F473418
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 661 | 370 | 661 | 114 |
Family's Representative Sequence
| Representative Sequence | 3300031852|Ga0307410_11446630|Ga0307410_114466302 |
| Length | 125 |
| Sequence | VDAAGEGFRRQAELGVPGISIHVVDVSRGLVGAGMRIELRQGAKALLSGRASGKGLVELNEKVAAGTYEAVFHVAEWYREQRVTLPPTPFLDVVTYRFGISDPEQHYHLPFKCTPWGYSCFRGGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 83 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 84 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 137 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 214 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 215 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 217 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 225 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 226 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 227 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 228 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 229 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 230 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 231 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 232 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 245 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 257 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 258 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 259 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 260 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 261 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 262 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 263 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 264 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 265 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 266 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 267 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 268 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 269 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 297 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 298 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 299 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 300 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 301 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 302 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 304 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 305 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 306 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 307 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 311 | 3300049516 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought | Metagenome | Rhizosphere |
| 312 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 313 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 314 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 325 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 326 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 327 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 328 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 329 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 330 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 331 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 341 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 355 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 356 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 357 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 358 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 359 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 360 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 361 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 363 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 364 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 365 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 367 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 368 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 369 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 370 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.55 |
| Metatranscriptomes | 0.45 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.02 |
| Nodule | 0 |
| Rhizoplane | 3.78 |
| Rhizosphere | 86.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10158448 | 3300001979 | Unclassified | 562 |
| 2 | JGI24738J21930_10123452 | 3300002075 | Unclassified | 563 |
| 3 | JGI25406J46586_10064461 | 3300003203 | Bacteria | 1170 |
| 4 | JGI25153J46596_10000326 | 3300003215 | Bacteria | 34486 |
| 5 | JGI25153J46596_10031146 | 3300003215 | Unclassified | 1801 |
| 6 | rootH1_10076163 | 3300003323 | Bacteria | 1040 |
| 7 | Ga0065707_10095642 | 3300005295 | Bacteria | 3354 |
| 8 | Ga0070658_10002078 | 3300005327 | Bacteria | 16808 |
| 9 | Ga0070658_10328272 | 3300005327 | Bacteria | 1307 |
| 10 | Ga0070676_10062667 | 3300005328 | Bacteria | 2213 |
| 11 | Ga0070683_100001436 | 3300005329 | Bacteria | 18293 |
| 12 | Ga0070690_101692375 | 3300005330 | Unclassified | 514 |
| 13 | Ga0070670_100203174 | 3300005331 | Bacteria | 1722 |
| 14 | Ga0070670_101552672 | 3300005331 | Bacteria | 608 |
| 15 | Ga0068869_100000251 | 3300005334 | Bacteria | 28247 |
| 16 | Ga0068869_100134410 | 3300005334 | Bacteria | 1904 |
| 17 | Ga0068869_100734395 | 3300005334 | Bacteria | 844 |
| 18 | Ga0070666_10025642 | 3300005335 | Bacteria | 3845 |
| 19 | Ga0070680_100028969 | 3300005336 | Bacteria | 4445 |
| 20 | Ga0070680_100037534 | 3300005336 | Bacteria | 3915 |
| 21 | Ga0070680_100048610 | 3300005336 | Bacteria | 3457 |
| 22 | Ga0070680_100519708 | 3300005336 | Unclassified | 1019 |
| 23 | Ga0070682_100001570 | 3300005337 | Bacteria | 12755 |
| 24 | Ga0068868_100000323 | 3300005338 | Bacteria | 32212 |
| 25 | Ga0068868_100226386 | 3300005338 | Bacteria | 1567 |
| 26 | Ga0068868_101307054 | 3300005338 | Unclassified | 674 |
| 27 | Ga0070660_100004203 | 3300005339 | Bacteria | 9944 |
| 28 | Ga0070660_100006164 | 3300005339 | Bacteria | 8298 |
| 29 | Ga0070660_100015529 | 3300005339 | Bacteria | 5502 |
| 30 | Ga0070660_100066787 | 3300005339 | Bacteria | 2801 |
| 31 | Ga0070689_100000549 | 3300005340 | Bacteria | 22423 |
| 32 | Ga0070689_100008057 | 3300005340 | Bacteria | 7399 |
| 33 | Ga0070689_100345986 | 3300005340 | Bacteria | 1246 |
| 34 | Ga0070691_10001307 | 3300005341 | Bacteria | 10580 |
| 35 | Ga0070691_10299294 | 3300005341 | Bacteria | 878 |
| 36 | Ga0070687_100000059 | 3300005343 | Bacteria | 35532 |
| 37 | Ga0070661_100002685 | 3300005344 | Bacteria | 12177 |
| 38 | Ga0070661_100005262 | 3300005344 | Bacteria | 8912 |
| 39 | Ga0070661_100127394 | 3300005344 | Bacteria | 1911 |
| 40 | Ga0070661_100468553 | 3300005344 | Bacteria | 1004 |
| 41 | Ga0070692_10133525 | 3300005345 | Bacteria | 1398 |
| 42 | Ga0070692_10343719 | 3300005345 | Bacteria | 925 |
| 43 | Ga0070668_100424206 | 3300005347 | Bacteria | 1139 |
| 44 | Ga0070669_100328277 | 3300005353 | Unclassified | 1237 |
| 45 | Ga0070669_100796148 | 3300005353 | Unclassified | 803 |
| 46 | Ga0070675_100070101 | 3300005354 | Bacteria | 2905 |
| 47 | Ga0070675_100133138 | 3300005354 | Bacteria | 2120 |
| 48 | Ga0070671_100028448 | 3300005355 | Bacteria | 4603 |
| 49 | Ga0070671_100127703 | 3300005355 | Bacteria | 2141 |
| 50 | Ga0070673_100032966 | 3300005364 | Bacteria | 3906 |
| 51 | Ga0070673_100616129 | 3300005364 | Bacteria | 991 |
| 52 | Ga0070688_100292239 | 3300005365 | Bacteria | 1175 |
| 53 | Ga0070688_100344786 | 3300005365 | Bacteria | 1089 |
| 54 | Ga0070659_100001376 | 3300005366 | Bacteria | 17521 |
| 55 | Ga0070659_100007839 | 3300005366 | Bacteria | 7772 |
| 56 | Ga0070659_100093581 | 3300005366 | Bacteria | 2412 |
| 57 | Ga0070659_100355407 | 3300005366 | Bacteria | 1230 |
| 58 | Ga0070709_10002761 | 3300005434 | Bacteria | 9496 |
| 59 | Ga0070709_10183793 | 3300005434 | Bacteria | 1470 |
| 60 | Ga0070714_100003230 | 3300005435 | Bacteria | 12133 |
| 61 | Ga0070714_100008916 | 3300005435 | Bacteria | 7848 |
| 62 | Ga0070713_100000399 | 3300005436 | Bacteria | 27898 |
| 63 | Ga0070713_100104933 | 3300005436 | Bacteria | 2454 |
| 64 | Ga0070710_10009602 | 3300005437 | Bacteria | 4738 |
| 65 | Ga0070710_10454976 | 3300005437 | Bacteria | 868 |
| 66 | Ga0070710_10621513 | 3300005437 | Bacteria | 754 |
| 67 | Ga0070701_10000194 | 3300005438 | Bacteria | 18862 |
| 68 | Ga0070701_10197462 | 3300005438 | Bacteria | 1187 |
| 69 | Ga0070711_100006108 | 3300005439 | Bacteria | 7241 |
| 70 | Ga0070711_100258782 | 3300005439 | Bacteria | 1368 |
| 71 | Ga0070711_100713172 | 3300005439 | Bacteria | 845 |
| 72 | Ga0070705_100000370 | 3300005440 | Bacteria | 26351 |
| 73 | Ga0070705_100001756 | 3300005440 | Bacteria | 11250 |
| 74 | Ga0070705_100150062 | 3300005440 | Bacteria | 1545 |
| 75 | Ga0070705_100995563 | 3300005440 | Bacteria | 680 |
| 76 | Ga0070700_100000391 | 3300005441 | Bacteria | 22586 |
| 77 | Ga0070694_100000813 | 3300005444 | Bacteria | 17488 |
| 78 | Ga0070694_100019804 | 3300005444 | Bacteria | 4283 |
| 79 | Ga0070694_101376060 | 3300005444 | Bacteria | 595 |
| 80 | Ga0070708_100124028 | 3300005445 | Bacteria | 2386 |
| 81 | Ga0070708_100303879 | 3300005445 | Bacteria | 1502 |
| 82 | Ga0070663_100007228 | 3300005455 | Bacteria | 6747 |
| 83 | Ga0070678_100034110 | 3300005456 | Bacteria | 3541 |
| 84 | Ga0070678_100459062 | 3300005456 | Bacteria | 1117 |
| 85 | Ga0070662_100008096 | 3300005457 | Bacteria | 6843 |
| 86 | Ga0070662_100307183 | 3300005457 | Bacteria | 1290 |
| 87 | Ga0070681_10082306 | 3300005458 | Bacteria | 3174 |
| 88 | Ga0070681_10143996 | 3300005458 | Bacteria | 2313 |
| 89 | Ga0070681_10702541 | 3300005458 | Bacteria | 927 |
| 90 | Ga0068867_100000514 | 3300005459 | Bacteria | 25802 |
| 91 | Ga0070685_10892951 | 3300005466 | Bacteria | 661 |
| 92 | Ga0070706_101108506 | 3300005467 | Unclassified | 728 |
| 93 | Ga0070707_100545657 | 3300005468 | Unclassified | 1121 |
| 94 | Ga0070707_100998507 | 3300005468 | Unclassified | 802 |
| 95 | Ga0070698_100113777 | 3300005471 | Bacteria | 2671 |
| 96 | Ga0070698_100294330 | 3300005471 | Bacteria | 1554 |
| 97 | Ga0070698_100484920 | 3300005471 | Unclassified | 1173 |
| 98 | Ga0070698_101155537 | 3300005471 | Bacteria | 723 |
| 99 | Ga0070699_100006127 | 3300005518 | Bacteria | 10519 |
| 100 | Ga0070699_100029629 | 3300005518 | Bacteria | 4720 |
| 101 | Ga0070699_100040010 | 3300005518 | Bacteria | 4060 |
| 102 | Ga0070699_100046239 | 3300005518 | Bacteria | 3767 |
| 103 | Ga0070699_101261050 | 3300005518 | Bacteria | 678 |
| 104 | Ga0070679_100005870 | 3300005530 | Bacteria | 11402 |
| 105 | Ga0070679_102111494 | 3300005530 | Unclassified | 513 |
| 106 | Ga0070684_100008755 | 3300005535 | Bacteria | 7935 |
| 107 | Ga0070697_100117509 | 3300005536 | Bacteria | 2222 |
| 108 | Ga0068853_100001556 | 3300005539 | Bacteria | 16698 |
| 109 | Ga0068853_100002165 | 3300005539 | Bacteria | 14625 |
| 110 | Ga0068853_100021931 | 3300005539 | Bacteria | 5327 |
| 111 | Ga0068853_100380533 | 3300005539 | Bacteria | 1318 |
| 112 | Ga0070672_100365488 | 3300005543 | Bacteria | 1232 |
| 113 | Ga0070686_100000243 | 3300005544 | Bacteria | 37165 |
| 114 | Ga0070695_100000141 | 3300005545 | Bacteria | 33296 |
| 115 | Ga0070695_100060007 | 3300005545 | Bacteria | 2464 |
| 116 | Ga0070696_100000253 | 3300005546 | Bacteria | 32345 |
| 117 | Ga0070696_100002444 | 3300005546 | Bacteria | 12314 |
| 118 | Ga0070696_100042788 | 3300005546 | Bacteria | 3131 |
| 119 | Ga0070693_100000009 | 3300005547 | Bacteria | 77783 |
| 120 | Ga0070665_100557841 | 3300005548 | Unclassified | 1158 |
| 121 | Ga0070704_100000076 | 3300005549 | Bacteria | 33631 |
| 122 | Ga0070704_100017240 | 3300005549 | Bacteria | 4588 |
