Ga0081455_102100092 116
435 3300006028 Ga0070717_10009273 Ga0070717_100092735 116
436 3300006028 Ga0070717_10223331 Ga0070717_102233312 116
437 3300006028 Ga0070717_10531729 Ga0070717_105317292 116
438 3300006038 Ga0075365_10027914 Ga0075365_100279142 116
439 3300006042 Ga0075368_10043143 Ga0075368_100431432 116
440 3300006048 Ga0075363_100025133 Ga0075363_1000251332 116
441 3300006051 Ga0075364_10086396 Ga0075364_100863962 116
442 3300006163 Ga0070715_10001341 Ga0070715_100013417 116
443 3300006175 Ga0070712_100177005 Ga0070712_1001770052 116
444 3300006175 Ga0070712_100418950 Ga0070712_1004189502 116
445 3300006177 Ga0075362_10253044 Ga0075362_102530442 116
446 3300006177 Ga0075362_10319652 Ga0075362_103196522 116
447 3300006178 Ga0075367_10097879 Ga0075367_100978792 116
448 3300006178 Ga0075367_10111996 Ga0075367_101119962 116
449 3300006195 Ga0075366_10096506 Ga0075366_100965062 116
450 3300006195 Ga0075366_10325502 Ga0075366_103255022 116
451 3300006353 Ga0075370_10136465 Ga0075370_101364652 116
452 3300006844 Ga0075428_102523842 Ga0075428_1025238422 116
453 3300006847 Ga0075431_100481334 Ga0075431_1004813342 116
454 3300006852 Ga0075433_10221170 Ga0075433_102211701 116
455 3300006871 Ga0075434_100499273 Ga0075434_1004992732 116
456 3300009092 Ga0105250_10622271 Ga0105250_106222712 116
457 3300009093 Ga0105240_10012947 Ga0105240_100129476 116
458 3300009093 Ga0105240_10069698 Ga0105240_100696984 116
459 3300009094 Ga0111539_11298927 Ga0111539_112989271 116
460 3300009094 Ga0111539_12222517 Ga0111539_122225171 116
461 3300009147 Ga0114129_10213431 Ga0114129_102134312 116
462 3300009147 Ga0114129_10295662 Ga0114129_102956622 116
463 3300009147 Ga0114129_12577334 Ga0114129_125773341 116
464 3300009174 Ga0105241_10120966 Ga0105241_101209661 116
465 3300009545 Ga0105237_10111265 Ga0105237_101112653 116
466 3300009551 Ga0105238_10001480 Ga0105238_1000148011 116
467 3300010159 Ga0099796_10300680 Ga0099796_103006801 116
468 3300011119 Ga0105246_10940927 Ga0105246_109409271 116
469 3300013100 Ga0157373_10003033 Ga0157373_1000303310 116
470 3300013100 Ga0157373_10005270 Ga0157373_100052704 116
471 3300013102 Ga0157371_10000273 Ga0157371_1000027351 116
472 3300013102 Ga0157371_10034452 Ga0157371_100344522 116
473 3300013102 Ga0157371_10505573 Ga0157371_105055732 116
474 3300013104 Ga0157370_10004474 Ga0157370_1000447415 116
475 3300013104 Ga0157370_10007899 Ga0157370_100078994 116
476 3300013104 Ga0157370_10020330 Ga0157370_100203306 116
477 3300013104 Ga0157370_10050276 Ga0157370_100502762 116
478 3300013104 Ga0157370_10395943 Ga0157370_103959432 116
479 3300013105 Ga0157369_10014597 Ga0157369_100145972 116
480 3300013105 Ga0157369_10282973 Ga0157369_102829732 116
481 3300013105 Ga0157369_10444709 Ga0157369_104447092 116
482 3300013105 Ga0157369_10448430 Ga0157369_104484302 116
483 3300013297 Ga0157378_12828762 Ga0157378_128287621 116
484 3300013307 Ga0157372_10031649 Ga0157372_100316492 116
485 3300013307 Ga0157372_10036492 Ga0157372_100364925 116
486 3300013307 Ga0157372_10257205 Ga0157372_102572052 116
487 3300013307 Ga0157372_11782347 Ga0157372_117823472 116