| 123 | Ga0068855_100000832 | 3300005563 | Bacteria | 38157 |
| 124 | Ga0068855_100004666 | 3300005563 | Bacteria | 16737 |
| 125 | Ga0068855_100287727 | 3300005563 | Bacteria | 1823 |
| 126 | Ga0068855_100484402 | 3300005563 | Bacteria | 1346 |
| 127 | Ga0070664_100013427 | 3300005564 | Bacteria | 6672 |
| 128 | Ga0070664_100080265 | 3300005564 | Bacteria | 2809 |
| 129 | Ga0068857_100005743 | 3300005577 | Bacteria | 10611 |
| 130 | Ga0068854_100001580 | 3300005578 | Bacteria | 13853 |
| 131 | Ga0068854_100006194 | 3300005578 | Bacteria | 7596 |
| 132 | Ga0068854_100195011 | 3300005578 | Bacteria | 1589 |
| 133 | Ga0068856_100000679 | 3300005614 | Bacteria | 36874 |
| 134 | Ga0068856_100012570 | 3300005614 | Bacteria | 8195 |
| 135 | Ga0068856_100024817 | 3300005614 | Bacteria | 5840 |
| 136 | Ga0070702_100000075 | 3300005615 | Bacteria | 28434 |
| 137 | Ga0068852_100002542 | 3300005616 | Bacteria | 12563 |
| 138 | Ga0068852_100172372 | 3300005616 | Bacteria | 2029 |
| 139 | Ga0068859_100001974 | 3300005617 | Bacteria | 20936 |
| 140 | Ga0068864_100611897 | 3300005618 | Bacteria | 1058 |
| 141 | Ga0068866_10000347 | 3300005718 | Bacteria | 21827 |
| 142 | Ga0068866_10295210 | 3300005718 | Bacteria | 1010 |
| 143 | Ga0068861_100000106 | 3300005719 | Bacteria | 41730 |
| 144 | Ga0068861_100669004 | 3300005719 | Bacteria | 961 |
| 145 | Ga0068851_10000367 | 3300005834 | Bacteria | 20365 |
| 146 | Ga0068863_100472136 | 3300005841 | Bacteria | 1233 |
| 147 | Ga0068863_101376880 | 3300005841 | Bacteria | 713 |
| 148 | Ga0068858_100137412 | 3300005842 | Bacteria | 2294 |
| 149 | Ga0068858_100188129 | 3300005842 | Bacteria | 1951 |
| 150 | Ga0068860_100000484 | 3300005843 | Bacteria | 49078 |
| 151 | Ga0068860_100061096 | 3300005843 | Bacteria | 3580 |
| 152 | Ga0068862_100001748 | 3300005844 | Bacteria | 19665 |
| 153 | Ga0081455_10210009 | 3300005937 | Bacteria | 1451 |
| 154 | Ga0081538_10128292 | 3300005981 | Unclassified | 1199 |
| 155 | Ga0081539_10000803 | 3300005985 | Bacteria | 61113 |
| 156 | Ga0070717_10009273 | 3300006028 | Bacteria | 7396 |
| 157 | Ga0070717_10223331 | 3300006028 | Unclassified | 1656 |
| 158 | Ga0070717_10531729 | 3300006028 | Bacteria | 1064 |
| 159 | Ga0075365_10027914 | 3300006038 | Bacteria | 3595 |
| 160 | Ga0075365_10834265 | 3300006038 | Bacteria | 650 |
| 161 | Ga0075368_10043143 | 3300006042 | Bacteria | 1776 |
| 162 | Ga0075363_100025133 | 3300006048 | Bacteria | 3034 |
| 163 | Ga0075364_10086396 | 3300006051 | Bacteria | 2078 |
| 164 | Ga0070715_10001341 | 3300006163 | Bacteria | 7098 |
| 165 | Ga0070716_100616749 | 3300006173 | Bacteria | 818 |
| 166 | Ga0070712_100177005 | 3300006175 | Bacteria | 1659 |
| 167 | Ga0070712_100418950 | 3300006175 | Bacteria | 1109 |
| 168 | Ga0070712_100690685 | 3300006175 | Bacteria | 869 |
| 169 | Ga0075362_10253044 | 3300006177 | Bacteria | 866 |
| 170 | Ga0075362_10319652 | 3300006177 | Bacteria | 773 |
| 171 | Ga0075367_10097879 | 3300006178 | Bacteria | 1790 |
| 172 | Ga0075367_10111996 | 3300006178 | Bacteria | 1676 |
| 173 | Ga0075366_10096506 | 3300006195 | Bacteria | 1772 |
| 174 | Ga0075366_10325502 | 3300006195 | Bacteria | 942 |
| 175 | Ga0097621_100012458 | 3300006237 | Bacteria | 6305 |
| 176 | Ga0075370_10136465 | 3300006353 | Bacteria | 1433 |
| 177 | Ga0068871_100017622 | 3300006358 | Bacteria | 5409 |
| 178 | Ga0075428_100000615 | 3300006844 | Bacteria | 36398 |
| 179 | Ga0075428_100083015 | 3300006844 | Bacteria | 3496 |
| 180 | Ga0075428_100208444 | 3300006844 | Bacteria | 2112 |
| 181 | Ga0075428_100342414 | 3300006844 | Bacteria | 1605 |
| 182 | Ga0075428_101213397 | 3300006844 | Bacteria | 795 |
| 183 | Ga0075428_102523842 | 3300006844 | Bacteria | 526 |
| 184 | Ga0075430_100068421 | 3300006846 | Bacteria | 2979 |
| 185 | Ga0075430_100101040 | 3300006846 | Bacteria | 2408 |
| 186 | Ga0075430_100337992 | 3300006846 | Bacteria | 1244 |
| 187 | Ga0075430_100401392 | 3300006846 | Bacteria | 1132 |
| 188 | Ga0075430_100834499 | 3300006846 | Bacteria | 759 |
| 189 | Ga0075431_100047993 | 3300006847 | Bacteria | 4404 |
| 190 | Ga0075431_100219568 | 3300006847 | Bacteria | 1939 |
| 191 | Ga0075431_100240397 | 3300006847 | Bacteria | 1842 |
| 192 | Ga0075431_100481334 | 3300006847 | Bacteria | 1234 |
| 193 | Ga0075431_100497262 | 3300006847 | Bacteria | 1211 |
| 194 | Ga0075431_100867239 | 3300006847 | Bacteria | 873 |
| 195 | Ga0075433_10001240 | 3300006852 | Bacteria | 18606 |
| 196 | Ga0075433_10221170 | 3300006852 | Bacteria | 1682 |
| 197 | Ga0075433_11035065 | 3300006852 | Bacteria | 715 |
| 198 | Ga0075434_100499273 | 3300006871 | Bacteria | 1238 |
| 199 | Ga0075429_100000506 | 3300006880 | Bacteria | 29418 |
| 200 | Ga0075429_100226441 | 3300006880 | Bacteria | 1638 |
| 201 | Ga0075429_100234264 | 3300006880 | Bacteria | 1608 |
| 202 | Ga0075429_100326289 | 3300006880 | Bacteria | 1343 |
| 203 | Ga0075429_101662242 | 3300006880 | Bacteria | 555 |
| 204 | Ga0075436_100000896 | 3300006914 | Bacteria | 19786 |
| 205 | Ga0075436_100010510 | 3300006914 | Bacteria | 6349 |
| 206 | Ga0097620_100001974 | 3300006931 | Bacteria | 20936 |
| 207 | Ga0075435_100656015 | 3300007076 | Bacteria | 911 |
| 208 | Ga0099794_10008683 | 3300007265 | Bacteria | 4232 |
| 209 | Ga0099794_10568206 | 3300007265 | Bacteria | 599 |
| 210 | Ga0105250_10622271 | 3300009092 | Bacteria | 502 |
| 211 | Ga0105240_10012947 | 3300009093 | Bacteria | 11489 |
| 212 | Ga0105240_10069698 | 3300009093 | Bacteria | 4351 |
| 213 | Ga0111539_10046625 | 3300009094 | Bacteria | 5183 |
| 214 | Ga0111539_10388342 | 3300009094 | Bacteria | 1625 |
| 215 | Ga0111539_11298927 | 3300009094 | Bacteria | 844 |
| 216 | Ga0111539_12222517 | 3300009094 | Unclassified | 636 |
| 217 | Ga0105245_10000329 | 3300009098 | Bacteria | 44773 |
| 218 | Ga0114129_10000534 | 3300009147 | Bacteria | 46594 |
| 219 | Ga0114129_10154576 | 3300009147 | Bacteria | 3138 |
| 220 | Ga0114129_10213431 | 3300009147 | Bacteria | 2608 |
| 221 | Ga0114129_10295662 | 3300009147 | Bacteria | 2160 |
| 222 | Ga0114129_10796389 | 3300009147 | Bacteria | 1206 |
| 223 | Ga0114129_11399935 | 3300009147 | Bacteria | 863 |
| 224 | Ga0114129_12577334 | 3300009147 | Unclassified | 607 |
| 225 | Ga0105243_10000590 | 3300009148 | Bacteria | 36363 |
| 226 | Ga0105241_10120966 | 3300009174 | Bacteria | 2108 |
| 227 | Ga0105241_10579476 | 3300009174 | Bacteria | 1011 |
| 228 | Ga0105242_10000243 | 3300009176 | Bacteria | 42938 |
| 229 | Ga0105242_12847243 | 3300009176 | Bacteria | 534 |
| 230 | Ga0105237_10111265 | 3300009545 | Bacteria | 2730 |
| 231 | Ga0105238_10001480 | 3300009551 | Bacteria | 23574 |
| 232 | Ga0105249_10000832 | 3300009553 | Bacteria | 27782 |
| 233 | Ga0105249_12931582 | 3300009553 | Unclassified | 548 |
| 234 | Ga0099796_10300680 | 3300010159 | Bacteria | 680 |
| 235 | Ga0105239_10023448 | 3300010375 | Bacteria | 6797 |
| 236 | Ga0105246_10940927 | 3300011119 | Bacteria | 778 |
| 237 | Ga0105246_11097290 | 3300011119 | Unclassified | 726 |
| 238 | Ga0157316_1014179 | 3300012510 | Bacteria | 790 |
| 239 | Ga0157373_10003033 | 3300013100 | Bacteria | 12664 |
| 240 | Ga0157373_10005270 | 3300013100 | Bacteria | 9711 |
| 241 | Ga0157371_10000273 | 3300013102 | Bacteria | 70036 |
| 242 | Ga0157371_10034452 | 3300013102 | Bacteria | 3631 |
| 243 | Ga0157371_10505573 | 3300013102 | Bacteria | 893 |
| 244 | Ga0157371_10521335 | 3300013102 | Bacteria | 879 |
| 245 | Ga0157370_10004474 | 3300013104 | Bacteria | 16013 |
| 246 | Ga0157370_10007899 | 3300013104 | Bacteria | 11527 |
| 247 | Ga0157370_10020330 | 3300013104 | Bacteria | 6631 |
| 248 | Ga0157370_10050276 | 3300013104 | Bacteria | 3985 |
| 249 | Ga0157370_10395943 | 3300013104 | Bacteria | 1271 |
| 250 | Ga0157369_10014597 | 3300013105 | Bacteria | 8861 |
| 251 | Ga0157369_10282973 | 3300013105 | Bacteria | 1727 |
| 252 | Ga0157369_10444709 | 3300013105 | Bacteria | 1342 |
| 253 | Ga0157369_10448430 | 3300013105 | Bacteria | 1336 |
| 254 | Ga0157378_12828762 | 3300013297 | Bacteria | 538 |
| 255 | Ga0163162_10239328 | 3300013306 | Bacteria | 1946 |
| 256 | Ga0157372_10031649 | 3300013307 | Bacteria | 5792 |
| 257 | Ga0157372_10036492 | 3300013307 | Bacteria | 5418 |
| 258 | Ga0157372_10257205 | 3300013307 | Bacteria | 2027 |
| 259 | Ga0157372_11363442 | 3300013307 | Bacteria | 818 |
| 260 | Ga0157372_11782347 | 3300013307 | Bacteria | 708 |
| 261 | Ga0157375_13268001 | 3300013308 | Bacteria | 540 |
| 262 | Ga0157380_10151548 | 3300014326 | Bacteria | 2005 |
| 263 | Ga0157380_12194765 | 3300014326 | Bacteria | 616 |
| 264 | Ga0182008_10031251 | 3300014497 | Bacteria | 2681 |
| 265 | Ga0157377_10102982 | 3300014745 | Bacteria | 1704 |
| 266 | Ga0157379_10046402 | 3300014968 | Bacteria | 3875 |
| 267 | Ga0157376_10001360 | 3300014969 | Bacteria | 16077 |
| 268 | Ga0157376_10943628 | 3300014969 | Bacteria | 883 |
| 269 | Ga0157376_11772440 | 3300014969 | Unclassified | 653 |
| 270 | Ga0163161_10184992 | 3300017792 | Bacteria | 1599 |
| 271 | Ga0197907_11214187 | 3300020069 | Bacteria | 761 |
| 272 | Ga0206354_10304488 | 3300020081 | Bacteria | 707 |
| 273 | Ga0206353_10254265 | 3300020082 | Bacteria | 4083 |
| 274 | Ga0213872_10377523 | 3300021361 | Unclassified | 578 |
| 275 | Ga0209758_1000267 | 3300025297 | Bacteria | 103340 |
| 276 | Ga0209758_1002898 | 3300025297 | Bacteria | 16560 |
| 277 | Ga0209758_1018476 | 3300025297 | Bacteria | 3413 |
| 278 | Ga0207656_10004688 | 3300025321 | Bacteria | 4793 |
| 279 | Ga0207692_10003963 | 3300025898 | Bacteria | 5813 |
| 280 | Ga0207692_10338154 | 3300025898 | Unclassified | 925 |
| 281 | Ga0207642_10000839 | 3300025899 | Bacteria | 9538 |
| 282 | Ga0207642_10554649 | 3300025899 | Unclassified | 710 |
| 283 | Ga0207688_10566670 | 3300025901 | Bacteria | 714 |
| 284 | Ga0207685_10005558 | 3300025905 | Bacteria | 3340 |
| 285 | Ga0207699_10039510 | 3300025906 | Bacteria | 2712 |
| 286 | Ga0207699_10243798 | 3300025906 | Bacteria | 1236 |
| 287 | Ga0207699_11112258 | 3300025906 | Unclassified | 585 |
| 288 | Ga0207645_10014464 | 3300025907 | Bacteria | 5280 |
| 289 | Ga0207705_10004340 | 3300025909 | Bacteria | 10729 |
| 290 | Ga0207684_10010039 | 3300025910 | Bacteria | 8341 |
| 291 | Ga0207684_10627603 | 3300025910 | Bacteria | 916 |
| 292 | Ga0207684_11351376 | 3300025910 | Bacteria | 585 |
| 293 | Ga0207707_10001205 | 3300025912 | Bacteria | 24338 |
| 294 | Ga0207707_10045954 | 3300025912 | Bacteria | 3803 |
| 295 | Ga0207695_10004595 | 3300025913 | Bacteria | 18758 |
| 296 | Ga0207695_10103624 | 3300025913 | Bacteria | 2836 |
| 297 | Ga0207671_10170896 | 3300025914 | Bacteria | 1688 |
| 298 | Ga0207693_10037062 | 3300025915 | Bacteria | 3843 |
| 299 | Ga0207693_10500713 | 3300025915 | Bacteria | 948 |
| 300 | Ga0207693_10729495 | 3300025915 | Bacteria | 766 |
| 301 | Ga0207663_10027809 | 3300025916 | Bacteria | 3301 |
| 302 | Ga0207663_10209846 | 3300025916 | Bacteria | 1411 |
| 303 | Ga0207660_10001740 | 3300025917 | Bacteria | 14595 |
| 304 | Ga0207660_10248337 | 3300025917 | Bacteria | 1404 |
| 305 | Ga0207660_10264678 | 3300025917 | Bacteria | 1361 |
| 306 | Ga0207660_10351805 | 3300025917 | Bacteria | 1181 |
| 307 | Ga0207660_10456093 | 3300025917 | Bacteria | 1034 |
| 308 | Ga0207662_10000081 | 3300025918 | Bacteria | 44149 |
| 309 | Ga0207657_10000151 | 3300025919 | Bacteria | 70697 |
| 310 | Ga0207657_10000751 | 3300025919 | Bacteria | 34386 |
| 311 | Ga0207657_10003042 | 3300025919 | Bacteria | 17950 |
| 312 | Ga0207649_10000967 | 3300025920 | Bacteria | 17795 |
| 313 | Ga0207649_10109528 | 3300025920 | Bacteria | 1843 |
| 314 | Ga0207649_10179429 | 3300025920 | Bacteria | 1481 |
| 315 | Ga0207652_10003455 | 3300025921 | Bacteria | 13032 |
| 316 | Ga0207694_10001041 | 3300025924 | Bacteria | 24125 |
| 317 | Ga0207650_10634172 | 3300025925 | Bacteria | 900 |
| 318 | Ga0207650_11139120 | 3300025925 | Bacteria | 664 |
| 319 | Ga0207650_11180982 | 3300025925 | Unclassified | 651 |
| 320 | Ga0207659_10687151 | 3300025926 | Bacteria | 876 |
| 321 | Ga0207687_10000540 | 3300025927 | Bacteria | 25312 |
| 322 | Ga0207700_10002081 | 3300025928 | Bacteria | 11427 |
| 323 | Ga0207700_10131462 | 3300025928 | Bacteria | 2044 |
| 324 | Ga0207664_10001164 | 3300025929 | Bacteria | 17490 |
| 325 | Ga0207664_10016398 | 3300025929 | Bacteria | 5405 |
| 326 | Ga0207644_10019099 | 3300025931 | Bacteria | 4647 |
| 327 | Ga0207644_10058785 | 3300025931 | Bacteria | 2780 |
| 328 | Ga0207690_10003450 | 3300025932 | Bacteria | 9433 |
| 329 | Ga0207690_10067771 | 3300025932 | Bacteria | 2449 |
| 330 | Ga0207690_10131510 | 3300025932 | Bacteria | 1832 |
| 331 | Ga0207690_10134615 | 3300025932 | Bacteria | 1813 |
| 332 | Ga0207706_10001691 | 3300025933 | Bacteria | 21750 |
| 333 | Ga0207706_10478907 | 3300025933 | Bacteria | 1076 |
| 334 | Ga0207686_10013213 | 3300025934 | Bacteria | 4564 |
| 335 | Ga0207709_10003797 | 3300025935 | Bacteria | 8872 |
| 336 | Ga0207670_10007113 | 3300025936 | Bacteria | 6233 |
| 337 | Ga0207670_10496135 | 3300025936 | Bacteria | 991 |
| 338 | Ga0207704_10050142 | 3300025938 | Bacteria | 2516 |
| 339 | Ga0207704_10946845 | 3300025938 | Unclassified | 726 |
| 340 | Ga0207665_10063563 | 3300025939 | Bacteria | 2507 |
| 341 | Ga0207691_10075261 | 3300025940 | Bacteria | 3044 |
| 342 | Ga0207689_10000238 | 3300025942 | Bacteria | 49163 |
| 343 | Ga0207689_10368883 | 3300025942 | Bacteria | 1194 |
| 344 | Ga0207661_10010838 | 3300025944 | Bacteria | 6577 |
| 345 | Ga0207679_10010286 | 3300025945 | Bacteria | 6021 |
| 346 | Ga0207679_10010391 | 3300025945 | Bacteria | 5991 |
| 347 | Ga0207679_10053817 | 3300025945 | Bacteria | 2960 |
| 348 | Ga0207667_10000460 | 3300025949 | Bacteria | 54739 |
| 349 | Ga0207667_10035932 | 3300025949 | Bacteria | 5314 |
| 350 | Ga0207667_10042563 | 3300025949 | Bacteria | 4826 |
| 351 | Ga0207651_10022708 | 3300025960 | Bacteria | 3843 |
| 352 | Ga0207651_10564108 | 3300025960 | Bacteria | 991 |
| 353 | Ga0207712_10238085 | 3300025961 | Unclassified | 1465 |
| 354 | Ga0207640_10002366 | 3300025981 | Bacteria | 10108 |
| 355 | Ga0207640_10059013 | 3300025981 | Bacteria | 2530 |
| 356 | Ga0207640_10890466 | 3300025981 | Unclassified | 777 |
| 357 | Ga0207658_10049976 | 3300025986 | Bacteria | 3075 |
| 358 | Ga0207677_10006636 | 3300026023 | Bacteria | 6350 |
| 359 | Ga0207677_10296566 | 3300026023 | Bacteria | 1334 |
| 360 | Ga0207677_12084391 | 3300026023 | Unclassified | 527 |
| 361 | Ga0207703_10004524 | 3300026035 | Bacteria | 11404 |
| 362 | Ga0207703_10190894 | 3300026035 | Bacteria | 1814 |
| 363 | Ga0207639_10001340 | 3300026041 | Bacteria | 16630 |
| 364 | Ga0207639_10015684 | 3300026041 | Bacteria | 5347 |
| 365 | Ga0207639_10040346 | 3300026041 | Bacteria | 3483 |
| 366 | Ga0207639_10178609 | 3300026041 | Bacteria | 1804 |
| 367 | Ga0207639_10856860 | 3300026041 | Bacteria | 848 |
| 368 | Ga0207678_10003830 | 3300026067 | Bacteria | 13532 |
| 369 | Ga0207678_10025800 | 3300026067 | Bacteria | 5128 |
| 370 | Ga0207708_10000276 | 3300026075 | Bacteria | 40264 |
| 371 | Ga0207702_10003088 | 3300026078 | Bacteria | 15441 |
| 372 | Ga0207702_10028377 | 3300026078 | Bacteria | 4652 |
| 373 | Ga0207702_10835270 | 3300026078 | Bacteria | 911 |
| 374 | Ga0207641_11984541 | 3300026088 | Bacteria | 583 |
| 375 | Ga0207648_10005355 | 3300026089 | Bacteria | 12937 |
| 376 | Ga0207648_10452984 | 3300026089 | Bacteria | 1169 |
| 377 | Ga0207676_11128752 | 3300026095 | Bacteria | 776 |
| 378 | Ga0207674_10000248 | 3300026116 | Bacteria | 67145 |
| 379 | Ga0207675_100000120 | 3300026118 | Bacteria | 64416 |
| 380 | Ga0207675_100468266 | 3300026118 | Bacteria | 1251 |
| 381 | Ga0207698_10000475 | 3300026142 | Bacteria | 23321 |
| 382 | Ga0207698_10002920 | 3300026142 | Bacteria | 10213 |
| 383 | Ga0207698_10049343 | 3300026142 | Bacteria | 3203 |
| 384 | Ga0207698_10088122 | 3300026142 | Bacteria | 2530 |
| 385 | Ga0209967_1004667 | 3300027364 | Bacteria | 1827 |
| 386 | Ga0209967_1031179 | 3300027364 | Bacteria | 798 |
| 387 | Ga0209981_1006167 | 3300027378 | Bacteria | 1601 |
| 388 | Ga0209981_1011592 | 3300027378 | Bacteria | 1216 |
| 389 | Ga0209981_1014001 | 3300027378 | Bacteria | 1117 |
| 390 | Ga0209996_1012299 | 3300027395 | Bacteria | 1149 |
| 391 | Ga0209996_1024199 | 3300027395 | Bacteria | 864 |
| 392 | Ga0210000_1001117 | 3300027462 | Bacteria | 3762 |
| 393 | Ga0210000_1026843 | 3300027462 | Bacteria | 894 |
| 394 | Ga0210000_1035697 | 3300027462 | Bacteria | 783 |
| 395 | Ga0209968_1004771 | 3300027526 | Bacteria | 2031 |
| 396 | Ga0209999_1014765 | 3300027543 | Bacteria | 1419 |
| 397 | Ga0209999_1030822 | 3300027543 | Bacteria | 995 |
| 398 | Ga0209999_1068066 | 3300027543 | Bacteria | 681 |
| 399 | Ga0209982_1060182 | 3300027552 | Bacteria | 618 |
| 400 | Ga0210002_1062964 | 3300027617 | Bacteria | 649 |
| 401 | Ga0209983_1001705 | 3300027665 | Bacteria | 4855 |
| 402 | Ga0209983_1068722 | 3300027665 | Bacteria | 788 |
| 403 | Ga0209588_1009034 | 3300027671 | Bacteria | 2968 |
| 404 | Ga0209971_1014026 | 3300027682 | Bacteria | 1899 |
| 405 | Ga0209974_10001930 | 3300027876 | Bacteria | 7570 |
| 406 | Ga0209974_10006944 | 3300027876 | Bacteria | 3920 |
| 407 | Ga0207428_10000758 | 3300027907 | Bacteria | 36770 |
| 408 | Ga0207428_10163958 | 3300027907 | Bacteria | 1686 |
| 409 | Ga0268266_10878761 | 3300028379 | Unclassified | 867 |
| 410 | Ga0268265_10002989 | 3300028380 | Bacteria | 12351 |
| 411 | Ga0268264_10005363 | 3300028381 | Bacteria | 10865 |
| 412 | Ga0268264_10048316 | 3300028381 | Bacteria | 3540 |
| 413 | Ga0268264_10444908 | 3300028381 | Bacteria | 1254 |
| 414 | Ga0265338_10395628 | 3300028800 | Bacteria | 986 |
| 415 | Ga0265338_10949630 | 3300028800 | Bacteria | 584 |
| 416 | Ga0307511_10000001 | 3300030521 | Bacteria | 206079 |
| 417 | Ga0265340_10263704 | 3300031247 | Bacteria | 767 |
| 418 | Ga0265327_10041581 | 3300031251 | Bacteria | 2476 |
| 419 | Ga0307408_100356741 | 3300031548 | Bacteria | 1242 |
| 420 | Ga0307408_100899272 | 3300031548 | Bacteria | 810 |
| 421 | Ga0307508_10212658 | 3300031616 | Bacteria | 1534 |
| 422 | Ga0307508_10676021 | 3300031616 | Bacteria | 640 |
| 423 | Ga0307516_10242509 | 3300031730 | Bacteria | 1500 |
| 424 | Ga0307405_10176508 | 3300031731 | Unclassified | 1529 |
| 425 | Ga0307405_11571117 | 3300031731 | Bacteria | 580 |
| 426 | Ga0307413_10006689 | 3300031824 | Bacteria | 5290 |
| 427 | Ga0307410_10091464 | 3300031852 | Bacteria | 2160 |
| 428 | Ga0307410_10462552 | 3300031852 | Bacteria | 1037 |
| 429 | Ga0307410_11446630 | 3300031852 | Bacteria | 604 |
| 430 | Ga0307406_10136962 | 3300031901 | Bacteria | 1727 |
| 431 | Ga0307406_10515969 | 3300031901 | Bacteria | 972 |
| 432 | Ga0307407_10091013 | 3300031903 | Bacteria | 1870 |
| 433 | Ga0307416_100131617 | 3300032002 | Bacteria | 2253 |
| 434 | Ga0307416_100499716 | 3300032002 | Bacteria | 1280 |
| 435 | Ga0307416_100680726 | 3300032002 | Bacteria | 1116 |
| 436 | Ga0307416_100810547 | 3300032002 | Bacteria | 1032 |
| 437 | Ga0307416_100822242 | 3300032002 | Bacteria | 1026 |
| 438 | Ga0307416_101323355 | 3300032002 | Bacteria | 826 |
| 439 | Ga0307416_103122657 | 3300032002 | Bacteria | 554 |
| 440 | Ga0307414_10709444 | 3300032004 | Bacteria | 911 |
| 441 | Ga0307411_10001330 | 3300032005 | Bacteria | 9960 |
| 442 | Ga0307411_10089040 | 3300032005 | Bacteria | 2149 |
| 443 | Ga0307411_11201414 | 3300032005 | Bacteria | 687 |
| 444 | Ga0307415_100085261 | 3300032126 | Bacteria | 2269 |
| 445 | Ga0307415_100832573 | 3300032126 | Bacteria | 845 |
| 446 | Ga0307507_10228255 | 3300033179 | Bacteria | 1239 |
| 447 | Ga0307510_10156035 | 3300033180 | Bacteria | 1889 |
| 448 | Ga0373930_0016991 | 3300034816 | Bacteria | 1382 |
| 449 | Ga0373948_0002718 | 3300034817 | Bacteria | 2646 |
| 450 | Ga0373959_0021659 | 3300034820 | Bacteria | 1236 |
| 451 | Ga0373938_0015847 | 3300034957 | Bacteria | 1466 |
| 452 | Ga0373926_0007399 | 3300035083 | Bacteria | 3657 |
| 453 | Ga0373926_0197660 | 3300035083 | Bacteria | 773 |
| 454 | Ga0373929_0009222 | 3300035085 | Bacteria | 1827 |
| 455 | Ga0373940_0081569 | 3300035088 | Bacteria | 957 |
| 456 | Ga0373944_0047295 | 3300035089 | Bacteria | 1347 |
| 457 | Ga0373949_0014387 | 3300035090 | Bacteria | 1761 |
| 458 | Ga0373952_0093073 | 3300035092 | Bacteria | 785 |
| 459 | Ga0373932_0001387 | 3300035112 | Bacteria | 6796 |
| 460 | Ga0373932_0351945 | 3300035112 | Unclassified | 560 |
| 461 | Ga0373936_0006678 | 3300035113 | Bacteria | 4343 |
| 462 | Ga0373936_0094679 | 3300035113 | Bacteria | 1255 |
| 463 | Ga0373936_0173901 | 3300035113 | Bacteria | 942 |
| 464 | Ga0373939_0002376 | 3300035114 | Bacteria | 4445 |
| 465 | Ga0373945_0013405 | 3300035116 | Bacteria | 2734 |
| 466 | Ga0373960_0030486 | 3300035121 | Bacteria | 1503 |
| 467 | Ga0373960_0036457 | 3300035121 | Bacteria | 1401 |
| 468 | Ga0373943_0002540 | 3300035170 | Bacteria | 8297 |
| 469 | Ga0373943_0023215 | 3300035170 | Bacteria | 2882 |
| 470 | Ga0373946_0078003 | 3300035171 | Bacteria | 1444 |
| 471 | Ga0373942_0007911 | 3300035207 | Bacteria | 2471 |
| 472 | Ga0373961_0018294 | 3300035241 | Bacteria | 1828 |
| 473 | Ga0373962_0008923 | 3300035242 | Bacteria | 2476 |
| 474 | Ga0373931_0000248 | 3300035691 | Bacteria | 22945 |
| 475 | Ga0373935_0007685 | 3300035692 | Bacteria | 6462 |
| 476 | Ga0373935_0197554 | 3300035692 | Bacteria | 1388 |
| 477 | Ga0373927_0000238 | 3300035695 | Bacteria | 43099 |
| 478 | Ga0373927_0141391 | 3300035695 | Bacteria | 1574 |
| 479 | Ga0373947_0004553 | 3300035725 | Bacteria | 8125 |
| 480 | Ga0373947_0108738 | 3300035725 | Bacteria | 1749 |
| 481 | Ga0373925_0028100 | 3300037068 | Bacteria | 4119 |
| 482 | Ga0373925_0191834 | 3300037068 | Bacteria | 1621 |
| 483 | Ga0373925_1106627 | 3300037068 | Bacteria | 652 |
| 484 | Ga0395899_0229336 | 3300037312 | Bacteria | 1283 |
| 485 | Ga0395900_0082980 | 3300037418 | Bacteria | 3293 |
| 486 | Ga0395898_1052577 | 3300037466 | Bacteria | 748 |
| 487 | Ga0395905_0074000 | 3300037471 | Bacteria | 3193 |
| 488 | Ga0395901_0187834 | 3300038443 | Bacteria | 2167 |
| 489 | Ga0436361_0330901 | 3300039447 | Bacteria | 1885 |
| 490 | Ga0439453_0022869 | 3300041408 | Bacteria | 1137 |
| 491 | Ga0439441_000038 | 3300042001 | Bacteria | 9490 |
| 492 | Ga0439443_001039 | 3300042003 | Bacteria | 2879 |
| 493 | Ga0439443_009608 | 3300042003 | Bacteria | 1389 |
| 494 | Ga0439451_008889 | 3300042009 | Bacteria | 2036 |
| 495 | Ga0439456_043978 | 3300042013 | Bacteria | 971 |
| 496 | Ga0439434_0031302 | 3300042435 | Bacteria | 1617 |
| 497 | Ga0439435_0000706 | 3300042436 | Bacteria | 5562 |
| 498 | Ga0439435_0003425 | 3300042436 | Bacteria | 3296 |
| 499 | Ga0439444_0000748 | 3300042437 | Bacteria | 3861 |
| 500 | Ga0439464_0077555 | 3300042439 | Bacteria | 989 |
| 501 | Ga0439460_0000034 | 3300042461 | Bacteria | 19622 |
| 502 | Ga0439460_0023721 | 3300042461 | Bacteria | 1694 |
| 503 | Ga0451577_1185101 | 3300042876 | Unclassified | 682 |
| 504 | Ga0453683_0460860 | 3300044673 | Bacteria | 823 |
| 505 | Ga0466963_0648945 | 3300044694 | Bacteria | 745 |
| 506 | Ga0451576_0000814 | 3300045051 | Bacteria | 61027 |
| 507 | Ga0451576_0515557 | 3300045051 | Bacteria | 1256 |
| 508 | Ga0451576_0667369 | 3300045051 | Bacteria | 1092 |
| 509 | Ga0451576_1094189 | 3300045051 | Unclassified | 834 |
| 510 | Ga0466967_1162543 | 3300045976 | Bacteria | 769 |
| 511 | Ga0495603_0064976 | 3300046455 | Bacteria | 2150 |
| 512 | Ga0495580_0000129 | 3300046472 | Bacteria | 52542 |
| 513 | Ga0495639_0265725 | 3300046475 | Bacteria | 850 |