488 3300014497 Ga0182008_10031251 Ga0182008_100312512 116
489 3300014969 Ga0157376_10943628 Ga0157376_109436282 116
490 3300020069 Ga0197907_11214187 Ga0197907_112141872 116
491 3300020081 Ga0206354_10304488 Ga0206354_103044882 116
492 3300020082 Ga0206353_10254265 Ga0206353_102542652 116
493 3300025297 Ga0209758_1000267 Ga0209758_100026786 116
494 3300025297 Ga0209758_1002898 Ga0209758_100289816 116
495 3300025297 Ga0209758_1018476 Ga0209758_10184765 116
496 3300025321 Ga0207656_10004688 Ga0207656_100046884 116
497 3300025898 Ga0207692_10003963 Ga0207692_100039634 116
498 3300025899 Ga0207642_10554649 Ga0207642_105546491 116
499 3300025905 Ga0207685_10005558 Ga0207685_100055581 116
500 3300025906 Ga0207699_10039510 Ga0207699_100395102 116
501 3300025906 Ga0207699_10243798 Ga0207699_102437982 116
502 3300025906 Ga0207699_11112258 Ga0207699_111122581 116
503 3300025907 Ga0207645_10014464 Ga0207645_100144644 116
504 3300025909 Ga0207705_10004340 Ga0207705_100043407 116
505 3300025910 Ga0207684_10010039 Ga0207684_100100396 116
506 3300025910 Ga0207684_10627603 Ga0207684_106276032 116
507 3300025910 Ga0207684_11351376 Ga0207684_113513762 116
508 3300025912 Ga0207707_10001205 Ga0207707_1000120510 116
509 3300025913 Ga0207695_10004595 Ga0207695_100045955 116
510 3300025913 Ga0207695_10103624 Ga0207695_101036242 116
511 3300025914 Ga0207671_10170896 Ga0207671_101708962 116
512 3300025915 Ga0207693_10037062 Ga0207693_100370622 116
513 3300025915 Ga0207693_10729495 Ga0207693_107294952 116
514 3300025916 Ga0207663_10027809 Ga0207663_100278092 116
515 3300025916 Ga0207663_10209846 Ga0207663_102098462 116
516 3300025917 Ga0207660_10001740 Ga0207660_100017406 116
517 3300025917 Ga0207660_10264678 Ga0207660_102646782 116
518 3300025917 Ga0207660_10351805 Ga0207660_103518052 116
519 3300025919 Ga0207657_10000151 Ga0207657_1000015133 116
520 3300025919 Ga0207657_10000751 Ga0207657_100007513 116
521 3300025919 Ga0207657_10003042 Ga0207657_100030427 116
522 3300025920 Ga0207649_10000967 Ga0207649_1000096710 116
523 3300025920 Ga0207649_10109528 Ga0207649_101095282 116
524 3300025920 Ga0207649_10179429 Ga0207649_101794292 116
525 3300025921 Ga0207652_10003455 Ga0207652_100034554 116
526 3300025924 Ga0207694_10001041 Ga0207694_1000104114 116
527 3300025925 Ga0207650_11139120 Ga0207650_111391201 116
528 3300025928 Ga0207700_10002081 Ga0207700_1000208111 116
529 3300025928 Ga0207700_10131462 Ga0207700_101314622 116
530 3300025929 Ga0207664_10001164 Ga0207664_100011649 116
531 3300025929 Ga0207664_10016398 Ga0207664_100163984 116
532 3300025931 Ga0207644_10019099 Ga0207644_100190994 116
533 3300025932 Ga0207690_10003450 Ga0207690_100034503 116
534 3300025932 Ga0207690_10131510 Ga0207690_101315103 116
535 3300025932 Ga0207690_10134615 Ga0207690_101346152 116
536 3300025933 Ga0207706_10001691 Ga0207706_1000169117 116
537 3300025933 Ga0207706_10478907 Ga0207706_104789072 116
538 3300025938 Ga0207704_10946845 Ga0207704_109468452 116
539 3300025939 Ga0207665_10063563 Ga0207665_100635632 116
540 3300025940 Ga0207691_10075261 Ga0207691_100752612 116
541 3300025942 Ga0207689_10368883 Ga0207689_103688833 116
542 3300025944 Ga0207661_10010838 Ga0207661_100108388 116
543 3300025945 Ga0207679_10010286 Ga0207679_100102866 116
544 3300025945 Ga0207679_10010391 Ga0207679_100103913 116
545 3300025945 Ga0207679_10053817 Ga0207679_100538172 116
546 3300025949 Ga0207667_10000460 Ga0207667_1000046042 116
547 3300025949 Ga0207667_10035932 Ga0207667_100359322 116
548 3300025949 Ga0207667_10042563 Ga0207667_100425635 116
549 3300025960 Ga0207651_10022708 Ga0207651_100227082 116
550 3300025981 Ga0207640_10002366 Ga0207640_100023669 116
551 3300025981 Ga0207640_10890466 Ga0207640_108904662 116
552 3300025986 Ga0207658_10049976 Ga0207658_100499761 116
553 3300026023 Ga0207677_12084391 Ga0207677_120843911 116
554 3300026041 Ga0207639_10001340 Ga0207639_100013407 116
555 3300026041 Ga0207639_10040346 Ga0207639_100403462 116
556 3300026041 Ga0207639_10856860 Ga0207639_108568602 116
557 3300026067 Ga0207678_10003830 Ga0207678_100038302 116
558 3300026067 Ga0207678_10025800 Ga0207678_100258002 116
559 3300026078 Ga0207702_10003088 Ga0207702_1000308815 116
560 3300026078 Ga0207702_10028377 Ga0207702_100283772 116
561 3300026089 Ga0207648_10452984 Ga0207648_104529842 116
562 3300026095 Ga0207676_11128752 Ga0207676_111287521 116
563 3300026116 Ga0207674_10000248 Ga0207674_1000024811 116
564 3300026142 Ga0207698_10000475 Ga0207698_1000047517 116
565 3300026142 Ga0207698_10002920 Ga0207698_100029206 116
566 3300026142 Ga0207698_10088122 Ga0207698_100881222 116
567 3300027378 Ga0209981_1014001 Ga0209981_10140011 116
568 3300027395 Ga0209996_1024199 Ga0209996_10241992 116
569 3300027462 Ga0210000_1035697 Ga0210000_10356972 116
570 3300027543 Ga0209999_1014765 Ga0209999_10147652 116
571 3300027617 Ga0210002_1062964 Ga0210002_10629642 116
572 3300027665 Ga0209983_1001705 Ga0209983_10017053 116
573 3300027682 Ga0209971_1014026 Ga0209971_10140263 116
574 3300027876 Ga0209974_10001930 Ga0209974_100019304 116
575 3300028379 Ga0268266_10878761 Ga0268266_108787611 116
576 3300028381 Ga0268264_10444908 Ga0268264_104449082 116
577 3300028800 Ga0265338_10395628 Ga0265338_103956281 116
578 3300028800 Ga0265338_10949630 Ga0265338_109496302 116
579 3300030521 Ga0307511_10000001 Ga0307511_1000000165 116
580 3300031247 Ga0265340_10263704 Ga0265340_102637042 116
581 3300031251 Ga0265327_10041581 Ga0265327_100415812 116
582 3300031616 Ga0307508_10212658 Ga0307508_102126582 116
583 3300031616 Ga0307508_10676021 Ga0307508_106760212 116
584 3300031730 Ga0307516_10242509 Ga0307516_102425092 116
585 3300031731 Ga0307405_10176508 Ga0307405_101765082 116
586 3300031824 Ga0307413_10006689 Ga0307413_100066893 116
587 3300031852 Ga0307410_10091464 Ga0307410_100914642 116
588 3300031901 Ga0307406_10136962 Ga0307406_101369623 116
589 3300032002 Ga0307416_100822242 Ga0307416_1008222422 116
590 3300032004 Ga0307414_10709444 Ga0307414_107094442 116
591 3300032005 Ga0307411_10001330 Ga0307411_100013303 116
592 3300032126 Ga0307415_100085261 Ga0307415_1000852612 116
593 3300033180 Ga0307510_10156035 Ga0307510_101560352 116