| 514 | Ga0495584_0199542 | 3300046491 | Bacteria | 1017 |
| 515 | Ga0495618_0855944 | 3300046514 | Bacteria | 527 |
| 516 | Ga0495666_0009163 | 3300046526 | Bacteria | 4950 |
| 517 | Ga0495642_0131433 | 3300046528 | Bacteria | 1078 |
| 518 | Ga0495665_0291869 | 3300046531 | Bacteria | 836 |
| 519 | Ga0495586_0001200 | 3300046535 | Bacteria | 14559 |
| 520 | Ga0495598_0074706 | 3300046537 | Bacteria | 1075 |
| 521 | Ga0495598_0120954 | 3300046537 | Bacteria | 887 |
| 522 | Ga0495645_0290404 | 3300046543 | Bacteria | 1072 |
| 523 | Ga0495622_0100878 | 3300046557 | Bacteria | 1323 |
| 524 | Ga0495659_0009046 | 3300046664 | Bacteria | 3175 |
| 525 | Ga0495659_0252927 | 3300046664 | Bacteria | 735 |
| 526 | Ga0495588_0032491 | 3300046674 | Bacteria | 2631 |
| 527 | Ga0495647_0002864 | 3300046681 | Bacteria | 5478 |
| 528 | Ga0495658_0127347 | 3300046683 | Bacteria | 1547 |
| 529 | Ga0495669_0273030 | 3300046684 | Bacteria | 813 |
| 530 | Ga0495624_0118544 | 3300046690 | Bacteria | 1626 |
| 531 | Ga0495581_0027084 | 3300047315 | Bacteria | 3325 |
| 532 | Ga0495604_0946898 | 3300047317 | Unclassified | 536 |
| 533 | Ga0495636_0006014 | 3300047318 | Bacteria | 4762 |
| 534 | Ga0496100_0201405 | 3300048903 | Bacteria | 1451 |
| 535 | Ga0496100_0902023 | 3300048903 | Bacteria | 694 |
| 536 | Ga0496100_1065610 | 3300048903 | Bacteria | 637 |
| 537 | Ga0496101_0204305 | 3300048904 | Bacteria | 1528 |
| 538 | Ga0496102_1422187 | 3300048905 | Unclassified | 612 |
| 539 | Ga0496103_0122691 | 3300048906 | Bacteria | 1656 |
| 540 | Ga0496104_0014252 | 3300048907 | Bacteria | 7176 |
| 541 | Ga0496104_0045650 | 3300048907 | Bacteria | 4122 |
| 542 | Ga0496104_0595475 | 3300048907 | Bacteria | 1016 |
| 543 | Ga0496105_0074052 | 3300048908 | Bacteria | 2813 |
| 544 | Ga0496106_0008137 | 3300048909 | Bacteria | 7745 |
| 545 | Ga0496106_0170702 | 3300048909 | Bacteria | 1724 |
| 546 | Ga0496106_0543484 | 3300048909 | Bacteria | 932 |
| 547 | Ga0496107_0054257 | 3300048910 | Bacteria | 2892 |
| 548 | Ga0496107_1274388 | 3300048910 | Unclassified | 526 |
| 549 | Ga0496108_1750898 | 3300048911 | Unclassified | 510 |
| 550 | Ga0496109_0050662 | 3300048912 | Bacteria | 3781 |
| 551 | Ga0496110_0073828 | 3300048913 | Bacteria | 3027 |
| 552 | Ga0496110_0688929 | 3300048913 | Bacteria | 923 |
| 553 | Ga0496111_1032988 | 3300048914 | Unclassified | 588 |
| 554 | Ga0496113_0846665 | 3300048916 | Bacteria | 725 |
| 555 | Ga0496114_0154005 | 3300048917 | Bacteria | 1995 |
| 556 | Ga0496114_0375646 | 3300048917 | Bacteria | 1258 |
| 557 | Ga0496115_0058786 | 3300048918 | Bacteria | 3095 |
| 558 | Ga0496115_0986921 | 3300048918 | Bacteria | 644 |
| 559 | Ga0496118_0157700 | 3300048921 | Bacteria | 1409 |
| 560 | Ga0496119_0062434 | 3300048922 | Bacteria | 2220 |
| 561 | Ga0501291_016415 | 3300049514 | Bacteria | 1131 |
| 562 | Ga0501291_056472 | 3300049514 | Bacteria | 728 |
| 563 | Ga0501293_010562 | 3300049516 | Bacteria | 800 |
| 564 | Ga0501297_050169 | 3300049520 | Bacteria | 612 |
| 565 | Ga0501298_152254 | 3300049521 | Bacteria | 566 |
| 566 | Ga0501299_071211 | 3300049522 | Bacteria | 755 |
| 567 | Ga0501299_075979 | 3300049522 | Bacteria | 738 |
| 568 | Ga0501299_085396 | 3300049522 | Bacteria | 708 |
| 569 | Ga0501039_0161926 | 3300049575 | Bacteria | 1759 |
| 570 | Ga0501040_0932879 | 3300049576 | Bacteria | 629 |
| 571 | Ga0501042_0133153 | 3300049578 | Bacteria | 1792 |
| 572 | Ga0501042_0891418 | 3300049578 | Bacteria | 648 |
| 573 | Ga0501048_0324147 | 3300049582 | Bacteria | 1097 |
| 574 | Ga0501068_0613210 | 3300049584 | Bacteria | 709 |
| 575 | Ga0501071_0228030 | 3300049587 | Bacteria | 1403 |
| 576 | Ga0501071_1598304 | 3300049587 | Unclassified | 503 |
| 577 | Ga0501072_0080016 | 3300049588 | Bacteria | 2588 |
| 578 | Ga0501072_0203660 | 3300049588 | Bacteria | 1578 |
| 579 | Ga0501072_0666873 | 3300049588 | Bacteria | 818 |
| 580 | Ga0501072_0683277 | 3300049588 | Bacteria | 807 |
| 581 | Ga0501072_0725910 | 3300049588 | Bacteria | 780 |
| 582 | Ga0501075_0138293 | 3300049591 | Bacteria | 1855 |
| 583 | Ga0501076_0271727 | 3300049592 | Bacteria | 1388 |
| 584 | Ga0501076_0806923 | 3300049592 | Unclassified | 774 |
| 585 | Ga0501198_083977 | 3300049649 | Unclassified | 621 |
| 586 | Ga0501209_243591 | 3300049656 | Bacteria | 561 |
| 587 | Ga0501214_016652 | 3300049659 | Bacteria | 891 |
| 588 | Ga0501216_070548 | 3300049660 | Bacteria | 721 |
| 589 | Ga0501227_072439 | 3300049665 | Bacteria | 896 |
| 590 | Ga0501228_012888 | 3300049666 | Bacteria | 865 |
| 591 | Ga0501230_045416 | 3300049667 | Bacteria | 861 |
| 592 | Ga0501233_187973 | 3300049668 | Unclassified | 595 |
| 593 | Ga0501235_219733 | 3300049669 | Bacteria | 521 |
| 594 | Ga0501225_0113008 | 3300049705 | Bacteria | 802 |
| 595 | Ga0501229_071413 | 3300049706 | Bacteria | 544 |
| 596 | Ga0501081_0215408 | 3300049743 | Bacteria | 1396 |
| 597 | Ga0501283_015624 | 3300049779 | Bacteria | 1170 |
| 598 | Ga0501045_0277675 | 3300049824 | Bacteria | 1247 |
| 599 | nmdc:mga03683_245660_c1 | 3300050489 | Bacteria | 830 |
| 600 | nmdc:mga03n38_552297_c1 | 3300050490 | Bacteria | 652 |
| 601 | nmdc:mga00v17_327952_c1 | 3300050491 | Bacteria | 995 |
| 602 | nmdc:mga00v17_621869_c1 | 3300050491 | Bacteria | 696 |
| 603 | nmdc:mga00v17_77928_c1 | 3300050491 | Bacteria | 2064 |
| 604 | nmdc:mga0yw44_22437_c1 | 3300050492 | Bacteria | 3540 |
| 605 | nmdc:mga0yw44_449181_c1 | 3300050492 | Bacteria | 874 |
| 606 | nmdc:mga0k408_65206_c1 | 3300050493 | Bacteria | 2120 |
| 607 | nmdc:mga06z11_39682_c1 | 3300050494 | Bacteria | 2345 |
| 608 | nmdc:mga04h51_124786_c1 | 3300050495 | Bacteria | 963 |
| 609 | nmdc:mga07m45_139518_c1 | 3300050496 | Bacteria | 1404 |
| 610 | nmdc:mga07m45_35974_c2 | 3300050496 | Bacteria | 2396 |
| 611 | nmdc:mga05p37_1349522_c1 | 3300050507 | Bacteria | 722 |
| 612 | nmdc:mga05p37_2242280_c1 | 3300050507 | Unclassified | 505 |
| 613 | nmdc:mga05p37_233794_c1 | 3300050507 | Bacteria | 2213 |
| 614 | nmdc:mga05p37_381285_c1 | 3300050507 | Bacteria | 1652 |
| 615 | nmdc:mga05p37_453_c1 | 3300050507 | Bacteria | 44606 |
| 616 | nmdc:mga05p37_688374_c1 | 3300050507 | Bacteria | 1138 |
| 617 | nmdc:mga05p37_940686_c1 | 3300050507 | Bacteria | 926 |
| 618 | nmdc:mga09592_148654_c1 | 3300050508 | Bacteria | 2021 |
| 619 | nmdc:mga09592_2521_c1 | 3300050508 | Bacteria | 14819 |
| 620 | nmdc:mga09592_316333_c1 | 3300050508 | Bacteria | 1353 |
| 621 | nmdc:mga09592_610553_c1 | 3300050508 | Bacteria | 934 |
| 622 | nmdc:mga0qj67_19850_c1 | 3300050509 | Bacteria | 5141 |
| 623 | nmdc:mga0qj67_284626_c1 | 3300050509 | Bacteria | 1340 |
| 624 | nmdc:mga06r32_1164781_c1 | 3300050510 | Bacteria | 718 |
| 625 | nmdc:mga06r32_119414_c1 | 3300050510 | Bacteria | 2600 |
| 626 | nmdc:mga06r32_171041_c1 | 3300050510 | Bacteria | 2157 |
| 627 | nmdc:mga06r32_229875_c1 | 3300050510 | Bacteria | 1843 |
| 628 | nmdc:mga06r32_452194_c1 | 3300050510 | Bacteria | 1264 |
| 629 | nmdc:mga08y16_1018957_c1 | 3300050511 | Bacteria | 807 |
| 630 | nmdc:mga08y16_43257_c1 | 3300050511 | Bacteria | 4720 |
| 631 | nmdc:mga08y16_71997_c1 | 3300050511 | Bacteria | 3602 |
| 632 | nmdc:mga0n895_1496506_c1 | 3300050512 | Bacteria | 641 |
| 633 | nmdc:mga0n895_396549_c1 | 3300050512 | Bacteria | 1396 |
| 634 | nmdc:mga0rr50_624195_c1 | 3300050513 | Bacteria | 919 |
| 635 | nmdc:mga0a205_160961_c1 | 3300050515 | Bacteria | 2141 |
| 636 | nmdc:mga0a205_255009_c1 | 3300050515 | Bacteria | 1633 |
| 637 | nmdc:mga0sz30_378100_c1 | 3300050516 | Unclassified | 634 |
| 638 | nmdc:mga0sz30_81081_c1 | 3300050516 | Bacteria | 1404 |
| 639 | Ga0500643_003071 | 3300053087 | Bacteria | 8206 |
| 640 | Ga0500644_0313433 | 3300053088 | Bacteria | 673 |
| 641 | Ga0500646_0000184 | 3300053090 | Bacteria | 18721 |
| 642 | Ga0500583_0005384 | 3300053092 | Bacteria | 4285 |
| 643 | Ga0500583_0124688 | 3300053092 | Bacteria | 1275 |
| 644 | Ga0500651_0421426 | 3300053093 | Unclassified | 747 |
| 645 | Ga0500641_0004864 | 3300053096 | Bacteria | 4755 |
| 646 | Ga0500641_0249765 | 3300053096 | Bacteria | 744 |
| 647 | Ga0500650_0036589 | 3300053098 | Bacteria | 2253 |
| 648 | Ga0500650_0166244 | 3300053098 | Bacteria | 1016 |
| 649 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 650 | Ga0500595_002937 | 3300053119 | Bacteria | 8144 |
| 651 | Ga0500595_054026 | 3300053119 | Bacteria | 1234 |
| 652 | Ga0500642_0085297 | 3300053130 | Bacteria | 1455 |
| 653 | Ga0500642_0174774 | 3300053130 | Bacteria | 1005 |
| 654 | Ga0500655_000967 | 3300053133 | Bacteria | 5534 |
| 655 | Ga0500568_0045198 | 3300053139 | Bacteria | 1754 |
| 656 | Ga0500568_0050545 | 3300053139 | Bacteria | 1638 |
| 657 | Ga0500588_0221381 | 3300053146 | Bacteria | 706 |
| 658 | Ga0500604_0000501 | 3300053151 | Bacteria | 10800 |
| 659 | Ga0500627_0186692 | 3300053158 | Bacteria | 932 |
| 660 | Ga0500637_0108147 | 3300053178 | Bacteria | 1613 |
| 661 | Ga0530510_0238418 | 3300061734 | Bacteria | 1354 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005981 | Ga0081538_10128292 | Ga0081538_101282921 | 91 |
| 2 | 3300031548 | Ga0307408_100356741 | Ga0307408_1003567412 | 92 |
| 3 | 3300037068 | Ga0373925_1106627 | Ga0373925_1106627_157_441 | 92 |
| 4 | 3300049522 | Ga0501299_075979 | Ga0501299_075979_283_567 | 92 |
| 5 | 3300049667 | Ga0501230_045416 | Ga0501230_045416_333_611 | 92 |
| 6 | 3300049576 | Ga0501040_0932879 | Ga0501040_0932879_22_318 | 96 |
| 7 | 3300050509 | nmdc:mga0qj67_284626_c1 | nmdc:mga0qj67_284626_c1_24_317 | 96 |
| 8 | 3300005563 | Ga0068855_100287727 | Ga0068855_1002877272 | 97 |
| 9 | 3300005578 | Ga0068854_100195011 | Ga0068854_1001950112 | 97 |
| 10 | 3300025932 | Ga0207690_10067771 | Ga0207690_100677712 | 97 |
| 11 | 3300026041 | Ga0207639_10178609 | Ga0207639_101786092 | 97 |
| 12 | 3300048914 | Ga0496111_1032988 | Ga0496111_1032988_258_557 | 97 |
| 13 | 3300031852 | Ga0307410_10462552 | Ga0307410_104625522 | 102 |
| 14 | 3300032002 | Ga0307416_101323355 | Ga0307416_1013233552 | 102 |
| 15 | 3300032005 | Ga0307411_11201414 | Ga0307411_112014142 | 102 |
| 16 | 3300032126 | Ga0307415_100832573 | Ga0307415_1008325732 | 102 |
| 17 | 3300050511 | nmdc:mga08y16_71997_c1 | nmdc:mga08y16_71997_c1_18_329 | 103 |
| 18 | 3300046528 | Ga0495642_0131433 | Ga0495642_0131433_569_883 | 104 |
| 19 | 3300007076 | Ga0075435_100656015 | Ga0075435_1006560152 | 108 |
| 20 | 3300049582 | Ga0501048_0324147 | Ga0501048_0324147_324_653 | 109 |
| 21 | 3300049588 | Ga0501072_0666873 | Ga0501072_0666873_112_441 | 109 |
| 22 | 3300049591 | Ga0501075_0138293 | Ga0501075_0138293_1228_1557 | 109 |
| 23 | 3300049592 | Ga0501076_0271727 | Ga0501076_0271727_561_890 | 109 |
| 24 | 3300049824 | Ga0501045_0277675 | Ga0501045_0277675_491_820 | 109 |
| 25 | 3300005334 | Ga0068869_100000251 | Ga0068869_10000025119 | 110 |
| 26 | 3300005335 | Ga0070666_10025642 | Ga0070666_100256424 | 110 |
| 27 | 3300005336 | Ga0070680_100028969 | Ga0070680_1000289696 | 110 |
| 28 | 3300005336 | Ga0070680_100519708 | Ga0070680_1005197082 | 110 |
| 29 | 3300005337 | Ga0070682_100001570 | Ga0070682_1000015702 | 110 |
| 30 | 3300005338 | Ga0068868_100000323 | Ga0068868_10000032321 | 110 |
| 31 | 3300005338 | Ga0068868_100226386 | Ga0068868_1002263861 | 110 |
| 32 | 3300005340 | Ga0070689_100000549 | Ga0070689_10000054919 | 110 |
| 33 | 3300005340 | Ga0070689_100008057 | Ga0070689_1000080577 | 110 |
| 34 | 3300005340 | Ga0070689_100345986 | Ga0070689_1003459862 | 110 |
| 35 | 3300005341 | Ga0070691_10001307 | Ga0070691_1000130710 | 110 |
| 36 | 3300005343 | Ga0070687_100000059 | Ga0070687_10000005918 | 110 |
| 37 | 3300005355 | Ga0070671_100127703 | Ga0070671_1001277032 | 110 |
| 38 | 3300005364 | Ga0070673_100616129 | Ga0070673_1006161292 | 110 |
| 39 | 3300005365 | Ga0070688_100292239 | Ga0070688_1002922392 | 110 |