594 3300035113 Ga0373936_0094679 Ga0373936_0094679_424_780 116
595 3300037312 Ga0395899_0229336 Ga0395899_0229336_677_1027 116
596 3300037418 Ga0395900_0082980 Ga0395900_0082980_972_1322 116
597 3300037466 Ga0395898_1052577 Ga0395898_1052577_45_395 116
598 3300037471 Ga0395905_0074000 Ga0395905_0074000_1371_1721 116
599 3300038443 Ga0395901_0187834 Ga0395901_0187834_340_690 116
600 3300044694 Ga0466963_0648945 Ga0466963_0648945_377_727 116
601 3300045051 Ga0451576_0515557 Ga0451576_0515557_274_624 116
602 3300046543 Ga0495645_0290404 Ga0495645_0290404_569_925 116
603 3300047317 Ga0495604_0946898 Ga0495604_0946898_157_513 116
604 3300048903 Ga0496100_0201405 Ga0496100_0201405_443_799 116
605 3300048903 Ga0496100_1065610 Ga0496100_1065610_229_585 116
606 3300048904 Ga0496101_0204305 Ga0496101_0204305_273_623 116
607 3300048905 Ga0496102_1422187 Ga0496102_1422187_57_407 116
608 3300048906 Ga0496103_0122691 Ga0496103_0122691_484_834 116
609 3300048907 Ga0496104_0014252 Ga0496104_0014252_4990_5346 116
610 3300048907 Ga0496104_0045650 Ga0496104_0045650_1748_2104 116
611 3300048907 Ga0496104_0595475 Ga0496104_0595475_491_847 116
612 3300048908 Ga0496105_0074052 Ga0496105_0074052_363_719 116
613 3300048909 Ga0496106_0008137 Ga0496106_0008137_3356_3706 116
614 3300048909 Ga0496106_0170702 Ga0496106_0170702_298_654 116
615 3300048909 Ga0496106_0543484 Ga0496106_0543484_200_556 116
616 3300048910 Ga0496107_0054257 Ga0496107_0054257_76_426 116
617 3300048911 Ga0496108_1750898 Ga0496108_1750898_89_445 116
618 3300048912 Ga0496109_0050662 Ga0496109_0050662_611_967 116
619 3300048913 Ga0496110_0073828 Ga0496110_0073828_322_678 116
620 3300048913 Ga0496110_0688929 Ga0496110_0688929_124_480 116
621 3300048916 Ga0496113_0846665 Ga0496113_0846665_39_395 116
622 3300048917 Ga0496114_0154005 Ga0496114_0154005_465_821 116
623 3300048917 Ga0496114_0375646 Ga0496114_0375646_883_1239 116
624 3300048918 Ga0496115_0058786 Ga0496115_0058786_1159_1515 116
625 3300048918 Ga0496115_0986921 Ga0496115_0986921_272_625 116
626 3300050489 nmdc:mga03683_245660_c1 nmdc:mga03683_245660_c1_288_644 116
627 3300050490 nmdc:mga03n38_552297_c1 nmdc:mga03n38_552297_c1_75_431 116
628 3300050491 nmdc:mga00v17_327952_c1 nmdc:mga00v17_327952_c1_83_439 116
629 3300050491 nmdc:mga00v17_621869_c1 nmdc:mga00v17_621869_c1_201_557 116
630 3300050491 nmdc:mga00v17_77928_c1 nmdc:mga00v17_77928_c1_1544_1900 116
631 3300050492 nmdc:mga0yw44_22437_c1 nmdc:mga0yw44_22437_c1_782_1138 116
632 3300050492 nmdc:mga0yw44_449181_c1 nmdc:mga0yw44_449181_c1_379_735 116
633 3300050493 nmdc:mga0k408_65206_c1 nmdc:mga0k408_65206_c1_147_503 116
634 3300050494 nmdc:mga06z11_39682_c1 nmdc:mga06z11_39682_c1_935_1291 116
635 3300050495 nmdc:mga04h51_124786_c1 nmdc:mga04h51_124786_c1_51_407 116
636 3300050496 nmdc:mga07m45_139518_c1 nmdc:mga07m45_139518_c1_893_1249 116
637 3300050496 nmdc:mga07m45_35974_c2 nmdc:mga07m45_35974_c2_171_527 116
638 3300050507 nmdc:mga05p37_2242280_c1 nmdc:mga05p37_2242280_c1_56_412 116
639 3300050507 nmdc:mga05p37_688374_c1 nmdc:mga05p37_688374_c1_627_983 116