| 40 | 3300005365 | Ga0070688_100344786 | Ga0070688_1003447862 | 110 |
| 41 | 3300005438 | Ga0070701_10000194 | Ga0070701_1000019420 | 110 |
| 42 | 3300005438 | Ga0070701_10197462 | Ga0070701_101974622 | 110 |
| 43 | 3300005439 | Ga0070711_100713172 | Ga0070711_1007131722 | 110 |
| 44 | 3300005440 | Ga0070705_100000370 | Ga0070705_1000003704 | 110 |
| 45 | 3300005440 | Ga0070705_100150062 | Ga0070705_1001500622 | 110 |
| 46 | 3300005441 | Ga0070700_100000391 | Ga0070700_1000003914 | 110 |
| 47 | 3300005444 | Ga0070694_100000813 | Ga0070694_10000081317 | 110 |
| 48 | 3300005444 | Ga0070694_101376060 | Ga0070694_1013760602 | 110 |
| 49 | 3300005445 | Ga0070708_100124028 | Ga0070708_1001240282 | 110 |
| 50 | 3300005456 | Ga0070678_100459062 | Ga0070678_1004590622 | 110 |
| 51 | 3300005457 | Ga0070662_100307183 | Ga0070662_1003071832 | 110 |
| 52 | 3300005458 | Ga0070681_10143996 | Ga0070681_101439962 | 110 |
| 53 | 3300005459 | Ga0068867_100000514 | Ga0068867_1000005149 | 110 |
| 54 | 3300005466 | Ga0070685_10892951 | Ga0070685_108929512 | 110 |
| 55 | 3300005530 | Ga0070679_102111494 | Ga0070679_1021114942 | 110 |
| 56 | 3300005539 | Ga0068853_100021931 | Ga0068853_1000219314 | 110 |
| 57 | 3300005544 | Ga0070686_100000243 | Ga0070686_1000002434 | 110 |
| 58 | 3300005545 | Ga0070695_100000141 | Ga0070695_10000014128 | 110 |
| 59 | 3300005546 | Ga0070696_100000253 | Ga0070696_10000025317 | 110 |
| 60 | 3300005547 | Ga0070693_100000009 | Ga0070693_10000000929 | 110 |
| 61 | 3300005549 | Ga0070704_100000076 | Ga0070704_10000007631 | 110 |
| 62 | 3300005563 | Ga0068855_100004666 | Ga0068855_1000046664 | 110 |
| 63 | 3300005578 | Ga0068854_100001580 | Ga0068854_1000015801 | 110 |
| 64 | 3300005614 | Ga0068856_100024817 | Ga0068856_1000248172 | 110 |
| 65 | 3300005615 | Ga0070702_100000075 | Ga0070702_10000007519 | 110 |
| 66 | 3300005617 | Ga0068859_100001974 | Ga0068859_1000019745 | 110 |
| 67 | 3300005618 | Ga0068864_100611897 | Ga0068864_1006118972 | 110 |
| 68 | 3300005718 | Ga0068866_10000347 | Ga0068866_1000034716 | 110 |
| 69 | 3300005719 | Ga0068861_100000106 | Ga0068861_10000010613 | 110 |
| 70 | 3300005841 | Ga0068863_100472136 | Ga0068863_1004721362 | 110 |
| 71 | 3300005841 | Ga0068863_101376880 | Ga0068863_1013768801 | 110 |
| 72 | 3300005842 | Ga0068858_100137412 | Ga0068858_1001374122 | 110 |
| 73 | 3300005842 | Ga0068858_100188129 | Ga0068858_1001881292 | 110 |
| 74 | 3300005843 | Ga0068860_100000484 | Ga0068860_10000048429 | 110 |
| 75 | 3300005843 | Ga0068860_100061096 | Ga0068860_1000610964 | 110 |
| 76 | 3300005844 | Ga0068862_100001748 | Ga0068862_1000017482 | 110 |
| 77 | 3300006173 | Ga0070716_100616749 | Ga0070716_1006167491 | 110 |
| 78 | 3300006237 | Ga0097621_100012458 | Ga0097621_1000124587 | 110 |
| 79 | 3300006358 | Ga0068871_100017622 | Ga0068871_1000176227 | 110 |
| 80 | 3300006844 | Ga0075428_101213397 | Ga0075428_1012133972 | 110 |
| 81 | 3300006846 | Ga0075430_100068421 | Ga0075430_1000684215 | 110 |
| 82 | 3300006846 | Ga0075430_100834499 | Ga0075430_1008344991 | 110 |
| 83 | 3300006847 | Ga0075431_100047993 | Ga0075431_1000479936 | 110 |
| 84 | 3300006847 | Ga0075431_100240397 | Ga0075431_1002403972 | 110 |
| 85 | 3300006852 | Ga0075433_10001240 | Ga0075433_1000124015 | 110 |
| 86 | 3300006880 | Ga0075429_100326289 | Ga0075429_1003262892 | 110 |
| 87 | 3300006880 | Ga0075429_101662242 | Ga0075429_1016622422 | 110 |
| 88 | 3300006914 | Ga0075436_100000896 | Ga0075436_10000089612 | 110 |
| 89 | 3300006931 | Ga0097620_100001974 | Ga0097620_1000019745 | 110 |
| 90 | 3300009098 | Ga0105245_10000329 | Ga0105245_1000032916 | 110 |
| 91 | 3300009147 | Ga0114129_10796389 | Ga0114129_107963892 | 110 |
| 92 | 3300009148 | Ga0105243_10000590 | Ga0105243_1000059021 | 110 |
| 93 | 3300009174 | Ga0105241_10579476 | Ga0105241_105794761 | 110 |
| 94 | 3300009176 | Ga0105242_10000243 | Ga0105242_1000024312 | 110 |
| 95 | 3300009553 | Ga0105249_10000832 | Ga0105249_1000083212 | 110 |
| 96 | 3300010375 | Ga0105239_10023448 | Ga0105239_100234488 | 110 |
| 97 | 3300011119 | Ga0105246_11097290 | Ga0105246_110972901 | 110 |
| 98 | 3300013102 | Ga0157371_10521335 | Ga0157371_105213352 | 110 |
| 99 | 3300013306 | Ga0163162_10239328 | Ga0163162_102393282 | 110 |
| 100 | 3300013307 | Ga0157372_11363442 | Ga0157372_113634422 | 110 |
| 101 | 3300013308 | Ga0157375_13268001 | Ga0157375_132680011 | 110 |
| 102 | 3300014326 | Ga0157380_10151548 | Ga0157380_101515482 | 110 |
| 103 | 3300014326 | Ga0157380_12194765 | Ga0157380_121947651 | 110 |
| 104 | 3300014745 | Ga0157377_10102982 | Ga0157377_101029822 | 110 |
| 105 | 3300014968 | Ga0157379_10046402 | Ga0157379_100464025 | 110 |
| 106 | 3300014969 | Ga0157376_10001360 | Ga0157376_1000136012 | 110 |
| 107 | 3300017792 | Ga0163161_10184992 | Ga0163161_101849921 | 110 |
| 108 | 3300025899 | Ga0207642_10000839 | Ga0207642_100008399 | 110 |
| 109 | 3300025901 | Ga0207688_10566670 | Ga0207688_105666702 | 110 |
| 110 | 3300025912 | Ga0207707_10045954 | Ga0207707_100459542 | 110 |
| 111 | 3300025917 | Ga0207660_10248337 | Ga0207660_102483372 | 110 |
| 112 | 3300025918 | Ga0207662_10000081 | Ga0207662_1000008114 | 110 |
| 113 | 3300025927 | Ga0207687_10000540 | Ga0207687_1000054022 | 110 |
| 114 | 3300025931 | Ga0207644_10058785 | Ga0207644_100587851 | 110 |
| 115 | 3300025934 | Ga0207686_10013213 | Ga0207686_100132134 | 110 |
| 116 | 3300025935 | Ga0207709_10003797 | Ga0207709_100037979 | 110 |
| 117 | 3300025936 | Ga0207670_10007113 | Ga0207670_100071135 | 110 |
| 118 | 3300025936 | Ga0207670_10496135 | Ga0207670_104961352 | 110 |
| 119 | 3300025938 | Ga0207704_10050142 | Ga0207704_100501424 | 110 |
| 120 | 3300025942 | Ga0207689_10000238 | Ga0207689_1000023821 | 110 |
| 121 | 3300025960 | Ga0207651_10564108 | Ga0207651_105641082 | 110 |
| 122 | 3300025981 | Ga0207640_10059013 | Ga0207640_100590135 | 110 |
| 123 | 3300026023 | Ga0207677_10006636 | Ga0207677_100066367 | 110 |
| 124 | 3300026023 | Ga0207677_10296566 | Ga0207677_102965662 | 110 |
| 125 | 3300026035 | Ga0207703_10004524 | Ga0207703_100045242 | 110 |
| 126 | 3300026035 | Ga0207703_10190894 | Ga0207703_101908942 | 110 |
| 127 | 3300026041 | Ga0207639_10015684 | Ga0207639_100156842 | 110 |
| 128 | 3300026075 | Ga0207708_10000276 | Ga0207708_1000027622 | 110 |
| 129 | 3300026078 | Ga0207702_10835270 | Ga0207702_108352702 | 110 |
| 130 | 3300026089 | Ga0207648_10005355 | Ga0207648_100053557 | 110 |
| 131 | 3300026118 | Ga0207675_100000120 | Ga0207675_10000012021 | 110 |
| 132 | 3300026142 | Ga0207698_10049343 | Ga0207698_100493434 | 110 |
| 133 | 3300027364 | Ga0209967_1004667 | Ga0209967_10046673 | 110 |
| 134 | 3300027364 | Ga0209967_1031179 | Ga0209967_10311792 | 110 |
| 135 | 3300027378 | Ga0209981_1006167 | Ga0209981_10061672 | 110 |
| 136 | 3300027378 | Ga0209981_1011592 | Ga0209981_10115922 | 110 |
| 137 | 3300027395 | Ga0209996_1012299 | Ga0209996_10122992 | 110 |
| 138 | 3300027462 | Ga0210000_1001117 | Ga0210000_10011173 | 110 |
| 139 | 3300027462 | Ga0210000_1026843 | Ga0210000_10268432 | 110 |
| 140 | 3300027526 | Ga0209968_1004771 | Ga0209968_10047712 | 110 |
| 141 | 3300027543 | Ga0209999_1030822 | Ga0209999_10308222 | 110 |
| 142 | 3300027543 | Ga0209999_1068066 | Ga0209999_10680662 | 110 |
| 143 | 3300027552 | Ga0209982_1060182 | Ga0209982_10601821 | 110 |
| 144 | 3300027665 | Ga0209983_1068722 | Ga0209983_10687222 | 110 |
| 145 | 3300027876 | Ga0209974_10006944 | Ga0209974_100069443 | 110 |
| 146 | 3300027907 | Ga0207428_10163958 | Ga0207428_101639582 | 110 |
| 147 | 3300028380 | Ga0268265_10002989 | Ga0268265_1000298914 | 110 |
| 148 | 3300028381 | Ga0268264_10005363 | Ga0268264_100053632 | 110 |
| 149 | 3300028381 | Ga0268264_10048316 | Ga0268264_100483162 | 110 |
| 150 | 3300031852 | Ga0307410_11446630 | Ga0307410_114466302 | 110 |
| 151 | 3300031901 | Ga0307406_10515969 | Ga0307406_105159692 | 110 |
| 152 | 3300032002 | Ga0307416_100131617 | Ga0307416_1001316172 | 110 |
| 153 | 3300032002 | Ga0307416_100680726 | Ga0307416_1006807262 | 110 |
| 154 | 3300032005 | Ga0307411_10089040 | Ga0307411_100890402 | 110 |
| 155 | 3300035083 | Ga0373926_0007399 | Ga0373926_0007399_668_1000 | 110 |
| 156 | 3300035083 | Ga0373926_0197660 | Ga0373926_0197660_413_745 | 110 |
| 157 | 3300035088 | Ga0373940_0081569 | Ga0373940_0081569_33_365 | 110 |
| 158 | 3300035089 | Ga0373944_0047295 | Ga0373944_0047295_636_968 | 110 |
| 159 | 3300035112 | Ga0373932_0351945 | Ga0373932_0351945_133_465 | 110 |
| 160 | 3300035113 | Ga0373936_0006678 | Ga0373936_0006678_2655_2987 | 110 |
| 161 | 3300035113 | Ga0373936_0173901 | Ga0373936_0173901_379_711 | 110 |
| 162 | 3300035116 | Ga0373945_0013405 | Ga0373945_0013405_632_964 | 110 |
| 163 | 3300035121 | Ga0373960_0030486 | Ga0373960_0030486_1086_1418 | 110 |
| 164 | 3300035170 | Ga0373943_0002540 | Ga0373943_0002540_568_900 | 110 |
| 165 | 3300035170 | Ga0373943_0023215 | Ga0373943_0023215_1902_2234 | 110 |
| 166 | 3300035171 | Ga0373946_0078003 | Ga0373946_0078003_663_995 | 110 |
| 167 | 3300035692 | Ga0373935_0007685 | Ga0373935_0007685_4209_4541 | 110 |
| 168 | 3300035692 | Ga0373935_0197554 | Ga0373935_0197554_780_1112 | 110 |
| 169 | 3300035695 | Ga0373927_0000238 | Ga0373927_0000238_3147_3479 | 110 |
| 170 | 3300035695 | Ga0373927_0141391 | Ga0373927_0141391_746_1078 | 110 |
| 171 | 3300035725 | Ga0373947_0004553 | Ga0373947_0004553_5968_6300 | 110 |
| 172 | 3300035725 | Ga0373947_0108738 | Ga0373947_0108738_755_1087 | 110 |
| 173 | 3300037068 | Ga0373925_0028100 | Ga0373925_0028100_1962_2294 | 110 |
| 174 | 3300037068 | Ga0373925_0191834 | Ga0373925_0191834_663_995 | 110 |
| 175 | 3300041408 | Ga0439453_0022869 | Ga0439453_0022869_728_1060 | 110 |
| 176 | 3300042003 | Ga0439443_009608 | Ga0439443_009608_1000_1332 | 110 |
| 177 | 3300042013 | Ga0439456_043978 | Ga0439456_043978_300_632 | 110 |
| 178 | 3300042435 | Ga0439434_0031302 | Ga0439434_0031302_809_1141 | 110 |
| 179 | 3300042436 | Ga0439435_0003425 | Ga0439435_0003425_457_789 | 110 |
| 180 | 3300042461 | Ga0439460_0023721 | Ga0439460_0023721_941_1273 | 110 |
| 181 | 3300045051 | Ga0451576_0000814 | Ga0451576_0000814_44404_44736 | 110 |
| 182 | 3300045051 | Ga0451576_0667369 | Ga0451576_0667369_611_943 | 110 |
| 183 | 3300046455 | Ga0495603_0064976 | Ga0495603_0064976_680_1012 | 110 |
| 184 | 3300046472 | Ga0495580_0000129 | Ga0495580_0000129_6051_6383 | 110 |
| 185 | 3300046475 | Ga0495639_0265725 | Ga0495639_0265725_42_374 | 110 |
| 186 | 3300046526 | Ga0495666_0009163 | Ga0495666_0009163_4460_4792 | 110 |
| 187 | 3300046535 | Ga0495586_0001200 | Ga0495586_0001200_6460_6792 | 110 |
| 188 | 3300046557 | Ga0495622_0100878 | Ga0495622_0100878_747_1079 | 110 |
| 189 | 3300046674 | Ga0495588_0032491 | Ga0495588_0032491_587_919 | 110 |
| 190 | 3300046681 | Ga0495647_0002864 | Ga0495647_0002864_425_757 | 110 |
| 191 | 3300046683 | Ga0495658_0127347 | Ga0495658_0127347_629_961 | 110 |
| 192 | 3300046690 | Ga0495624_0118544 | Ga0495624_0118544_924_1256 | 110 |
| 193 | 3300047315 | Ga0495581_0027084 | Ga0495581_0027084_1491_1823 | 110 |
| 194 | 3300047318 | Ga0495636_0006014 | Ga0495636_0006014_403_735 | 110 |
| 195 | 3300049520 | Ga0501297_050169 | Ga0501297_050169_194_526 | 110 |
| 196 | 3300049521 | Ga0501298_152254 | Ga0501298_152254_182_514 | 110 |
| 197 | 3300049522 | Ga0501299_071211 | Ga0501299_071211_221_553 | 110 |
| 198 | 3300049522 | Ga0501299_085396 | Ga0501299_085396_170_502 | 110 |
| 199 | 3300049578 | Ga0501042_0133153 | Ga0501042_0133153_336_668 | 110 |
| 200 | 3300049587 | Ga0501071_1598304 | Ga0501071_1598304_63_395 | 110 |
| 201 | 3300049588 | Ga0501072_0725910 | Ga0501072_0725910_328_660 | 110 |
| 202 | 3300049659 | Ga0501214_016652 | Ga0501214_016652_485_817 | 110 |
| 203 | 3300049666 | Ga0501228_012888 | Ga0501228_012888_510_842 | 110 |
| 204 | 3300049669 | Ga0501235_219733 | Ga0501235_219733_71_403 | 110 |
| 205 | 3300049705 | Ga0501225_0113008 | Ga0501225_0113008_23_355 | 110 |
| 206 | 3300049706 | Ga0501229_071413 | Ga0501229_071413_157_489 | 110 |
| 207 | 3300049779 | Ga0501283_015624 | Ga0501283_015624_398_730 | 110 |
| 208 | 3300050507 | nmdc:mga05p37_381285_c1 | nmdc:mga05p37_381285_c1_276_608 | 110 |
| 209 | 3300050507 | nmdc:mga05p37_940686_c1 | nmdc:mga05p37_940686_c1_83_415 | 110 |
| 210 | 3300050508 | nmdc:mga09592_316333_c1 | nmdc:mga09592_316333_c1_377_709 | 110 |
| 211 | 3300050509 | nmdc:mga0qj67_19850_c1 | nmdc:mga0qj67_19850_c1_1896_2228 | 110 |
| 212 | 3300050510 | nmdc:mga06r32_171041_c1 | nmdc:mga06r32_171041_c1_58_390 | 110 |
| 213 | 3300005295 | Ga0065707_10095642 | Ga0065707_100956425 | 111 |
| 214 | 3300005336 | Ga0070680_100048610 | Ga0070680_1000486105 | 111 |
| 215 | 3300005345 | Ga0070692_10133525 | Ga0070692_101335252 | 111 |
| 216 | 3300005440 | Ga0070705_100001756 | Ga0070705_1000017562 | 111 |
| 217 | 3300005444 | Ga0070694_100019804 | Ga0070694_1000198045 | 111 |
| 218 | 3300005545 | Ga0070695_100060007 | Ga0070695_1000600074 | 111 |
| 219 | 3300005546 | Ga0070696_100002444 | Ga0070696_10000244411 | 111 |
| 220 | 3300005546 | Ga0070696_100042788 | Ga0070696_1000427885 | 111 |
| 221 | 3300005549 | Ga0070704_100017240 | Ga0070704_1000172405 | 111 |
| 222 | 3300006844 | Ga0075428_100000615 | Ga0075428_10000061533 | 111 |
| 223 | 3300006844 | Ga0075428_100083015 | Ga0075428_1000830154 | 111 |
| 224 | 3300006844 | Ga0075428_100208444 | Ga0075428_1002084444 | 111 |
| 225 | 3300006846 | Ga0075430_100337992 | Ga0075430_1003379922 | 111 |
| 226 | 3300006846 | Ga0075430_100401392 | Ga0075430_1004013922 | 111 |
| 227 | 3300006847 | Ga0075431_100497262 | Ga0075431_1004972622 | 111 |
| 228 | 3300006847 | Ga0075431_100867239 | Ga0075431_1008672392 | 111 |
| 229 | 3300006852 | Ga0075433_11035065 | Ga0075433_110350652 | 111 |
| 230 | 3300006880 | Ga0075429_100000506 | Ga0075429_10000050611 | 111 |
| 231 | 3300006880 | Ga0075429_100226441 | Ga0075429_1002264412 | 111 |
| 232 | 3300009094 | Ga0111539_10046625 | Ga0111539_100466254 | 111 |
| 233 | 3300009094 | Ga0111539_10388342 | Ga0111539_103883423 | 111 |
| 234 | 3300009147 | Ga0114129_10000534 | Ga0114129_1000053425 | 111 |
| 235 | 3300009147 | Ga0114129_10154576 | Ga0114129_101545764 | 111 |
| 236 | 3300009176 | Ga0105242_12847243 | Ga0105242_128472431 | 111 |
| 237 | 3300012510 | Ga0157316_1014179 | Ga0157316_10141792 | 111 |
| 238 | 3300014969 | Ga0157376_11772440 | Ga0157376_117724401 | 111 |
| 239 | 3300025917 | Ga0207660_10456093 | Ga0207660_104560932 | 111 |
| 240 | 3300027907 | Ga0207428_10000758 | Ga0207428_1000075819 | 111 |
| 241 | 3300031731 | Ga0307405_11571117 | Ga0307405_115711172 | 111 |
| 242 | 3300032002 | Ga0307416_100499716 | Ga0307416_1004997162 | 111 |
| 243 | 3300033179 | Ga0307507_10228255 | Ga0307507_102282552 | 111 |
| 244 | 3300034816 | Ga0373930_0016991 | Ga0373930_0016991_651_992 | 111 |
| 245 | 3300034817 | Ga0373948_0002718 | Ga0373948_0002718_375_716 | 111 |
| 246 | 3300034820 | Ga0373959_0021659 | Ga0373959_0021659_186_527 | 111 |
| 247 | 3300034957 | Ga0373938_0015847 | Ga0373938_0015847_741_1082 | 111 |
| 248 | 3300035085 | Ga0373929_0009222 | Ga0373929_0009222_840_1181 | 111 |
| 249 | 3300035090 | Ga0373949_0014387 | Ga0373949_0014387_419_760 | 111 |
| 250 | 3300035092 | Ga0373952_0093073 | Ga0373952_0093073_298_639 | 111 |
| 251 | 3300035112 | Ga0373932_0001387 | Ga0373932_0001387_2714_3055 | 111 |
| 252 | 3300035114 | Ga0373939_0002376 | Ga0373939_0002376_121_462 | 111 |
| 253 | 3300035121 | Ga0373960_0036457 | Ga0373960_0036457_690_1031 | 111 |
| 254 | 3300035207 | Ga0373942_0007911 | Ga0373942_0007911_138_479 | 111 |
| 255 | 3300035241 | Ga0373961_0018294 | Ga0373961_0018294_228_569 | 111 |
| 256 | 3300035242 | Ga0373962_0008923 | Ga0373962_0008923_942_1283 | 111 |
| 257 | 3300035691 | Ga0373931_0000248 | Ga0373931_0000248_2131_2472 | 111 |
| 258 | 3300042001 | Ga0439441_000038 | Ga0439441_000038_1222_1557 | 111 |
| 259 | 3300042003 | Ga0439443_001039 | Ga0439443_001039_908_1243 | 111 |
| 260 | 3300042009 | Ga0439451_008889 | Ga0439451_008889_975_1310 | 111 |
| 261 | 3300042436 | Ga0439435_0000706 | Ga0439435_0000706_643_978 | 111 |
| 262 | 3300042437 | Ga0439444_0000748 | Ga0439444_0000748_1920_2255 | 111 |
| 263 | 3300042439 | Ga0439464_0077555 | Ga0439464_0077555_392_727 | 111 |
| 264 | 3300042461 | Ga0439460_0000034 | Ga0439460_0000034_14819_15154 | 111 |
| 265 | 3300044673 | Ga0453683_0460860 | Ga0453683_0460860_253_594 | 111 |
| 266 | 3300046491 | Ga0495584_0199542 | Ga0495584_0199542_274_609 | 111 |
| 267 | 3300046537 | Ga0495598_0120954 | Ga0495598_0120954_384_725 | 111 |
| 268 | 3300046664 | Ga0495659_0009046 | Ga0495659_0009046_673_1014 | 111 |
| 269 | 3300046664 | Ga0495659_0252927 | Ga0495659_0252927_165_500 | 111 |
| 270 | 3300046684 | Ga0495669_0273030 | Ga0495669_0273030_238_573 | 111 |
| 271 | 3300049575 | Ga0501039_0161926 | Ga0501039_0161926_454_795 | 111 |
| 272 | 3300049578 | Ga0501042_0891418 | Ga0501042_0891418_203_538 | 111 |
| 273 | 3300049584 | Ga0501068_0613210 | Ga0501068_0613210_217_558 | 111 |
| 274 | 3300049588 | Ga0501072_0080016 | Ga0501072_0080016_1551_1892 | 111 |
| 275 | 3300049588 | Ga0501072_0203660 | Ga0501072_0203660_1219_1560 | 111 |
| 276 | 3300049592 | Ga0501076_0806923 | Ga0501076_0806923_389_724 | 111 |
| 277 | 3300049649 | Ga0501198_083977 | Ga0501198_083977_188_523 | 111 |
| 278 | 3300049660 | Ga0501216_070548 | Ga0501216_070548_21_356 | 111 |
| 279 | 3300049743 | Ga0501081_0215408 | Ga0501081_0215408_932_1273 | 111 |
| 280 | 3300050507 | nmdc:mga05p37_233794_c1 | nmdc:mga05p37_233794_c1_410_745 | 111 |
| 281 | 3300050507 | nmdc:mga05p37_453_c1 | nmdc:mga05p37_453_c1_28369_28710 | 111 |
| 282 | 3300050508 | nmdc:mga09592_2521_c1 | nmdc:mga09592_2521_c1_1820_2161 | 111 |
| 283 | 3300050508 | nmdc:mga09592_610553_c1 | nmdc:mga09592_610553_c1_365_700 | 111 |
| 284 | 3300050510 | nmdc:mga06r32_119414_c1 | nmdc:mga06r32_119414_c1_1663_1998 | 111 |
| 285 | 3300050510 | nmdc:mga06r32_452194_c1 | nmdc:mga06r32_452194_c1_192_533 | 111 |
| 286 | 3300050511 | nmdc:mga08y16_43257_c1 | nmdc:mga08y16_43257_c1_2527_2868 | 111 |
| 287 | 3300050515 | nmdc:mga0a205_160961_c1 | nmdc:mga0a205_160961_c1_1076_1417 | 111 |
| 288 | 3300061734 | Ga0530510_0238418 | Ga0530510_0238418_903_1244 | 111 |
| 289 | 3300046531 | Ga0495665_0291869 | Ga0495665_0291869_86_430 | 112 |
| 290 | 3300003203 | JGI25406J46586_10064461 | JGI25406J46586_100644612 | 113 |
| 291 | 3300005985 | Ga0081539_10000803 | Ga0081539_1000080313 | 113 |
| 292 | 3300053119 | Ga0500595_054026 | Ga0500595_054026_58_405 | 113 |
| 293 | 3300005354 | Ga0070675_100133138 | Ga0070675_1001331381 | 114 |
| 294 | 3300005468 | Ga0070707_100998507 | Ga0070707_1009985072 | 114 |
| 295 | 3300005471 | Ga0070698_101155537 | Ga0070698_1011555371 | 114 |
| 296 | 3300005518 | Ga0070699_100029629 | Ga0070699_1000296292 | 114 |
| 297 | 3300005518 | Ga0070699_101261050 | Ga0070699_1012610501 | 114 |
| 298 | 3300006914 | Ga0075436_100010510 | Ga0075436_1000105105 | 114 |
| 299 | 3300007265 | Ga0099794_10568206 | Ga0099794_105682061 | 114 |
| 300 | 3300025926 | Ga0207659_10687151 | Ga0207659_106871512 | 114 |
| 301 | 3300031548 | Ga0307408_100899272 | Ga0307408_1008992722 | 114 |
| 302 | 3300032002 | Ga0307416_103122657 | Ga0307416_1031226571 | 114 |
| 303 | 3300045976 | Ga0466967_1162543 | Ga0466967_1162543_374_721 | 114 |
| 304 | 3300046537 | Ga0495598_0074706 | Ga0495598_0074706_42_389 | 114 |
| 305 | 3300049514 | Ga0501291_056472 | Ga0501291_056472_183_530 | 114 |
| 306 | 3300049516 | Ga0501293_010562 | Ga0501293_010562_357_704 | 114 |
| 307 | 3300049656 | Ga0501209_243591 | Ga0501209_243591_31_378 | 114 |
| 308 | 3300049668 | Ga0501233_187973 | Ga0501233_187973_28_375 | 114 |
| 309 | 3300050507 | nmdc:mga05p37_1349522_c1 | nmdc:mga05p37_1349522_c1_93_440 | 114 |
| 310 | 3300005330 | Ga0070690_101692375 | Ga0070690_1016923751 | 115 |
| 311 | 3300005331 | Ga0070670_100203174 | Ga0070670_1002031742 | 115 |
| 312 | 3300005353 | Ga0070669_100328277 | Ga0070669_1003282772 | 115 |
| 313 | 3300005437 | Ga0070710_10454976 | Ga0070710_104549762 | 115 |
| 314 | 3300005437 | Ga0070710_10621513 | Ga0070710_106215131 | 115 |
| 315 | 3300005445 | Ga0070708_100303879 | Ga0070708_1003038792 | 115 |
| 316 | 3300005468 | Ga0070707_100545657 | Ga0070707_1005456572 | 115 |
| 317 | 3300005471 | Ga0070698_100294330 | Ga0070698_1002943302 | 115 |
| 318 | 3300005471 | Ga0070698_100484920 | Ga0070698_1004849202 | 115 |
| 319 | 3300005719 | Ga0068861_100669004 | Ga0068861_1006690042 | 115 |
| 320 | 3300006038 | Ga0075365_10834265 | Ga0075365_108342652 | 115 |
| 321 | 3300006175 | Ga0070712_100690685 | Ga0070712_1006906852 | 115 |
| 322 | 3300006844 | Ga0075428_100342414 | Ga0075428_1003424142 | 115 |
| 323 | 3300006846 | Ga0075430_100101040 | Ga0075430_1001010403 | 115 |
| 324 | 3300006847 | Ga0075431_100219568 | Ga0075431_1002195682 | 115 |
| 325 | 3300006880 | Ga0075429_100234264 | Ga0075429_1002342643 | 115 |
| 326 | 3300007265 | Ga0099794_10008683 | Ga0099794_100086833 | 115 |
| 327 | 3300009147 | Ga0114129_11399935 | Ga0114129_113999351 | 115 |
| 328 | 3300009553 | Ga0105249_12931582 | Ga0105249_129315821 | 115 |
| 329 | 3300021361 | Ga0213872_10377523 | Ga0213872_103775231 | 115 |
| 330 | 3300025898 | Ga0207692_10338154 | Ga0207692_103381542 | 115 |
| 331 | 3300025915 | Ga0207693_10500713 | Ga0207693_105007132 | 115 |
| 332 | 3300025925 | Ga0207650_10634172 | Ga0207650_106341722 | 115 |
| 333 | 3300025925 | Ga0207650_11180982 | Ga0207650_111809822 | 115 |
| 334 | 3300025961 | Ga0207712_10238085 | Ga0207712_102380851 | 115 |
| 335 | 3300026088 | Ga0207641_11984541 | Ga0207641_119845412 | 115 |
| 336 | 3300026118 | Ga0207675_100468266 | Ga0207675_1004682662 | 115 |
| 337 | 3300027671 | Ga0209588_1009034 | Ga0209588_10090343 | 115 |
| 338 | 3300031903 | Ga0307407_10091013 | Ga0307407_100910132 | 115 |
| 339 | 3300032002 | Ga0307416_100810547 | Ga0307416_1008105472 | 115 |
| 340 | 3300039447 | Ga0436361_0330901 | Ga0436361_0330901_1371_1724 | 115 |
| 341 | 3300042876 | Ga0451577_1185101 | Ga0451577_1185101_194_544 | 115 |
| 342 | 3300045051 | Ga0451576_1094189 | Ga0451576_1094189_451_801 | 115 |
| 343 | 3300046514 | Ga0495618_0855944 | Ga0495618_0855944_86_439 | 115 |
| 344 | 3300048903 | Ga0496100_0902023 | Ga0496100_0902023_113_466 | 115 |
| 345 | 3300048910 | Ga0496107_1274388 | Ga0496107_1274388_42_395 | 115 |
| 346 | 3300048921 | Ga0496118_0157700 | Ga0496118_0157700_194_547 | 115 |
| 347 | 3300048922 | Ga0496119_0062434 | Ga0496119_0062434_1651_2004 | 115 |
| 348 | 3300049514 | Ga0501291_016415 | Ga0501291_016415_273_623 | 115 |
| 349 | 3300049587 | Ga0501071_0228030 | Ga0501071_0228030_789_1139 | 115 |
| 350 | 3300049588 | Ga0501072_0683277 | Ga0501072_0683277_275_625 | 115 |
| 351 | 3300049665 | Ga0501227_072439 | Ga0501227_072439_422_772 | 115 |
| 352 | 3300050508 | nmdc:mga09592_148654_c1 | nmdc:mga09592_148654_c1_56_406 | 115 |
| 353 | 3300050510 | nmdc:mga06r32_1164781_c1 | nmdc:mga06r32_1164781_c1_304_654 | 115 |
| 354 | 3300050510 | nmdc:mga06r32_229875_c1 | nmdc:mga06r32_229875_c1_1360_1710 | 115 |
| 355 | 3300050512 | nmdc:mga0n895_1496506_c1 | nmdc:mga0n895_1496506_c1_43_396 | 115 |
| 356 | 3300053093 | Ga0500651_0421426 | Ga0500651_0421426_56_409 | 115 |
| 357 | 3300053098 | Ga0500650_0166244 | Ga0500650_0166244_57_410 | 115 |
| 358 | 3300053130 | Ga0500642_0174774 | Ga0500642_0174774_87_440 | 115 |
| 359 | 3300053139 | Ga0500568_0045198 | Ga0500568_0045198_566_919 | 115 |
| 360 | 3300053158 | Ga0500627_0186692 | Ga0500627_0186692_436_789 | 115 |