640 3300050511 nmdc:mga08y16_1018957_c1 nmdc:mga08y16_1018957_c1_404_760 116
641 3300050512 nmdc:mga0n895_396549_c1 nmdc:mga0n895_396549_c1_395_751 116
642 3300050513 nmdc:mga0rr50_624195_c1 nmdc:mga0rr50_624195_c1_248_604 116
643 3300050515 nmdc:mga0a205_255009_c1 nmdc:mga0a205_255009_c1_242_598 116
644 3300050516 nmdc:mga0sz30_378100_c1 nmdc:mga0sz30_378100_c1_13_369 116
645 3300050516 nmdc:mga0sz30_81081_c1 nmdc:mga0sz30_81081_c1_892_1248 116
646 3300053087 Ga0500643_003071 Ga0500643_003071_4283_4639 116
647 3300053088 Ga0500644_0313433 Ga0500644_0313433_177_533 116
648 3300053090 Ga0500646_0000184 Ga0500646_0000184_12898_13254 116
649 3300053092 Ga0500583_0005384 Ga0500583_0005384_2771_3136 116
650 3300053092 Ga0500583_0124688 Ga0500583_0124688_347_703 116
651 3300053096 Ga0500641_0004864 Ga0500641_0004864_1217_1573 116
652 3300053096 Ga0500641_0249765 Ga0500641_0249765_115_471 116
653 3300053098 Ga0500650_0036589 Ga0500650_0036589_1206_1562 116
654 3300053119 Ga0500595_000003 Ga0500595_000003_293668_294024 116
655 3300053119 Ga0500595_002937 Ga0500595_002937_7028_7384 116
656 3300053130 Ga0500642_0085297 Ga0500642_0085297_151_507 116
657 3300053133 Ga0500655_000967 Ga0500655_000967_1322_1678 116
658 3300053139 Ga0500568_0050545 Ga0500568_0050545_358_714 116
659 3300053146 Ga0500588_0221381 Ga0500588_0221381_115_471 116
660 3300053151 Ga0500604_0000501 Ga0500604_0000501_8648_9004 116
661 3300053178 Ga0500637_0108147 Ga0500637_0108147_470_826 116

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00576

Transthyretin

HIUase/Transthyretin family

19

123

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q14-assembly1.cif.gz_B crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis 0.9353 1 115
4q14-assembly1.cif.gz_B crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis 0.92 1 115
5z5m-assembly1.cif.gz_A crystal structure of (s)-allantoin synthase 0.9184 3 115
5z5m-assembly1.cif.gz_B crystal structure of (s)-allantoin synthase 0.9178 2 115
5z5m-assembly1.cif.gz_D crystal structure of (s)-allantoin synthase 0.9161 3 115
ID Description Score Start End Superfamily
4q14B00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9355 1 115 2.60.40.180
4q14B00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9201 1 115 2.60.40.180
af_Q54LD6_18_133_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9127 2 113 2.60.40.180
2gpzC00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.9075 3 115 2.60.40.180
2h0jA00 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.8945 3 115 2.60.40.180
ID Description Score Start End GO Terms
AF-A0A537VFG0-F1-model_v4 Hydroxyisourate hydrolase 0.9756 1 116 GO:0006144
GO:0016787
AF-A0A537VFG0-F1-model_v4 Hydroxyisourate hydrolase 0.9674 1 116 GO:0006144
GO:0016787
AF-A0A3N5ESK0-F1-model_v4 Hydroxyisourate hydrolase 0.961 1 115 GO:0006144
GO:0016787
AF-A0A4Q3HJ11-F1-model_v4 5-hydroxyisourate hydrolase 0.957 54 115 GO:0006144
GO:0016787
AF-A0A520N693-F1-model_v4 5-hydroxyisourate hydrolase 0.9567 52 115 GO:0006144
GO:0016787

Feature Viewer

pLDDT pTM Quality
94.93 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map