| 361 | 3300001979 | JGI24740J21852_10158448 | JGI24740J21852_101584481 | 116 |
| 362 | 3300002075 | JGI24738J21930_10123452 | JGI24738J21930_101234522 | 116 |
| 363 | 3300003215 | JGI25153J46596_10000326 | JGI25153J46596_1000032621 | 116 |
| 364 | 3300003215 | JGI25153J46596_10031146 | JGI25153J46596_100311463 | 116 |
| 365 | 3300003323 | rootH1_10076163 | rootH1_100761632 | 116 |
| 366 | 3300005327 | Ga0070658_10002078 | Ga0070658_100020789 | 116 |
| 367 | 3300005327 | Ga0070658_10328272 | Ga0070658_103282722 | 116 |
| 368 | 3300005328 | Ga0070676_10062667 | Ga0070676_100626672 | 116 |
| 369 | 3300005329 | Ga0070683_100001436 | Ga0070683_10000143610 | 116 |
| 370 | 3300005331 | Ga0070670_101552672 | Ga0070670_1015526722 | 116 |
| 371 | 3300005334 | Ga0068869_100134410 | Ga0068869_1001344103 | 116 |
| 372 | 3300005334 | Ga0068869_100734395 | Ga0068869_1007343952 | 116 |
| 373 | 3300005336 | Ga0070680_100037534 | Ga0070680_1000375343 | 116 |
| 374 | 3300005338 | Ga0068868_101307054 | Ga0068868_1013070541 | 116 |
| 375 | 3300005339 | Ga0070660_100004203 | Ga0070660_1000042032 | 116 |
| 376 | 3300005339 | Ga0070660_100006164 | Ga0070660_1000061648 | 116 |
| 377 | 3300005339 | Ga0070660_100015529 | Ga0070660_1000155292 | 116 |
| 378 | 3300005339 | Ga0070660_100066787 | Ga0070660_1000667873 | 116 |
| 379 | 3300005341 | Ga0070691_10299294 | Ga0070691_102992942 | 116 |
| 380 | 3300005344 | Ga0070661_100002685 | Ga0070661_10000268510 | 116 |
| 381 | 3300005344 | Ga0070661_100005262 | Ga0070661_1000052622 | 116 |
| 382 | 3300005344 | Ga0070661_100127394 | Ga0070661_1001273942 | 116 |
| 383 | 3300005344 | Ga0070661_100468553 | Ga0070661_1004685531 | 116 |
| 384 | 3300005345 | Ga0070692_10343719 | Ga0070692_103437192 | 116 |
| 385 | 3300005347 | Ga0070668_100424206 | Ga0070668_1004242061 | 116 |
| 386 | 3300005353 | Ga0070669_100796148 | Ga0070669_1007961482 | 116 |
| 387 | 3300005354 | Ga0070675_100070101 | Ga0070675_1000701014 | 116 |
| 388 | 3300005355 | Ga0070671_100028448 | Ga0070671_1000284482 | 116 |
| 389 | 3300005364 | Ga0070673_100032966 | Ga0070673_1000329662 | 116 |
| 390 | 3300005366 | Ga0070659_100001376 | Ga0070659_10000137610 | 116 |
| 391 | 3300005366 | Ga0070659_100007839 | Ga0070659_1000078398 | 116 |
| 392 | 3300005366 | Ga0070659_100093581 | Ga0070659_1000935812 | 116 |
| 393 | 3300005366 | Ga0070659_100355407 | Ga0070659_1003554071 | 116 |
| 394 | 3300005434 | Ga0070709_10002761 | Ga0070709_100027617 | 116 |
| 395 | 3300005434 | Ga0070709_10183793 | Ga0070709_101837932 | 116 |
| 396 | 3300005435 | Ga0070714_100003230 | Ga0070714_10000323010 | 116 |
| 397 | 3300005435 | Ga0070714_100008916 | Ga0070714_1000089165 | 116 |
| 398 | 3300005436 | Ga0070713_100000399 | Ga0070713_10000039920 | 116 |
| 399 | 3300005436 | Ga0070713_100104933 | Ga0070713_1001049332 | 116 |
| 400 | 3300005437 | Ga0070710_10009602 | Ga0070710_100096022 | 116 |
| 401 | 3300005439 | Ga0070711_100006108 | Ga0070711_1000061084 | 116 |
| 402 | 3300005439 | Ga0070711_100258782 | Ga0070711_1002587822 | 116 |
| 403 | 3300005440 | Ga0070705_100995563 | Ga0070705_1009955631 | 116 |
| 404 | 3300005455 | Ga0070663_100007228 | Ga0070663_1000072284 | 116 |
| 405 | 3300005456 | Ga0070678_100034110 | Ga0070678_1000341104 | 116 |
| 406 | 3300005457 | Ga0070662_100008096 | Ga0070662_1000080962 | 116 |
| 407 | 3300005458 | Ga0070681_10082306 | Ga0070681_100823062 | 116 |
| 408 | 3300005458 | Ga0070681_10702541 | Ga0070681_107025412 | 116 |
| 409 | 3300005467 | Ga0070706_101108506 | Ga0070706_1011085062 | 116 |
| 410 | 3300005471 | Ga0070698_100113777 | Ga0070698_1001137772 | 116 |
| 411 | 3300005518 | Ga0070699_100006127 | Ga0070699_10000612711 | 116 |
| 412 | 3300005518 | Ga0070699_100040010 | Ga0070699_1000400105 | 116 |
| 413 | 3300005518 | Ga0070699_100046239 | Ga0070699_1000462394 | 116 |
| 414 | 3300005530 | Ga0070679_100005870 | Ga0070679_1000058709 | 116 |
| 415 | 3300005535 | Ga0070684_100008755 | Ga0070684_1000087558 | 116 |
| 416 | 3300005536 | Ga0070697_100117509 | Ga0070697_1001175092 | 116 |
| 417 | 3300005539 | Ga0068853_100001556 | Ga0068853_10000155614 | 116 |
| 418 | 3300005539 | Ga0068853_100002165 | Ga0068853_1000021658 | 116 |
| 419 | 3300005539 | Ga0068853_100380533 | Ga0068853_1003805332 | 116 |
| 420 | 3300005543 | Ga0070672_100365488 | Ga0070672_1003654881 | 116 |
| 421 | 3300005548 | Ga0070665_100557841 | Ga0070665_1005578411 | 116 |
| 422 | 3300005563 | Ga0068855_100000832 | Ga0068855_10000083235 | 116 |
| 423 | 3300005563 | Ga0068855_100484402 | Ga0068855_1004844022 | 116 |
| 424 | 3300005564 | Ga0070664_100013427 | Ga0070664_1000134274 | 116 |
| 425 | 3300005564 | Ga0070664_100080265 | Ga0070664_1000802652 | 116 |
| 426 | 3300005577 | Ga0068857_100005743 | Ga0068857_1000057437 | 116 |
| 427 | 3300005578 | Ga0068854_100006194 | Ga0068854_1000061945 | 116 |
| 428 | 3300005614 | Ga0068856_100000679 | Ga0068856_10000067915 | 116 |
| 429 | 3300005614 | Ga0068856_100012570 | Ga0068856_1000125703 | 116 |
| 430 | 3300005616 | Ga0068852_100002542 | Ga0068852_1000025429 | 116 |
| 431 | 3300005616 | Ga0068852_100172372 | Ga0068852_1001723722 | 116 |
| 432 | 3300005718 | Ga0068866_10295210 | Ga0068866_102952101 | 116 |
| 433 | 3300005834 | Ga0068851_10000367 | Ga0068851_1000036711 | 116 |
| 434 | 3300005937 | Ga0081455_10210009 | Ga0081455_102100092 | 116 |
| 435 | 3300006028 | Ga0070717_10009273 | Ga0070717_100092735 | 116 |
| 436 | 3300006028 | Ga0070717_10223331 | Ga0070717_102233312 | 116 |
| 437 | 3300006028 | Ga0070717_10531729 | Ga0070717_105317292 | 116 |
| 438 | 3300006038 | Ga0075365_10027914 | Ga0075365_100279142 | 116 |
| 439 | 3300006042 | Ga0075368_10043143 | Ga0075368_100431432 | 116 |
| 440 | 3300006048 | Ga0075363_100025133 | Ga0075363_1000251332 | 116 |
| 441 | 3300006051 | Ga0075364_10086396 | Ga0075364_100863962 | 116 |
| 442 | 3300006163 | Ga0070715_10001341 | Ga0070715_100013417 | 116 |
| 443 | 3300006175 | Ga0070712_100177005 | Ga0070712_1001770052 | 116 |
| 444 | 3300006175 | Ga0070712_100418950 | Ga0070712_1004189502 | 116 |
| 445 | 3300006177 | Ga0075362_10253044 | Ga0075362_102530442 | 116 |
| 446 | 3300006177 | Ga0075362_10319652 | Ga0075362_103196522 | 116 |
| 447 | 3300006178 | Ga0075367_10097879 | Ga0075367_100978792 | 116 |
| 448 | 3300006178 | Ga0075367_10111996 | Ga0075367_101119962 | 116 |
| 449 | 3300006195 | Ga0075366_10096506 | Ga0075366_100965062 | 116 |
| 450 | 3300006195 | Ga0075366_10325502 | Ga0075366_103255022 | 116 |
| 451 | 3300006353 | Ga0075370_10136465 | Ga0075370_101364652 | 116 |
| 452 | 3300006844 | Ga0075428_102523842 | Ga0075428_1025238422 | 116 |
| 453 | 3300006847 | Ga0075431_100481334 | Ga0075431_1004813342 | 116 |
| 454 | 3300006852 | Ga0075433_10221170 | Ga0075433_102211701 | 116 |
| 455 | 3300006871 | Ga0075434_100499273 | Ga0075434_1004992732 | 116 |
| 456 | 3300009092 | Ga0105250_10622271 | Ga0105250_106222712 | 116 |
| 457 | 3300009093 | Ga0105240_10012947 | Ga0105240_100129476 | 116 |
| 458 | 3300009093 | Ga0105240_10069698 | Ga0105240_100696984 | 116 |
| 459 | 3300009094 | Ga0111539_11298927 | Ga0111539_112989271 | 116 |
| 460 | 3300009094 | Ga0111539_12222517 | Ga0111539_122225171 | 116 |
| 461 | 3300009147 | Ga0114129_10213431 | Ga0114129_102134312 | 116 |
| 462 | 3300009147 | Ga0114129_10295662 | Ga0114129_102956622 | 116 |
| 463 | 3300009147 | Ga0114129_12577334 | Ga0114129_125773341 | 116 |
| 464 | 3300009174 | Ga0105241_10120966 | Ga0105241_101209661 | 116 |
| 465 | 3300009545 | Ga0105237_10111265 | Ga0105237_101112653 | 116 |
| 466 | 3300009551 | Ga0105238_10001480 | Ga0105238_1000148011 | 116 |
| 467 | 3300010159 | Ga0099796_10300680 | Ga0099796_103006801 | 116 |
| 468 | 3300011119 | Ga0105246_10940927 | Ga0105246_109409271 | 116 |
| 469 | 3300013100 | Ga0157373_10003033 | Ga0157373_1000303310 | 116 |
| 470 | 3300013100 | Ga0157373_10005270 | Ga0157373_100052704 | 116 |
| 471 | 3300013102 | Ga0157371_10000273 | Ga0157371_1000027351 | 116 |
| 472 | 3300013102 | Ga0157371_10034452 | Ga0157371_100344522 | 116 |
| 473 | 3300013102 | Ga0157371_10505573 | Ga0157371_105055732 | 116 |
| 474 | 3300013104 | Ga0157370_10004474 | Ga0157370_1000447415 | 116 |
| 475 | 3300013104 | Ga0157370_10007899 | Ga0157370_100078994 | 116 |
| 476 | 3300013104 | Ga0157370_10020330 | Ga0157370_100203306 | 116 |
| 477 | 3300013104 | Ga0157370_10050276 | Ga0157370_100502762 | 116 |
| 478 | 3300013104 | Ga0157370_10395943 | Ga0157370_103959432 | 116 |
| 479 | 3300013105 | Ga0157369_10014597 | Ga0157369_100145972 | 116 |
| 480 | 3300013105 | Ga0157369_10282973 | Ga0157369_102829732 | 116 |
| 481 | 3300013105 | Ga0157369_10444709 | Ga0157369_104447092 | 116 |
| 482 | 3300013105 | Ga0157369_10448430 | Ga0157369_104484302 | 116 |
| 483 | 3300013297 | Ga0157378_12828762 | Ga0157378_128287621 | 116 |
| 484 | 3300013307 | Ga0157372_10031649 | Ga0157372_100316492 | 116 |
| 485 | 3300013307 | Ga0157372_10036492 | Ga0157372_100364925 | 116 |
| 486 | 3300013307 | Ga0157372_10257205 | Ga0157372_102572052 | 116 |
| 487 | 3300013307 | Ga0157372_11782347 | Ga0157372_117823472 | 116 |
| 488 | 3300014497 | Ga0182008_10031251 | Ga0182008_100312512 | 116 |
| 489 | 3300014969 | Ga0157376_10943628 | Ga0157376_109436282 | 116 |
| 490 | 3300020069 | Ga0197907_11214187 | Ga0197907_112141872 | 116 |
| 491 | 3300020081 | Ga0206354_10304488 | Ga0206354_103044882 | 116 |
| 492 | 3300020082 | Ga0206353_10254265 | Ga0206353_102542652 | 116 |
| 493 | 3300025297 | Ga0209758_1000267 | Ga0209758_100026786 | 116 |
| 494 | 3300025297 | Ga0209758_1002898 | Ga0209758_100289816 | 116 |
| 495 | 3300025297 | Ga0209758_1018476 | Ga0209758_10184765 | 116 |
| 496 | 3300025321 | Ga0207656_10004688 | Ga0207656_100046884 | 116 |
| 497 | 3300025898 | Ga0207692_10003963 | Ga0207692_100039634 | 116 |
| 498 | 3300025899 | Ga0207642_10554649 | Ga0207642_105546491 | 116 |
| 499 | 3300025905 | Ga0207685_10005558 | Ga0207685_100055581 | 116 |
| 500 | 3300025906 | Ga0207699_10039510 | Ga0207699_100395102 | 116 |
| 501 | 3300025906 | Ga0207699_10243798 | Ga0207699_102437982 | 116 |
| 502 | 3300025906 | Ga0207699_11112258 | Ga0207699_111122581 | 116 |
| 503 | 3300025907 | Ga0207645_10014464 | Ga0207645_100144644 | 116 |
| 504 | 3300025909 | Ga0207705_10004340 | Ga0207705_100043407 | 116 |
| 505 | 3300025910 | Ga0207684_10010039 | Ga0207684_100100396 | 116 |
| 506 | 3300025910 | Ga0207684_10627603 | Ga0207684_106276032 | 116 |
| 507 | 3300025910 | Ga0207684_11351376 | Ga0207684_113513762 | 116 |
| 508 | 3300025912 | Ga0207707_10001205 | Ga0207707_1000120510 | 116 |
| 509 | 3300025913 | Ga0207695_10004595 | Ga0207695_100045955 | 116 |
| 510 | 3300025913 | Ga0207695_10103624 | Ga0207695_101036242 | 116 |
| 511 | 3300025914 | Ga0207671_10170896 | Ga0207671_101708962 | 116 |
| 512 | 3300025915 | Ga0207693_10037062 | Ga0207693_100370622 | 116 |
| 513 | 3300025915 | Ga0207693_10729495 | Ga0207693_107294952 | 116 |
| 514 | 3300025916 | Ga0207663_10027809 | Ga0207663_100278092 | 116 |
| 515 | 3300025916 | Ga0207663_10209846 | Ga0207663_102098462 | 116 |
| 516 | 3300025917 | Ga0207660_10001740 | Ga0207660_100017406 | 116 |
| 517 | 3300025917 | Ga0207660_10264678 | Ga0207660_102646782 | 116 |
| 518 | 3300025917 | Ga0207660_10351805 | Ga0207660_103518052 | 116 |
| 519 | 3300025919 | Ga0207657_10000151 | Ga0207657_1000015133 | 116 |
| 520 | 3300025919 | Ga0207657_10000751 | Ga0207657_100007513 | 116 |
| 521 | 3300025919 | Ga0207657_10003042 | Ga0207657_100030427 | 116 |
| 522 | 3300025920 | Ga0207649_10000967 | Ga0207649_1000096710 | 116 |
| 523 | 3300025920 | Ga0207649_10109528 | Ga0207649_101095282 | 116 |
| 524 | 3300025920 | Ga0207649_10179429 | Ga0207649_101794292 | 116 |
| 525 | 3300025921 | Ga0207652_10003455 | Ga0207652_100034554 | 116 |
| 526 | 3300025924 | Ga0207694_10001041 | Ga0207694_1000104114 | 116 |
| 527 | 3300025925 | Ga0207650_11139120 | Ga0207650_111391201 | 116 |
| 528 | 3300025928 | Ga0207700_10002081 | Ga0207700_1000208111 | 116 |
| 529 | 3300025928 | Ga0207700_10131462 | Ga0207700_101314622 | 116 |
| 530 | 3300025929 | Ga0207664_10001164 | Ga0207664_100011649 | 116 |
| 531 | 3300025929 | Ga0207664_10016398 | Ga0207664_100163984 | 116 |
| 532 | 3300025931 | Ga0207644_10019099 | Ga0207644_100190994 | 116 |
| 533 | 3300025932 | Ga0207690_10003450 | Ga0207690_100034503 | 116 |
| 534 | 3300025932 | Ga0207690_10131510 | Ga0207690_101315103 | 116 |
| 535 | 3300025932 | Ga0207690_10134615 | Ga0207690_101346152 | 116 |
| 536 | 3300025933 | Ga0207706_10001691 | Ga0207706_1000169117 | 116 |
| 537 | 3300025933 | Ga0207706_10478907 | Ga0207706_104789072 | 116 |
| 538 | 3300025938 | Ga0207704_10946845 | Ga0207704_109468452 | 116 |
| 539 | 3300025939 | Ga0207665_10063563 | Ga0207665_100635632 | 116 |
| 540 | 3300025940 | Ga0207691_10075261 | Ga0207691_100752612 | 116 |
| 541 | 3300025942 | Ga0207689_10368883 | Ga0207689_103688833 | 116 |
| 542 | 3300025944 | Ga0207661_10010838 | Ga0207661_100108388 | 116 |
| 543 | 3300025945 | Ga0207679_10010286 | Ga0207679_100102866 | 116 |
| 544 | 3300025945 | Ga0207679_10010391 | Ga0207679_100103913 | 116 |
| 545 | 3300025945 | Ga0207679_10053817 | Ga0207679_100538172 | 116 |
| 546 | 3300025949 | Ga0207667_10000460 | Ga0207667_1000046042 | 116 |
| 547 | 3300025949 | Ga0207667_10035932 | Ga0207667_100359322 | 116 |
| 548 | 3300025949 | Ga0207667_10042563 | Ga0207667_100425635 | 116 |
| 549 | 3300025960 | Ga0207651_10022708 | Ga0207651_100227082 | 116 |
| 550 | 3300025981 | Ga0207640_10002366 | Ga0207640_100023669 | 116 |
| 551 | 3300025981 | Ga0207640_10890466 | Ga0207640_108904662 | 116 |
| 552 | 3300025986 | Ga0207658_10049976 | Ga0207658_100499761 | 116 |
| 553 | 3300026023 | Ga0207677_12084391 | Ga0207677_120843911 | 116 |
| 554 | 3300026041 | Ga0207639_10001340 | Ga0207639_100013407 | 116 |
| 555 | 3300026041 | Ga0207639_10040346 | Ga0207639_100403462 | 116 |
| 556 | 3300026041 | Ga0207639_10856860 | Ga0207639_108568602 | 116 |
| 557 | 3300026067 | Ga0207678_10003830 | Ga0207678_100038302 | 116 |
| 558 | 3300026067 | Ga0207678_10025800 | Ga0207678_100258002 | 116 |
| 559 | 3300026078 | Ga0207702_10003088 | Ga0207702_1000308815 | 116 |
| 560 | 3300026078 | Ga0207702_10028377 | Ga0207702_100283772 | 116 |
| 561 | 3300026089 | Ga0207648_10452984 | Ga0207648_104529842 | 116 |
| 562 | 3300026095 | Ga0207676_11128752 | Ga0207676_111287521 | 116 |
| 563 | 3300026116 | Ga0207674_10000248 | Ga0207674_1000024811 | 116 |
| 564 | 3300026142 | Ga0207698_10000475 | Ga0207698_1000047517 | 116 |
| 565 | 3300026142 | Ga0207698_10002920 | Ga0207698_100029206 | 116 |
| 566 | 3300026142 | Ga0207698_10088122 | Ga0207698_100881222 | 116 |
| 567 | 3300027378 | Ga0209981_1014001 | Ga0209981_10140011 | 116 |
| 568 | 3300027395 | Ga0209996_1024199 | Ga0209996_10241992 | 116 |
| 569 | 3300027462 | Ga0210000_1035697 | Ga0210000_10356972 | 116 |
| 570 | 3300027543 | Ga0209999_1014765 | Ga0209999_10147652 | 116 |
| 571 | 3300027617 | Ga0210002_1062964 | Ga0210002_10629642 | 116 |
| 572 | 3300027665 | Ga0209983_1001705 | Ga0209983_10017053 | 116 |
| 573 | 3300027682 | Ga0209971_1014026 | Ga0209971_10140263 | 116 |
| 574 | 3300027876 | Ga0209974_10001930 | Ga0209974_100019304 | 116 |
| 575 | 3300028379 | Ga0268266_10878761 | Ga0268266_108787611 | 116 |
| 576 | 3300028381 | Ga0268264_10444908 | Ga0268264_104449082 | 116 |
| 577 | 3300028800 | Ga0265338_10395628 | Ga0265338_103956281 | 116 |
| 578 | 3300028800 | Ga0265338_10949630 | Ga0265338_109496302 | 116 |
| 579 | 3300030521 | Ga0307511_10000001 | Ga0307511_1000000165 | 116 |
| 580 | 3300031247 | Ga0265340_10263704 | Ga0265340_102637042 | 116 |
| 581 | 3300031251 | Ga0265327_10041581 | Ga0265327_100415812 | 116 |
| 582 | 3300031616 | Ga0307508_10212658 | Ga0307508_102126582 | 116 |
| 583 | 3300031616 | Ga0307508_10676021 | Ga0307508_106760212 | 116 |
| 584 | 3300031730 | Ga0307516_10242509 | Ga0307516_102425092 | 116 |
| 585 | 3300031731 | Ga0307405_10176508 | Ga0307405_101765082 | 116 |
| 586 | 3300031824 | Ga0307413_10006689 | Ga0307413_100066893 | 116 |
| 587 | 3300031852 | Ga0307410_10091464 | Ga0307410_100914642 | 116 |
| 588 | 3300031901 | Ga0307406_10136962 | Ga0307406_101369623 | 116 |
| 589 | 3300032002 | Ga0307416_100822242 | Ga0307416_1008222422 | 116 |
| 590 | 3300032004 | Ga0307414_10709444 | Ga0307414_107094442 | 116 |
| 591 | 3300032005 | Ga0307411_10001330 | Ga0307411_100013303 | 116 |
| 592 | 3300032126 | Ga0307415_100085261 | Ga0307415_1000852612 | 116 |
| 593 | 3300033180 | Ga0307510_10156035 | Ga0307510_101560352 | 116 |
| 594 | 3300035113 | Ga0373936_0094679 | Ga0373936_0094679_424_780 | 116 |
| 595 | 3300037312 | Ga0395899_0229336 | Ga0395899_0229336_677_1027 | 116 |
| 596 | 3300037418 | Ga0395900_0082980 | Ga0395900_0082980_972_1322 | 116 |
| 597 | 3300037466 | Ga0395898_1052577 | Ga0395898_1052577_45_395 | 116 |
| 598 | 3300037471 | Ga0395905_0074000 | Ga0395905_0074000_1371_1721 | 116 |
| 599 | 3300038443 | Ga0395901_0187834 | Ga0395901_0187834_340_690 | 116 |
| 600 | 3300044694 | Ga0466963_0648945 | Ga0466963_0648945_377_727 | 116 |
| 601 | 3300045051 | Ga0451576_0515557 | Ga0451576_0515557_274_624 | 116 |
| 602 | 3300046543 | Ga0495645_0290404 | Ga0495645_0290404_569_925 | 116 |
| 603 | 3300047317 | Ga0495604_0946898 | Ga0495604_0946898_157_513 | 116 |
| 604 | 3300048903 | Ga0496100_0201405 | Ga0496100_0201405_443_799 | 116 |
| 605 | 3300048903 | Ga0496100_1065610 | Ga0496100_1065610_229_585 | 116 |
| 606 | 3300048904 | Ga0496101_0204305 | Ga0496101_0204305_273_623 | 116 |
| 607 | 3300048905 | Ga0496102_1422187 | Ga0496102_1422187_57_407 | 116 |
| 608 | 3300048906 | Ga0496103_0122691 | Ga0496103_0122691_484_834 | 116 |
| 609 | 3300048907 | Ga0496104_0014252 | Ga0496104_0014252_4990_5346 | 116 |
| 610 | 3300048907 | Ga0496104_0045650 | Ga0496104_0045650_1748_2104 | 116 |
| 611 | 3300048907 | Ga0496104_0595475 | Ga0496104_0595475_491_847 | 116 |
| 612 | 3300048908 | Ga0496105_0074052 | Ga0496105_0074052_363_719 | 116 |
| 613 | 3300048909 | Ga0496106_0008137 | Ga0496106_0008137_3356_3706 | 116 |
| 614 | 3300048909 | Ga0496106_0170702 | Ga0496106_0170702_298_654 | 116 |
| 615 | 3300048909 | Ga0496106_0543484 | Ga0496106_0543484_200_556 | 116 |
| 616 | 3300048910 | Ga0496107_0054257 | Ga0496107_0054257_76_426 | 116 |
| 617 | 3300048911 | Ga0496108_1750898 | Ga0496108_1750898_89_445 | 116 |
| 618 | 3300048912 | Ga0496109_0050662 | Ga0496109_0050662_611_967 | 116 |
| 619 | 3300048913 | Ga0496110_0073828 | Ga0496110_0073828_322_678 | 116 |
| 620 | 3300048913 | Ga0496110_0688929 | Ga0496110_0688929_124_480 | 116 |
| 621 | 3300048916 | Ga0496113_0846665 | Ga0496113_0846665_39_395 | 116 |
| 622 | 3300048917 | Ga0496114_0154005 | Ga0496114_0154005_465_821 | 116 |
| 623 | 3300048917 | Ga0496114_0375646 | Ga0496114_0375646_883_1239 | 116 |
| 624 | 3300048918 | Ga0496115_0058786 | Ga0496115_0058786_1159_1515 | 116 |
| 625 | 3300048918 | Ga0496115_0986921 | Ga0496115_0986921_272_625 | 116 |
| 626 | 3300050489 | nmdc:mga03683_245660_c1 | nmdc:mga03683_245660_c1_288_644 | 116 |
| 627 | 3300050490 | nmdc:mga03n38_552297_c1 | nmdc:mga03n38_552297_c1_75_431 | 116 |
| 628 | 3300050491 | nmdc:mga00v17_327952_c1 | nmdc:mga00v17_327952_c1_83_439 | 116 |
| 629 | 3300050491 | nmdc:mga00v17_621869_c1 | nmdc:mga00v17_621869_c1_201_557 | 116 |
| 630 | 3300050491 | nmdc:mga00v17_77928_c1 | nmdc:mga00v17_77928_c1_1544_1900 | 116 |
| 631 | 3300050492 | nmdc:mga0yw44_22437_c1 | nmdc:mga0yw44_22437_c1_782_1138 | 116 |
| 632 | 3300050492 | nmdc:mga0yw44_449181_c1 | nmdc:mga0yw44_449181_c1_379_735 | 116 |
| 633 | 3300050493 | nmdc:mga0k408_65206_c1 | nmdc:mga0k408_65206_c1_147_503 | 116 |
| 634 | 3300050494 | nmdc:mga06z11_39682_c1 | nmdc:mga06z11_39682_c1_935_1291 | 116 |
| 635 | 3300050495 | nmdc:mga04h51_124786_c1 | nmdc:mga04h51_124786_c1_51_407 | 116 |
| 636 | 3300050496 | nmdc:mga07m45_139518_c1 | nmdc:mga07m45_139518_c1_893_1249 | 116 |
| 637 | 3300050496 | nmdc:mga07m45_35974_c2 | nmdc:mga07m45_35974_c2_171_527 | 116 |
| 638 | 3300050507 | nmdc:mga05p37_2242280_c1 | nmdc:mga05p37_2242280_c1_56_412 | 116 |
| 639 | 3300050507 | nmdc:mga05p37_688374_c1 | nmdc:mga05p37_688374_c1_627_983 | 116 |
| 640 | 3300050511 | nmdc:mga08y16_1018957_c1 | nmdc:mga08y16_1018957_c1_404_760 | 116 |
| 641 | 3300050512 | nmdc:mga0n895_396549_c1 | nmdc:mga0n895_396549_c1_395_751 | 116 |
| 642 | 3300050513 | nmdc:mga0rr50_624195_c1 | nmdc:mga0rr50_624195_c1_248_604 | 116 |
| 643 | 3300050515 | nmdc:mga0a205_255009_c1 | nmdc:mga0a205_255009_c1_242_598 | 116 |
| 644 | 3300050516 | nmdc:mga0sz30_378100_c1 | nmdc:mga0sz30_378100_c1_13_369 | 116 |
| 645 | 3300050516 | nmdc:mga0sz30_81081_c1 | nmdc:mga0sz30_81081_c1_892_1248 | 116 |
| 646 | 3300053087 | Ga0500643_003071 | Ga0500643_003071_4283_4639 | 116 |
| 647 | 3300053088 | Ga0500644_0313433 | Ga0500644_0313433_177_533 | 116 |
| 648 | 3300053090 | Ga0500646_0000184 | Ga0500646_0000184_12898_13254 | 116 |
| 649 | 3300053092 | Ga0500583_0005384 | Ga0500583_0005384_2771_3136 | 116 |
| 650 | 3300053092 | Ga0500583_0124688 | Ga0500583_0124688_347_703 | 116 |
| 651 | 3300053096 | Ga0500641_0004864 | Ga0500641_0004864_1217_1573 | 116 |
| 652 | 3300053096 | Ga0500641_0249765 | Ga0500641_0249765_115_471 | 116 |
| 653 | 3300053098 | Ga0500650_0036589 | Ga0500650_0036589_1206_1562 | 116 |
| 654 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_293668_294024 | 116 |
| 655 | 3300053119 | Ga0500595_002937 | Ga0500595_002937_7028_7384 | 116 |
| 656 | 3300053130 | Ga0500642_0085297 | Ga0500642_0085297_151_507 | 116 |
| 657 | 3300053133 | Ga0500655_000967 | Ga0500655_000967_1322_1678 | 116 |
| 658 | 3300053139 | Ga0500568_0050545 | Ga0500568_0050545_358_714 | 116 |
| 659 | 3300053146 | Ga0500588_0221381 | Ga0500588_0221381_115_471 | 116 |
| 660 | 3300053151 | Ga0500604_0000501 | Ga0500604_0000501_8648_9004 | 116 |
| 661 | 3300053178 | Ga0500637_0108147 | Ga0500637_0108147_470_826 | 116 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q14-assembly1.cif.gz_B | crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis | 0.9353 | 1 | 115 |
| 4q14-assembly1.cif.gz_B | crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis | 0.92 | 1 | 115 |
| 5z5m-assembly1.cif.gz_A | crystal structure of (s)-allantoin synthase | 0.9184 | 3 | 115 |
| 5z5m-assembly1.cif.gz_B | crystal structure of (s)-allantoin synthase | 0.9178 | 2 | 115 |
| 5z5m-assembly1.cif.gz_D | crystal structure of (s)-allantoin synthase | 0.9161 | 3 | 115 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4q14B00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9355 | 1 | 115 | 2.60.40.180 |
| 4q14B00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9201 | 1 | 115 | 2.60.40.180 |
| af_Q54LD6_18_133_2.60.40.180 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9127 | 2 | 113 | 2.60.40.180 |
| 2gpzC00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.9075 | 3 | 115 | 2.60.40.180 |
| 2h0jA00 | Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain | 0.8945 | 3 | 115 | 2.60.40.180 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537VFG0-F1-model_v4 | Hydroxyisourate hydrolase | 0.9756 | 1 | 116 |
GO:0006144
GO:0016787 |
| AF-A0A537VFG0-F1-model_v4 | Hydroxyisourate hydrolase | 0.9674 | 1 | 116 |
GO:0006144
GO:0016787 |
| AF-A0A3N5ESK0-F1-model_v4 | Hydroxyisourate hydrolase | 0.961 | 1 | 115 |
GO:0006144
GO:0016787 |
| AF-A0A4Q3HJ11-F1-model_v4 | 5-hydroxyisourate hydrolase | 0.957 | 54 | 115 |
GO:0006144
GO:0016787 |
| AF-A0A520N693-F1-model_v4 | 5-hydroxyisourate hydrolase | 0.9567 | 52 | 115 |
GO:0006144
GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar