F473407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 661 | 349 | 652 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300015262|Ga0182007_10039500|Ga0182007_100395002 |
| Length | 246 |
| Sequence | MQPALPVGVDIVHGRSSHGRSPRKVTRMTLELYAHPFSSYCQKVLTALYENDTPFEQRMLAPDDAKTAEEFETLWPLKRMPLLRDGKRTVVESSIIIEYLDLHYPGPVRLIPTDPGAALEVRLLDRVFDNYVQTPMQKIVTDRLRAEADRDGFGVTEARRMLDTAYAWLDQQLAGHRWAAGDAFSLADCAAAPALFYADWAHPIPSSHANVTAYRQRLLARPSFARAVDEARPYRSYFPLGAPDRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 3 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 4 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 5 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 6 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 7 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 8 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 9 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 182 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 183 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 184 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 193 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 207 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 210 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 211 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 212 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 213 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 218 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 219 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 220 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 221 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 222 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 223 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 226 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 227 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 228 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 229 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 230 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 231 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 232 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 233 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 234 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 235 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 294 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 295 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 296 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 299 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 300 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 301 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 302 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 303 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 312 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 313 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 314 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 318 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 328 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 329 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 330 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 331 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 332 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 333 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 334 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 335 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 337 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 339 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 340 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 341 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 342 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 343 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 344 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 345 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 346 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 347 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 348 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 349 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 0.3 |
| Isolates | 1.36 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.75 |
| Nodule | 0.15 |
| Rhizoplane | 5.9 |
| Rhizosphere | 78.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_214473 | 2162886007 | Bacteria | 13078 |
| 2 | SwRhRL2b_contig_70411 | 2162886007 | Bacteria | 3514 |
| 3 | JGI24751J29686_10000554 | 3300002459 | Bacteria | 10257 |
| 4 | JGI25151J46595_10000056 | 3300003187 | Bacteria | 151555 |
| 5 | rootH2_10161428 | 3300003320 | Bacteria | 1056 |
| 6 | rootH1_10022069 | 3300003323 | Bacteria | 4380 |
| 7 | Ga0055526_1000435 | 3300003771 | Bacteria | 33537 |
| 8 | Ga0055524_1000100 | 3300003775 | Bacteria | 107020 |
| 9 | Ga0055534_1021645 | 3300003784 | Bacteria | 1073 |
| 10 | Ga0065704_10070942 | 3300005289 | Bacteria | 14366 |
| 11 | Ga0065704_10082231 | 3300005289 | Bacteria | 3633 |
| 12 | Ga0065704_10082305 | 3300005289 | Bacteria | 3622 |
| 13 | Ga0065712_10142843 | 3300005290 | Bacteria | 1424 |
| 14 | Ga0065715_10318238 | 3300005293 | Bacteria | 1007 |
| 15 | Ga0070658_10478062 | 3300005327 | Bacteria | 1075 |
| 16 | Ga0070683_100284833 | 3300005329 | Bacteria | 1572 |
| 17 | Ga0070690_100012391 | 3300005330 | Bacteria | 5019 |
| 18 | Ga0070690_100026583 | 3300005330 | Bacteria | 3571 |
| 19 | Ga0070690_100440401 | 3300005330 | Bacteria | 964 |
| 20 | Ga0070670_100000395 | 3300005331 | Bacteria | 35994 |
| 21 | Ga0070670_100064289 | 3300005331 | Bacteria | 3148 |
| 22 | Ga0070670_100119593 | 3300005331 | Bacteria | 2272 |
| 23 | Ga0070670_100136046 | 3300005331 | Bacteria | 2123 |
| 24 | Ga0070670_100256591 | 3300005331 | Bacteria | 1523 |
| 25 | Ga0070670_100351860 | 3300005331 | Bacteria | 1294 |
| 26 | Ga0070670_100401105 | 3300005331 | Bacteria | 1211 |
| 27 | Ga0070670_100560945 | 3300005331 | Bacteria | 1019 |
| 28 | Ga0070677_10000296 | 3300005333 | Bacteria | 17488 |
| 29 | Ga0068869_100388793 | 3300005334 | Bacteria | 1145 |
| 30 | Ga0068869_100480851 | 3300005334 | Bacteria | 1034 |
| 31 | Ga0070666_10095113 | 3300005335 | Bacteria | 2050 |
| 32 | Ga0070666_10422377 | 3300005335 | Bacteria | 960 |
| 33 | Ga0068868_100122406 | 3300005338 | Bacteria | 2123 |
| 34 | Ga0070660_100139733 | 3300005339 | Bacteria | 1943 |
| 35 | Ga0070689_100060997 | 3300005340 | Bacteria | 2933 |
| 36 | Ga0070692_10006718 | 3300005345 | Bacteria | 5014 |
| 37 | Ga0070668_100008709 | 3300005347 | Bacteria | 7535 |
| 38 | Ga0070668_100113440 | 3300005347 | Bacteria | 2159 |
| 39 | Ga0070668_100274993 | 3300005347 | Bacteria | 1405 |
| 40 | Ga0070669_100000062 | 3300005353 | Bacteria | 107705 |
| 41 | Ga0070669_100001837 | 3300005353 | Bacteria | 15314 |
| 42 | Ga0070669_100172946 | 3300005353 | Bacteria | 1685 |
| 43 | Ga0070669_100493370 | 3300005353 | Bacteria | 1015 |
| 44 | Ga0070675_100480855 | 3300005354 | Bacteria | 1117 |
| 45 | Ga0070675_100979975 | 3300005354 | Bacteria | 776 |
| 46 | Ga0070671_100000117 | 3300005355 | Bacteria | 51485 |
| 47 | Ga0070671_100001984 | 3300005355 | Bacteria | 15713 |
| 48 | Ga0070671_100010287 | 3300005355 | Bacteria | 7505 |
| 49 | Ga0070671_100042872 | 3300005355 | Bacteria | 3762 |
| 50 | Ga0070671_100106535 | 3300005355 | Bacteria | 2353 |
| 51 | Ga0070671_100303361 | 3300005355 | Bacteria | 1360 |
| 52 | Ga0070671_100368995 | 3300005355 | Bacteria | 1226 |
| 53 | Ga0070671_100408527 | 3300005355 | Bacteria | 1162 |
| 54 | Ga0070671_100961766 | 3300005355 | Bacteria | 747 |
| 55 | Ga0070674_100020282 | 3300005356 | Bacteria | 4242 |
| 56 | Ga0070674_100217387 | 3300005356 | Bacteria | 1485 |
| 57 | Ga0070673_100107076 | 3300005364 | Bacteria | 2312 |
| 58 | Ga0070659_100273483 | 3300005366 | Bacteria | 1404 |
| 59 | Ga0070667_100003679 | 3300005367 | Bacteria | 13058 |
| 60 | Ga0070667_100006960 | 3300005367 | Bacteria | 9395 |
| 61 | Ga0070667_100082486 | 3300005367 | Bacteria | 2753 |
| 62 | Ga0070667_100254386 | 3300005367 | Bacteria | 1571 |
| 63 | Ga0070667_100424236 | 3300005367 | Bacteria | 1213 |
| 64 | Ga0070667_100797421 | 3300005367 | Bacteria | 877 |
| 65 | Ga0070714_100010586 | 3300005435 | Bacteria | 7295 |
| 66 | Ga0070713_100674983 | 3300005436 | Unclassified | 985 |
| 67 | Ga0070710_10476347 | 3300005437 | Unclassified | 850 |
| 68 | Ga0070694_100075440 | 3300005444 | Bacteria | 2332 |
| 69 | Ga0070678_100235625 | 3300005456 | Bacteria | 1528 |
| 70 | Ga0070678_100327969 | 3300005456 | Bacteria | 1309 |
| 71 | Ga0070678_100879069 | 3300005456 | Bacteria | 818 |
| 72 | Ga0070662_100204300 | 3300005457 | Bacteria | 1569 |
| 73 | Ga0070662_100312809 | 3300005457 | Bacteria | 1279 |
| 74 | Ga0070681_10015665 | 3300005458 | Bacteria | 7553 |
| 75 | Ga0070681_10018648 | 3300005458 | Bacteria | 6939 |
| 76 | Ga0070681_10068828 | 3300005458 | Bacteria | 3506 |
| 77 | Ga0068867_100394838 | 3300005459 | Bacteria | 1165 |
| 78 | Ga0070685_10299081 | 3300005466 | Bacteria | 1084 |
| 79 | Ga0070706_100226495 | 3300005467 | Bacteria | 1745 |
| 80 | Ga0070707_100211915 | 3300005468 | Bacteria | 1888 |
| 81 | Ga0070698_100052414 | 3300005471 | Bacteria | 4150 |
| 82 | Ga0070679_100003981 | 3300005530 | Bacteria | 13607 |
| 83 | Ga0070679_100042072 | 3300005530 | Bacteria | 4550 |
| 84 | Ga0070684_100142881 | 3300005535 | Bacteria | 2165 |
| 85 | Ga0068853_100029896 | 3300005539 | Bacteria | 4596 |
| 86 | Ga0068853_100144538 | 3300005539 | Bacteria | 2137 |
| 87 | Ga0068853_100312462 | 3300005539 | Bacteria | 1455 |
| 88 | Ga0070672_100107475 | 3300005543 | Bacteria | 2270 |
| 89 | Ga0070672_100785509 | 3300005543 | Bacteria | 837 |
| 90 | Ga0070672_100823439 | 3300005543 | Bacteria | 817 |
| 91 | Ga0070686_100012027 | 3300005544 | Bacteria | 4922 |
| 92 | Ga0070696_100129314 | 3300005546 | Bacteria | 1836 |
| 93 | Ga0070696_100400395 | 3300005546 | Bacteria | 1074 |
| 94 | Ga0070693_100114090 | 3300005547 | Bacteria | 1666 |
| 95 | Ga0070693_100180715 | 3300005547 | Bacteria | 1358 |
| 96 | Ga0070665_100001533 | 3300005548 | Bacteria | 26717 |
| 97 | Ga0070665_100019658 | 3300005548 | Bacteria | 6779 |
| 98 | Ga0070665_100138330 | 3300005548 | Bacteria | 2438 |
| 99 | Ga0068855_100000356 | 3300005563 | Bacteria | 56702 |
| 100 | Ga0068855_100004289 | 3300005563 | Bacteria | 17423 |
| 101 | Ga0068855_100041798 | 3300005563 | Bacteria | 5432 |
| 102 | Ga0068855_100043316 | 3300005563 | Bacteria | 5332 |
| 103 | Ga0068855_100158900 | 3300005563 | Bacteria | 2566 |
| 104 | Ga0070664_100006979 | 3300005564 | Bacteria | 9108 |
| 105 | Ga0070664_100239158 | 3300005564 | Bacteria | 1630 |
| 106 | Ga0070664_100819184 | 3300005564 | Bacteria | 871 |
| 107 | Ga0068857_100114160 | 3300005577 | Bacteria | 2429 |
| 108 | Ga0068856_100040516 | 3300005614 | Bacteria | 4576 |
| 109 | Ga0068856_100086059 | 3300005614 | Bacteria | 3123 |
| 110 | Ga0068852_100000205 | 3300005616 | Bacteria | 40110 |
| 111 | Ga0068852_100163118 | 3300005616 | Bacteria | 2083 |
| 112 | Ga0068852_100202928 | 3300005616 | Bacteria | 1877 |
| 113 | Ga0068859_100017816 | 3300005617 | Bacteria | 7140 |
| 114 | Ga0068859_100257206 | 3300005617 | Bacteria | 1837 |
| 115 | Ga0068859_100270907 | 3300005617 | Bacteria | 1790 |
| 116 | Ga0068864_100023410 | 3300005618 | Bacteria | 5186 |
| 117 | Ga0068864_100108198 | 3300005618 | Bacteria | 2474 |
| 118 | Ga0068861_100164930 | 3300005719 | Bacteria | 1831 |
| 119 | Ga0068863_100018013 | 3300005841 | Bacteria | 6761 |
| 120 | Ga0068863_100028095 | 3300005841 | Bacteria | 5370 |
| 121 | Ga0068863_100619569 | 3300005841 | Bacteria | 1072 |
| 122 | Ga0068863_100708248 | 3300005841 | Bacteria | 1001 |
| 123 | Ga0068858_100010715 | 3300005842 | Bacteria | 8675 |
| 124 | Ga0068858_100011909 | 3300005842 | Bacteria | 8197 |
| 125 | Ga0068858_100042151 | 3300005842 | Bacteria | 4232 |
| 126 | Ga0068858_100301450 | 3300005842 | Bacteria | 1529 |
| 127 | Ga0068860_100075264 | 3300005843 | Bacteria | 3211 |
| 128 | Ga0068860_100219612 | 3300005843 | Bacteria | 1845 |
| 129 | Ga0068860_100623402 | 3300005843 | Bacteria | 1085 |
| 130 | Ga0068860_100651860 | 3300005843 | Bacteria | 1061 |
| 131 | Ga0068862_100023138 | 3300005844 | Bacteria | 5203 |
| 132 | Ga0068862_100180347 | 3300005844 | Bacteria | 1895 |
| 133 | Ga0068862_100589092 | 3300005844 | Bacteria | 1066 |
| 134 | Ga0081538_10053789 | 3300005981 | Bacteria | 2389 |
| 135 | Ga0070717_10088939 | 3300006028 | Bacteria | 2604 |
| 136 | Ga0075364_10000044 | 3300006051 | Bacteria | 43540 |
| 137 | Ga0075432_10017447 | 3300006058 | Bacteria | 2449 |
| 138 | Ga0070716_100558513 | 3300006173 | Bacteria | 855 |
| 139 | Ga0070712_100153722 | 3300006175 | Unclassified | 1769 |
| 140 | Ga0097621_100036587 | 3300006237 | Bacteria | 3928 |
| 141 | Ga0097621_100160914 | 3300006237 | Bacteria | 1930 |
| 142 | Ga0075370_10038245 | 3300006353 | Bacteria | 2700 |
| 143 | Ga0068871_100422860 | 3300006358 | Bacteria | 1190 |
| 144 | Ga0075428_100002056 | 3300006844 | Bacteria | 21702 |
| 145 | Ga0075430_100031724 | 3300006846 | Bacteria | 4484 |
| 146 | Ga0075431_100002077 | 3300006847 | Bacteria | 19121 |
| 147 | Ga0075433_10484731 | 3300006852 | Bacteria | 1089 |
| 148 | Ga0075434_100649135 | 3300006871 | Bacteria | 1073 |
| 149 | Ga0075429_100012253 | 3300006880 | Bacteria | 7437 |
| 150 | Ga0068865_100169780 | 3300006881 | Bacteria | 1671 |
| 151 | Ga0068865_100415026 | 3300006881 | Bacteria | 1105 |
| 152 | Ga0097620_100017816 | 3300006931 | Bacteria | 7140 |
| 153 | Ga0097620_100116698 | 3300006931 | Bacteria | 2734 |
| 154 | Ga0097620_100257195 | 3300006931 | Bacteria | 1837 |
| 155 | Ga0097620_100270912 | 3300006931 | Bacteria | 1790 |
| 156 | Ga0075435_100397104 | 3300007076 | Bacteria | 1186 |
| 157 | Ga0105251_10000063 | 3300009011 | Bacteria | 101276 |
| 158 | Ga0105240_10009203 | 3300009093 | Bacteria | 14007 |
| 159 | Ga0105240_10021718 | 3300009093 | Bacteria | 8531 |
| 160 | Ga0105240_10081775 | 3300009093 | Bacteria | 3968 |
| 161 | Ga0105240_10347732 | 3300009093 | Bacteria | 1683 |
| 162 | Ga0105240_10753058 | 3300009093 | Bacteria | 1059 |
| 163 | Ga0105240_10784260 | 3300009093 | Bacteria | 1033 |
| 164 | Ga0111539_10001638 | 3300009094 | Bacteria | 29905 |
| 165 | Ga0111539_10043318 | 3300009094 | Bacteria | 5396 |
| 166 | Ga0114129_10005978 | 3300009147 | Bacteria | 17237 |
| 167 | Ga0114129_11361538 | 3300009147 | Bacteria | 877 |
| 168 | Ga0114129_11818959 | 3300009147 | Bacteria | 740 |
| 169 | Ga0105241_10681997 | 3300009174 | Bacteria | 936 |
| 170 | Ga0105242_10153018 | 3300009176 | Bacteria | 2013 |
| 171 | Ga0105248_10068418 | 3300009177 | Bacteria | 3986 |
| 172 | Ga0105248_10087974 | 3300009177 | Bacteria | 3496 |
| 173 | Ga0105248_10120770 | 3300009177 | Bacteria | 2956 |
| 174 | Ga0105238_10097652 | 3300009551 | Bacteria | 2923 |
| 175 | Ga0105249_10132350 | 3300009553 | Bacteria | 2382 |
| 176 | Ga0105249_10518060 | 3300009553 | Bacteria | 1239 |
| 177 | Ga0105249_11149672 | 3300009553 | Bacteria | 847 |
| 178 | Ga0105249_11711493 | 3300009553 | Bacteria | 701 |
| 179 | Ga0105239_10078200 | 3300010375 | Bacteria | 3640 |
| 180 | Ga0105239_11174973 | 3300010375 | Bacteria | 884 |
| 181 | Ga0157373_10150056 | 3300013100 | Bacteria | 1639 |
| 182 | Ga0157373_10435146 | 3300013100 | Bacteria | 942 |
| 183 | Ga0157370_10028848 | 3300013104 | Bacteria | 5455 |
| 184 | Ga0157369_10017984 | 3300013105 | Bacteria | 7931 |
| 185 | Ga0157374_10125329 | 3300013296 | Bacteria | 2483 |
| 186 | Ga0157374_10496641 | 3300013296 | Bacteria | 1224 |
| 187 | Ga0157374_10767290 | 3300013296 | Bacteria | 979 |
| 188 | Ga0163162_10040145 | 3300013306 | Bacteria | 4678 |
| 189 | Ga0163162_10077288 | 3300013306 | Bacteria | 3392 |
| 190 | Ga0163162_10090493 | 3300013306 | Bacteria | 3141 |
| 191 | Ga0163162_10186517 | 3300013306 | Bacteria | 2201 |
| 192 | Ga0163162_10495639 | 3300013306 | Bacteria | 1352 |
| 193 | Ga0157375_10032682 | 3300013308 | Bacteria | 4936 |
| 194 | Ga0163163_10056706 | 3300014325 | Bacteria | 3872 |
| 195 | Ga0163163_10114786 | 3300014325 | Bacteria | 2724 |
| 196 | Ga0157380_10085151 | 3300014326 | Bacteria | 2594 |
| 197 | Ga0182008_10078123 | 3300014497 | Bacteria | 1628 |
| 198 | Ga0157377_10251280 | 3300014745 | Bacteria | 1146 |
| 199 | Ga0157379_10001896 | 3300014968 | Bacteria | 17284 |
| 200 | Ga0157379_10113016 | 3300014968 | Bacteria | 2441 |
| 201 | Ga0157379_10124739 | 3300014968 | Bacteria | 2317 |
| 202 | Ga0157376_10160214 | 3300014969 | Bacteria | 2039 |
| 203 | Ga0182006_1031330 | 3300015261 | Bacteria | 2144 |
| 204 | Ga0182007_10017568 | 3300015262 | Bacteria | 2609 |
| 205 | Ga0182007_10039500 | 3300015262 | Bacteria | 1579 |
| 206 | Ga0163161_10012196 | 3300017792 | Bacteria | 5961 |
| 207 | Ga0163161_10326612 | 3300017792 | Bacteria | 1214 |
| 208 | Ga0213874_10061695 | 3300021377 | Bacteria | 1176 |
| 209 | Ga0213876_10056529 | 3300021384 | Bacteria | 2071 |
| 210 | Ga0209677_101004 | 3300025253 | Bacteria | 13531 |
| 211 | Ga0209759_1007926 | 3300025256 | Bacteria | 3361 |
| 212 | Ga0209673_1011303 | 3300025273 | Bacteria | 3690 |
| 213 | Ga0209673_1036940 | 3300025273 | Bacteria | 1441 |
| 214 | Ga0209675_1000959 | 3300025291 | Bacteria | 18268 |
| 215 | Ga0209676_1044142 | 3300025292 | Bacteria | 1225 |
| 216 | Ga0209025_1000016 | 3300025294 | Bacteria | 770739 |
| 217 | Ga0209564_1000035 | 3300025295 | Bacteria | 442446 |
| 218 | Ga0209758_1000060 | 3300025297 | Bacteria | 324326 |
| 219 | Ga0209050_1052408 | 3300025298 | Bacteria | 1022 |
| 220 | Ga0209256_1000025 | 3300025299 | Bacteria | 442449 |
| 221 | Ga0209257_1039200 | 3300025304 | Bacteria | 1427 |
| 222 | Ga0207697_10075391 | 3300025315 | Bacteria | 1418 |
| 223 | Ga0207696_1005518 | 3300025711 | Bacteria | 5236 |
| 224 | Ga0207713_1000204 | 3300025735 | Bacteria | 81680 |
| 225 | Ga0207713_1075655 | 3300025735 | Bacteria | 1227 |
| 226 | Ga0207692_10158026 | 3300025898 | Bacteria | 1304 |
| 227 | Ga0207680_10006416 | 3300025903 | Bacteria | 5688 |
| 228 | Ga0207680_10093040 | 3300025903 | Bacteria | 1922 |
| 229 | Ga0207647_10104082 | 3300025904 | Bacteria | 1682 |
| 230 | Ga0207647_10143217 | 3300025904 | Bacteria | 1400 |
| 231 | Ga0207685_10034859 | 3300025905 | Unclassified | 1832 |
| 232 | Ga0207699_10012257 | 3300025906 | Bacteria | 4357 |
| 233 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 234 | Ga0207705_10189909 | 3300025909 | Bacteria | 1553 |
| 235 | Ga0207705_10413589 | 3300025909 | Bacteria | 1044 |
| 236 | Ga0207707_10007774 | 3300025912 | Bacteria | 9333 |
| 237 | Ga0207695_10008723 | 3300025913 | Bacteria | 12641 |
| 238 | Ga0207695_10106364 | 3300025913 | Bacteria | 2792 |
| 239 | Ga0207695_10246269 | 3300025913 | Bacteria | 1687 |
| 240 | Ga0207693_10112833 | 3300025915 | Bacteria | 2132 |
| 241 | Ga0207663_10091231 | 3300025916 | Unclassified | 2022 |
| 242 | Ga0207662_10579709 | 3300025918 | Bacteria | 779 |
| 243 | Ga0207652_10129036 | 3300025921 | Bacteria | 2254 |
| 244 | Ga0207652_10323364 | 3300025921 | Bacteria | 1392 |
| 245 | Ga0207646_10355600 | 3300025922 | Bacteria | 1323 |
| 246 | Ga0207681_10000540 | 3300025923 | Bacteria | 26022 |
| 247 | Ga0207681_10001538 | 3300025923 | Bacteria | 14870 |
| 248 | Ga0207681_10191752 | 3300025923 | Bacteria | 1564 |
| 249 | Ga0207681_10448678 | 3300025923 | Bacteria | 1049 |
| 250 | Ga0207694_10009761 | 3300025924 | Bacteria | 7243 |
| 251 | Ga0207650_10001767 | 3300025925 | Bacteria | 15288 |
| 252 | Ga0207650_10049687 | 3300025925 | Bacteria | 3098 |
| 253 | Ga0207650_10093134 | 3300025925 | Bacteria | 2306 |
| 254 | Ga0207650_10225536 | 3300025925 | Bacteria | 1510 |
| 255 | Ga0207650_10239669 | 3300025925 | Bacteria | 1465 |
| 256 | Ga0207650_10818361 | 3300025925 | Bacteria | 790 |
| 257 | Ga0207687_10948148 | 3300025927 | Bacteria | 737 |
| 258 | Ga0207700_10009194 | 3300025928 | Bacteria | 6161 |
| 259 | Ga0207664_10001394 | 3300025929 | Bacteria | 15882 |
| 260 | Ga0207664_10021334 | 3300025929 | Bacteria | 4813 |
| 261 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 262 | Ga0207644_10005239 | 3300025931 | Bacteria | 8465 |
| 263 | Ga0207644_10007334 | 3300025931 | Bacteria | 7180 |
| 264 | Ga0207644_10017827 | 3300025931 | Bacteria | 4801 |
| 265 | Ga0207644_10020831 | 3300025931 | Bacteria | 4461 |
| 266 | Ga0207644_10043035 | 3300025931 | Bacteria | 3203 |
| 267 | Ga0207644_10144510 | 3300025931 | Bacteria | 1835 |
| 268 | Ga0207706_10236788 | 3300025933 | Bacteria | 1596 |
| 269 | Ga0207669_10090513 | 3300025937 | Bacteria | 1990 |
| 270 | Ga0207704_10796825 | 3300025938 | Bacteria | 789 |
| 271 | Ga0207665_10005611 | 3300025939 | Bacteria | 8363 |
| 272 | Ga0207665_10349542 | 3300025939 | Bacteria | 1116 |
| 273 | Ga0207691_10015977 | 3300025940 | Bacteria | 7131 |
| 274 | Ga0207711_10011069 | 3300025941 | Bacteria | 7498 |
| 275 | Ga0207711_10166096 | 3300025941 | Bacteria | 2000 |
| 276 | Ga0207711_10210205 | 3300025941 | Bacteria | 1777 |
| 277 | Ga0207711_10282498 | 3300025941 | Bacteria | 1529 |
| 278 | Ga0207661_10175326 | 3300025944 | Bacteria | 1869 |
| 279 | Ga0207679_10001563 | 3300025945 | Bacteria | 14327 |
| 280 | Ga0207679_10212924 | 3300025945 | Bacteria | 1622 |
| 281 | Ga0207667_10000072 | 3300025949 | Bacteria | 177312 |
| 282 | Ga0207667_10035850 | 3300025949 | Bacteria | 5321 |
| 283 | Ga0207667_10060493 | 3300025949 | Bacteria | 3964 |
| 284 | Ga0207667_10084052 | 3300025949 | Bacteria | 3295 |
| 285 | Ga0207667_10160702 | 3300025949 | Bacteria | 2311 |
| 286 | Ga0207651_10112369 | 3300025960 | Bacteria | 2048 |
| 287 | Ga0207651_10125186 | 3300025960 | Bacteria | 1957 |
| 288 | Ga0207651_10409426 | 3300025960 | Bacteria | 1155 |
| 289 | Ga0207712_10132070 | 3300025961 | Bacteria | 1904 |
| 290 | Ga0207668_10004384 | 3300025972 | Bacteria | 8290 |
| 291 | Ga0207668_10010268 | 3300025972 | Bacteria | 5654 |
| 292 | Ga0207640_10001408 | 3300025981 | Bacteria | 12992 |
| 293 | Ga0207640_10426600 | 3300025981 | Bacteria | 1087 |
| 294 | Ga0207658_10002671 | 3300025986 | Bacteria | 12912 |
| 295 | Ga0207658_10024383 | 3300025986 | Bacteria | 4232 |
| 296 | Ga0207658_10135602 | 3300025986 | Bacteria | 1984 |
| 297 | Ga0207658_10257027 | 3300025986 | Bacteria | 1487 |
| 298 | Ga0207677_10285082 | 3300026023 | Bacteria | 1357 |
| 299 | Ga0207703_10001573 | 3300026035 | Bacteria | 20694 |
| 300 | Ga0207703_10014199 | 3300026035 | Bacteria | 6212 |
| 301 | Ga0207703_10151271 | 3300026035 | Bacteria | 2024 |
| 302 | Ga0207703_10370316 | 3300026035 | Bacteria | 1323 |
| 303 | Ga0207639_10015419 | 3300026041 | Bacteria | 5393 |
| 304 | Ga0207639_10059793 | 3300026041 | Bacteria | 2937 |
| 305 | Ga0207639_10125636 | 3300026041 | Bacteria | 2115 |
| 306 | Ga0207639_10165956 | 3300026041 | Bacteria | 1865 |
| 307 | Ga0207702_10018124 | 3300026078 | Bacteria | 5825 |
| 308 | Ga0207641_10011616 | 3300026088 | Bacteria | 7231 |
| 309 | Ga0207641_10015462 | 3300026088 | Bacteria | 6253 |
| 310 | Ga0207641_10856669 | 3300026088 | Bacteria | 901 |
| 311 | Ga0207641_10870980 | 3300026088 | Bacteria | 893 |
| 312 | Ga0207648_10062597 | 3300026089 | Bacteria | 3244 |
| 313 | Ga0207648_10436772 | 3300026089 | Bacteria | 1190 |
| 314 | Ga0207648_10520719 | 3300026089 | Bacteria | 1090 |
| 315 | Ga0207676_10114020 | 3300026095 | Bacteria | 2267 |
| 316 | Ga0207674_10271340 | 3300026116 | Bacteria | 1644 |
| 317 | Ga0207675_100023706 | 3300026118 | Bacteria | 5709 |
| 318 | Ga0207683_10088623 | 3300026121 | Bacteria | 2753 |
| 319 | Ga0207683_10308999 | 3300026121 | Bacteria | 1447 |
| 320 | Ga0207683_10460785 | 3300026121 | Bacteria | 1172 |
| 321 | Ga0207698_10000058 | 3300026142 | Bacteria | 78048 |
| 322 | Ga0207698_10069777 | 3300026142 | Bacteria | 2781 |
| 323 | Ga0207698_10207288 | 3300026142 | Bacteria | 1761 |
| 324 | Ga0207698_10266784 | 3300026142 | Bacteria | 1576 |
| 325 | Ga0207428_10007950 | 3300027907 | Bacteria | 9630 |
| 326 | Ga0207428_10053263 | 3300027907 | Bacteria | 3227 |
| 327 | Ga0207428_10068855 | 3300027907 | Bacteria | 2783 |
| 328 | Ga0268266_10037534 | 3300028379 | Bacteria | 4126 |
| 329 | Ga0268266_10057731 | 3300028379 | Bacteria | 3340 |
| 330 | Ga0268266_10096824 | 3300028379 | Bacteria | 2595 |
| 331 | Ga0268266_10149781 | 3300028379 | Bacteria | 2102 |
| 332 | Ga0268266_10397297 | 3300028379 | Bacteria | 1303 |
| 333 | Ga0268265_10133439 | 3300028380 | Bacteria | 2067 |
| 334 | Ga0268265_10589106 | 3300028380 | Bacteria | 1061 |
| 335 | Ga0268265_10713173 | 3300028380 | Bacteria | 970 |
| 336 | Ga0268264_10049526 | 3300028381 | Bacteria | 3495 |
| 337 | Ga0268264_10054785 | 3300028381 | Bacteria | 3331 |
| 338 | Ga0268264_11292816 | 3300028381 | Bacteria | 739 |
| 339 | Ga0265336_10000013 | 3300028666 | Bacteria | 252156 |
| 340 | Ga0307517_10000714 | 3300028786 | Bacteria | 57225 |
| 341 | Ga0307517_10029338 | 3300028786 | Bacteria | 6500 |
| 342 | Ga0307515_10110041 | 3300028794 | Bacteria | 3229 |
| 343 | Ga0265324_10001467 | 3300029957 | Bacteria | 13422 |
| 344 | Ga0316177_1042136 | 3300030731 | Bacteria | 4124 |
| 345 | Ga0314311_1100888 | 3300030733 | Bacteria | 2681 |
| 346 | Ga0265340_10081597 | 3300031247 | Bacteria | 1522 |
| 347 | Ga0307513_10007960 | 3300031456 | Bacteria | 13637 |
| 348 | Ga0307513_10029371 | 3300031456 | Bacteria | 6270 |
| 349 | Ga0307513_10067966 | 3300031456 | Bacteria | 3735 |
| 350 | Ga0307408_100019349 | 3300031548 | Bacteria | 4584 |
| 351 | Ga0307408_100033511 | 3300031548 | Bacteria | 3589 |
| 352 | Ga0307408_100074082 | 3300031548 | Bacteria | 2525 |
| 353 | Ga0307408_100180620 | 3300031548 | Bacteria | 1692 |
| 354 | Ga0307516_10334779 | 3300031730 | Bacteria | 1182 |
| 355 | Ga0307405_10015498 | 3300031731 | Bacteria | 4131 |
| 356 | Ga0307405_10043036 | 3300031731 | Bacteria | 2752 |
| 357 | Ga0307405_10110700 | 3300031731 | Bacteria | 1860 |
| 358 | Ga0307413_10013290 | 3300031824 | Bacteria | 4133 |
| 359 | Ga0307413_10036182 | 3300031824 | Bacteria | 2840 |
| 360 | Ga0307413_10037496 | 3300031824 | Bacteria | 2800 |
| 361 | Ga0307413_10049509 | 3300031824 | Bacteria | 2518 |
| 362 | Ga0307413_10252929 | 3300031824 | Bacteria | 1308 |
| 363 | Ga0307410_10001948 | 3300031852 | Bacteria | 9692 |
| 364 | Ga0307410_10017152 | 3300031852 | Bacteria | 4339 |
| 365 | Ga0307410_10089066 | 3300031852 | Bacteria | 2186 |
| 366 | Ga0307406_10086216 | 3300031901 | Bacteria | 2102 |
| 367 | Ga0307406_10188619 | 3300031901 | Bacteria | 1507 |
| 368 | Ga0307406_10240561 | 3300031901 | Bacteria | 1357 |
| 369 | Ga0307406_10440243 | 3300031901 | Bacteria | 1043 |
| 370 | Ga0307406_10679323 | 3300031901 | Bacteria | 858 |
| 371 | Ga0307407_10068336 | 3300031903 | Bacteria | 2104 |
| 372 | Ga0307407_10175876 | 3300031903 | Bacteria | 1414 |
| 373 | Ga0307407_10238381 | 3300031903 | Bacteria | 1239 |
| 374 | Ga0307407_10270905 | 3300031903 | Bacteria | 1172 |
| 375 | Ga0307412_10034140 | 3300031911 | Bacteria | 3240 |
| 376 | Ga0307412_10056628 | 3300031911 | Bacteria | 2613 |
| 377 | Ga0307412_10132517 | 3300031911 | Bacteria | 1812 |
| 378 | Ga0307412_10159425 | 3300031911 | Bacteria | 1674 |
| 379 | Ga0307412_10255778 | 3300031911 | Bacteria | 1362 |
| 380 | Ga0307412_10338605 | 3300031911 | Bacteria | 1203 |
| 381 | Ga0307409_100025854 | 3300031995 | Bacteria | 4127 |
| 382 | Ga0307409_100039945 | 3300031995 | Bacteria | 3487 |
| 383 | Ga0307409_100063199 | 3300031995 | Bacteria | 2902 |
| 384 | Ga0307409_100219289 | 3300031995 | Bacteria | 1716 |
| 385 | Ga0307409_101109646 | 3300031995 | Bacteria | 812 |
| 386 | Ga0307416_100036987 | 3300032002 | Bacteria | 3751 |
| 387 | Ga0307416_100056211 | 3300032002 | Bacteria | 3174 |
| 388 | Ga0307416_100087745 | 3300032002 | Bacteria | 2657 |
| 389 | Ga0307416_100540607 | 3300032002 | Bacteria | 1237 |
| 390 | Ga0307416_101638362 | 3300032002 | Bacteria | 748 |
| 391 | Ga0307414_10002184 | 3300032004 | Bacteria | 10204 |
| 392 | Ga0307414_10040479 | 3300032004 | Bacteria | 3148 |
| 393 | Ga0307414_10046318 | 3300032004 | Bacteria | 2984 |
| 394 | Ga0307414_10074760 | 3300032004 | Bacteria | 2456 |
| 395 | Ga0307414_10160538 | 3300032004 | Bacteria | 1785 |
| 396 | Ga0307414_10280049 | 3300032004 | Bacteria | 1401 |
| 397 | Ga0307414_10511138 | 3300032004 | Bacteria | 1064 |
| 398 | Ga0307414_10530294 | 3300032004 | Bacteria | 1046 |
| 399 | Ga0307414_10731055 | 3300032004 | Bacteria | 898 |
| 400 | Ga0307414_11186623 | 3300032004 | Bacteria | 706 |
| 401 | Ga0307411_10052358 | 3300032005 | Bacteria | 2668 |
| 402 | Ga0307411_10055456 | 3300032005 | Bacteria | 2607 |
| 403 | Ga0307411_10141227 | 3300032005 | Bacteria | 1776 |
| 404 | Ga0307411_10158931 | 3300032005 | Bacteria | 1690 |
| 405 | Ga0307411_10166327 | 3300032005 | Bacteria | 1658 |
| 406 | Ga0307411_10241825 | 3300032005 | Bacteria | 1413 |
| 407 | Ga0307411_10270842 | 3300032005 | Bacteria | 1346 |
| 408 | Ga0307411_10415303 | 3300032005 | Bacteria | 1116 |
| 409 | Ga0307415_100017801 | 3300032126 | Bacteria | 4270 |
| 410 | Ga0307415_100136652 | 3300032126 | Bacteria | 1865 |
| 411 | Ga0307415_100359846 | 3300032126 | Bacteria | 1228 |
| 412 | Ga0307415_100466879 | 3300032126 | Bacteria | 1095 |
| 413 | Ga0307415_100673029 | 3300032126 | Bacteria | 930 |
| 414 | Ga0307510_10018891 | 3300033180 | Bacteria | 8091 |
| 415 | Ga0316212_1025267 | 3300033547 | Bacteria | 833 |
| 416 | Ga0373926_0002550 | 3300035083 | Bacteria | 5789 |
| 417 | Ga0373929_0051197 | 3300035085 | Bacteria | 944 |
| 418 | Ga0373931_0199264 | 3300035691 | Bacteria | 1195 |
| 419 | Ga0373935_0005636 | 3300035692 | Bacteria | 7390 |
| 420 | Ga0373935_0042507 | 3300035692 | Bacteria | 2858 |
| 421 | Ga0373927_0036961 | 3300035695 | Bacteria | 3174 |
| 422 | Ga0373947_0003512 | 3300035725 | Bacteria | 9257 |
| 423 | Ga0373947_0025977 | 3300035725 | Bacteria | 3417 |
| 424 | Ga0373937_0064678 | 3300036401 | Bacteria | 3365 |
| 425 | Ga0373925_0061155 | 3300037068 | Bacteria | 2828 |
| 426 | Ga0373925_0091476 | 3300037068 | Bacteria | 2326 |
| 427 | Ga0395899_0000059 | 3300037312 | Bacteria | 213004 |
| 428 | Ga0395899_0058474 | 3300037312 | Bacteria | 2843 |
| 429 | Ga0395899_0059468 | 3300037312 | Bacteria | 2817 |
| 430 | Ga0395899_0149841 | 3300037312 | Bacteria | 1654 |
| 431 | Ga0395899_0264882 | 3300037312 | Bacteria | 1174 |
| 432 | Ga0395900_0000017 | 3300037418 | Bacteria | 369602 |
| 433 | Ga0395900_0009530 | 3300037418 | Bacteria | 9956 |
| 434 | Ga0395900_0449868 | 3300037418 | Unclassified | 1244 |
| 435 | Ga0395898_0000030 | 3300037466 | Bacteria | 369577 |
| 436 | Ga0395898_0042315 | 3300037466 | Bacteria | 4495 |
| 437 | Ga0395898_0128157 | 3300037466 | Bacteria | 2431 |
| 438 | Ga0395898_0721605 | 3300037466 | Unclassified | 938 |
| 439 | Ga0395905_0000056 | 3300037471 | Bacteria | 209230 |
| 440 | Ga0395905_0021062 | 3300037471 | Bacteria | 6174 |
| 441 | Ga0395905_0111198 | 3300037471 | Bacteria | 2573 |
| 442 | Ga0436364_1314768 | 3300037853 | Bacteria | 3352 |
| 443 | Ga0395901_0000015 | 3300038443 | Bacteria | 373388 |
| 444 | Ga0395901_0008990 | 3300038443 | Bacteria | 10115 |
| 445 | Ga0395901_0027674 | 3300038443 | Bacteria | 5828 |
| 446 | Ga0395901_0059770 | 3300038443 | Bacteria | 3965 |
| 447 | Ga0395901_0093551 | 3300038443 | Bacteria | 3148 |
| 448 | Ga0395901_0101554 | 3300038443 | Bacteria | 3018 |
| 449 | Ga0237819_00202 | 3300038705 | Bacteria | 21730 |
| 450 | Ga0436365_0184254 | 3300039437 | Bacteria | 5294 |
| 451 | Ga0436365_1283872 | 3300039437 | Bacteria | 659 |
| 452 | Ga0436365_1544431 | 3300039437 | Bacteria | 3392 |
| 453 | Ga0436360_0732223 | 3300039438 | Bacteria | 3669 |
| 454 | Ga0436363_0998443 | 3300039450 | Bacteria | 2877 |
| 455 | Ga0436363_1232870 | 3300039450 | Bacteria | 1250 |
| 456 | Ga0439436_0067848 | 3300041404 | Bacteria | 995 |
| 457 | Ga0451804_0292709 | 3300041463 | Bacteria | 805 |
| 458 | Ga0451835_0421712 | 3300041492 | Bacteria | 1912 |
| 459 | Ga0451841_0329872 | 3300041498 | Bacteria | 2086 |
| 460 | Ga0451849_0107676 | 3300041505 | Bacteria | 2511 |
| 461 | Ga0451853_0502947 | 3300041512 | Bacteria | 33087 |
| 462 | Ga0451853_1755985 | 3300041512 | Bacteria | 2097 |
| 463 | Ga0450911_000004 | 3300042115 | Bacteria | 234537 |
| 464 | Ga0450895_022856 | 3300042132 | Unclassified | 587 |
| 465 | Ga0439446_0002115 | 3300042156 | Bacteria | 4721 |
| 466 | Ga0439460_0099074 | 3300042461 | Bacteria | 934 |
| 467 | Ga0450893_0000541 | 3300042532 | Bacteria | 5367 |
| 468 | Ga0451577_0003093 | 3300042876 | Bacteria | 18788 |
| 469 | Ga0466972_0024653 | 3300044658 | Bacteria | 2985 |
| 470 | Ga0453684_0315649 | 3300044712 | Bacteria | 1772 |
| 471 | Ga0451576_0425087 | 3300045051 | Bacteria | 1394 |
| 472 | Ga0451576_1100674 | 3300045051 | Bacteria | 831 |
| 473 | Ga0466967_0584792 | 3300045976 | Bacteria | 1101 |
| 474 | Ga0495603_0132385 | 3300046455 | Bacteria | 1452 |
| 475 | Ga0495629_0003965 | 3300046459 | Bacteria | 11132 |
| 476 | Ga0495638_0010420 | 3300046460 | Bacteria | 6457 |
| 477 | Ga0495653_0000971 | 3300046463 | Bacteria | 22003 |
| 478 | Ga0495580_0003388 | 3300046472 | Bacteria | 13613 |
| 479 | Ga0495580_0094020 | 3300046472 | Bacteria | 2086 |
| 480 | Ga0495580_0161141 | 3300046472 | Bacteria | 1552 |
| 481 | Ga0495582_0311670 | 3300046473 | Bacteria | 905 |
| 482 | Ga0495664_0068698 | 3300046477 | Bacteria | 2114 |
| 483 | Ga0495596_0000133 | 3300046500 | Bacteria | 51283 |
| 484 | Ga0495583_0000248 | 3300046506 | Bacteria | 89173 |
| 485 | Ga0495583_0061233 | 3300046506 | Bacteria | 1680 |
| 486 | Ga0495606_0068677 | 3300046507 | Bacteria | 2241 |
| 487 | Ga0495610_0000269 | 3300046512 | Bacteria | 54194 |
| 488 | Ga0495616_0098763 | 3300046513 | Bacteria | 1371 |
| 489 | Ga0495628_0005790 | 3300046516 | Bacteria | 10831 |
| 490 | Ga0495628_0390702 | 3300046516 | Bacteria | 1018 |
| 491 | Ga0495630_0022456 | 3300046517 | Bacteria | 4660 |
| 492 | Ga0495643_0000207 | 3300046522 | Bacteria | 90642 |
| 493 | Ga0495643_0030312 | 3300046522 | Bacteria | 3022 |
| 494 | Ga0495642_0001985 | 3300046528 | Bacteria | 8568 |
| 495 | Ga0495642_0235611 | 3300046528 | Bacteria | 800 |
| 496 | Ga0495652_0006057 | 3300046529 | Bacteria | 11311 |
| 497 | Ga0495665_0000517 | 3300046531 | Bacteria | 19533 |
| 498 | Ga0495587_0063821 | 3300046536 | Bacteria | 2153 |
| 499 | Ga0495598_0016150 | 3300046537 | Bacteria | 1900 |
| 500 | Ga0495598_0140397 | 3300046537 | Bacteria | 835 |
| 501 | Ga0495645_0061554 | 3300046543 | Bacteria | 2719 |
| 502 | Ga0495668_0073805 | 3300046616 | Bacteria | 1873 |
| 503 | Ga0495634_0149495 | 3300046642 | Bacteria | 1478 |
| 504 | Ga0495611_0021608 | 3300046648 | Bacteria | 2780 |
| 505 | Ga0495611_0069385 | 3300046648 | Bacteria | 1610 |
| 506 | Ga0495625_0088227 | 3300046660 | Bacteria | 2149 |
| 507 | Ga0495625_0390709 | 3300046660 | Bacteria | 871 |
| 508 | Ga0495635_0004635 | 3300046663 | Bacteria | 9540 |
| 509 | Ga0495661_0062122 | 3300046665 | Bacteria | 2214 |
| 510 | Ga0495623_0001766 | 3300046679 | Bacteria | 14510 |
| 511 | Ga0495646_0006311 | 3300046680 | Bacteria | 7521 |
| 512 | Ga0495669_0140121 | 3300046684 | Bacteria | 1142 |
| 513 | Ga0495669_0203694 | 3300046684 | Bacteria | 946 |
| 514 | Ga0495624_0140779 | 3300046690 | Bacteria | 1478 |
| 515 | Ga0495670_0041227 | 3300046691 | Bacteria | 2303 |
| 516 | Ga0495649_0000649 | 3300046694 | Bacteria | 28270 |
| 517 | Ga0495660_0414248 | 3300046810 | Bacteria | 588 |
| 518 | Ga0495674_0002426 | 3300047319 | Bacteria | 18233 |
| 519 | Ga0495680_0002387 | 3300047322 | Bacteria | 19256 |
| 520 | Ga0495677_0013823 | 3300047445 | Bacteria | 2939 |
| 521 | Ga0495677_0091936 | 3300047445 | Bacteria | 1144 |
| 522 | Ga0495673_0006032 | 3300047469 | Bacteria | 7198 |
| 523 | Ga0495681_0068937 | 3300047470 | Bacteria | 1608 |
| 524 | Ga0495686_0006965 | 3300047472 | Bacteria | 8541 |
| 525 | Ga0495686_0053879 | 3300047472 | Bacteria | 2520 |
| 526 | Ga0495593_0000294 | 3300047673 | Bacteria | 27159 |
| 527 | Ga0495602_0001221 | 3300048088 | Bacteria | 25282 |
| 528 | Ga0495615_0000145 | 3300048090 | Bacteria | 17874 |
| 529 | Ga0496100_0033901 | 3300048903 | Bacteria | 3198 |
| 530 | Ga0496100_0436834 | 3300048903 | Bacteria | 1002 |
| 531 | Ga0496101_0115411 | 3300048904 | Bacteria | 2025 |
| 532 | Ga0496102_0000036 | 3300048905 | Bacteria | 201896 |
| 533 | Ga0496102_0001749 | 3300048905 | Bacteria | 18963 |
| 534 | Ga0496102_0076863 | 3300048905 | Bacteria | 3072 |
| 535 | Ga0496102_0331510 | 3300048905 | Bacteria | 1433 |
| 536 | Ga0496103_0000074 | 3300048906 | Bacteria | 116385 |
| 537 | Ga0496103_0000180 | 3300048906 | Bacteria | 64400 |
| 538 | Ga0496104_0000744 | 3300048907 | Bacteria | 27900 |
| 539 | Ga0496104_0073477 | 3300048907 | Bacteria | 3253 |
| 540 | Ga0496104_0128928 | 3300048907 | Bacteria | 2429 |
| 541 | Ga0496104_0131197 | 3300048907 | Bacteria | 2407 |
| 542 | Ga0496104_0194617 | 3300048907 | Bacteria | 1940 |
| 543 | Ga0496105_0006029 | 3300048908 | Bacteria | 9267 |
| 544 | Ga0496105_0672057 | 3300048908 | Bacteria | 797 |
| 545 | Ga0496105_0746487 | 3300048908 | Bacteria | 748 |
| 546 | Ga0496106_0327380 | 3300048909 | Bacteria | 1230 |
| 547 | Ga0496107_0002992 | 3300048910 | Bacteria | 11187 |
| 548 | Ga0496107_0016944 | 3300048910 | Bacteria | 5124 |
| 549 | Ga0496107_0498716 | 3300048910 | Bacteria | 903 |
| 550 | Ga0496108_0034048 | 3300048911 | Bacteria | 4232 |
| 551 | Ga0496108_0124428 | 3300048911 | Bacteria | 2213 |
| 552 | Ga0496108_0256350 | 3300048911 | Bacteria | 1522 |
| 553 | Ga0496109_0097123 | 3300048912 | Bacteria | 2730 |
| 554 | Ga0496109_0102783 | 3300048912 | Bacteria | 2652 |
| 555 | Ga0496109_0431069 | 3300048912 | Bacteria | 1245 |
| 556 | Ga0496109_0602598 | 3300048912 | Bacteria | 1035 |
| 557 | Ga0496110_0046884 | 3300048913 | Bacteria | 3782 |
| 558 | Ga0496110_0194221 | 3300048913 | Bacteria | 1843 |
| 559 | Ga0496110_0413098 | 3300048913 | Bacteria | 1230 |
| 560 | Ga0496111_0109638 | 3300048914 | Bacteria | 2032 |
| 561 | Ga0496112_0016770 | 3300048915 | Bacteria | 6870 |
| 562 | Ga0496112_0022704 | 3300048915 | Bacteria | 5985 |
| 563 | Ga0496112_0044793 | 3300048915 | Bacteria | 4336 |
| 564 | Ga0496113_0003090 | 3300048916 | Bacteria | 9888 |
| 565 | Ga0496113_0014100 | 3300048916 | Bacteria | 5441 |
| 566 | Ga0496115_0217790 | 3300048918 | Bacteria | 1576 |
| 567 | Ga0496116_0016066 | 3300048919 | Bacteria | 5879 |
| 568 | Ga0496117_0000093 | 3300048920 | Bacteria | 201862 |
| 569 | Ga0496117_0000948 | 3300048920 | Bacteria | 44319 |
| 570 | Ga0496117_0008584 | 3300048920 | Bacteria | 9685 |
| 571 | Ga0496118_0000070 | 3300048921 | Bacteria | 201866 |
| 572 | Ga0496118_0033171 | 3300048921 | Bacteria | 4241 |
| 573 | Ga0496118_0155199 | 3300048921 | Bacteria | 1425 |
| 574 | Ga0496119_0000956 | 3300048922 | Bacteria | 37136 |
| 575 | Ga0496119_0000981 | 3300048922 | Bacteria | 36677 |
| 576 | Ga0496120_0001723 | 3300048923 | Bacteria | 24891 |
| 577 | Ga0496120_0003868 | 3300048923 | Bacteria | 13141 |
| 578 | Ga0496120_0088057 | 3300048923 | Bacteria | 1665 |
| 579 | Ga0496121_0010576 | 3300048924 | Bacteria | 10373 |
| 580 | Ga0496122_0000928 | 3300048925 | Bacteria | 53465 |
| 581 | Ga0496122_0001127 | 3300048925 | Bacteria | 46009 |
| 582 | Ga0496122_0005695 | 3300048925 | Bacteria | 14703 |
| 583 | Ga0496122_0007341 | 3300048925 | Bacteria | 12300 |
| 584 | Ga0496123_0000695 | 3300048926 | Bacteria | 55320 |
| 585 | Ga0496123_0001597 | 3300048926 | Bacteria | 30772 |
| 586 | Ga0496123_0005504 | 3300048926 | Bacteria | 12731 |
| 587 | Ga0496123_0037545 | 3300048926 | Bacteria | 3418 |
| 588 | Ga0496124_0000225 | 3300048927 | Bacteria | 110516 |
| 589 | Ga0496124_0000535 | 3300048927 | Bacteria | 64646 |
| 590 | Ga0496124_0000901 | 3300048927 | Bacteria | 48046 |
| 591 | Ga0496124_0133967 | 3300048927 | Bacteria | 1964 |
| 592 | Ga0496125_0075360 | 3300048928 | Bacteria | 2611 |
| 593 | Ga0496125_0102566 | 3300048928 | Bacteria | 2102 |
| 594 | Ga0496125_0178519 | 3300048928 | Bacteria | 1418 |
| 595 | Ga0496126_0000173 | 3300048929 | Bacteria | 146490 |
| 596 | Ga0496126_0005453 | 3300048929 | Bacteria | 14509 |
| 597 | Ga0496126_0049678 | 3300048929 | Bacteria | 3828 |
| 598 | Ga0496126_0229263 | 3300048929 | Bacteria | 1557 |
| 599 | Ga0501032_0018311 | 3300049569 | Bacteria | 4908 |
| 600 | Ga0501032_0196018 | 3300049569 | Bacteria | 1319 |
| 601 | Ga0501034_0001639 | 3300049571 | Bacteria | 28926 |
| 602 | Ga0501034_0971483 | 3300049571 | Bacteria | 734 |
| 603 | Ga0501036_0215064 | 3300049572 | Bacteria | 1615 |
| 604 | Ga0501039_0422023 | 3300049575 | Bacteria | 1048 |
| 605 | Ga0501043_0076859 | 3300049579 | Bacteria | 2623 |
| 606 | Ga0501047_0003609 | 3300049581 | Bacteria | 14583 |
| 607 | Ga0501072_0420131 | 3300049588 | Bacteria | 1060 |
| 608 | Ga0501252_016015 | 3300049682 | Bacteria | 941 |
| 609 | Ga0501225_0000130 | 3300049705 | Bacteria | 22936 |
| 610 | Ga0501268_041219 | 3300049765 | Bacteria | 870 |
| 611 | Ga0501273_022350 | 3300049770 | Bacteria | 864 |
| 612 | Ga0501035_0095271 | 3300049822 | Bacteria | 2617 |
| 613 | Ga0501044_0001364 | 3300049823 | Bacteria | 28627 |
| 614 | Ga0501044_0165448 | 3300049823 | Bacteria | 2186 |
| 615 | Ga0501226_000003 | 3300049853 | Bacteria | 358977 |
| 616 | nmdc:mga03683_80671_c1 | 3300050489 | Bacteria | 1404 |
| 617 | nmdc:mga05p37_635_c1 | 3300050507 | Bacteria | 38849 |
| 618 | nmdc:mga09592_460880_c1 | 3300050508 | Bacteria | 1096 |
| 619 | nmdc:mga09592_5882_c1 | 3300050508 | Bacteria | 10011 |
| 620 | nmdc:mga0qj67_63980_c1 | 3300050509 | Bacteria | 2925 |
| 621 | nmdc:mga06r32_2776_c1 | 3300050510 | Bacteria | 15677 |
| 622 | nmdc:mga06r32_669674_c1 | 3300050510 | Bacteria | 1005 |
| 623 | nmdc:mga08y16_463276_c1 | 3300050511 | Bacteria | 1291 |
| 624 | nmdc:mga08y16_78535_c1 | 3300050511 | Bacteria | 3441 |
| 625 | nmdc:mga08y16_809_c1 | 3300050511 | Bacteria | 29909 |
| 626 | nmdc:mga0n895_359238_c1 | 3300050512 | Bacteria | 1475 |
| 627 | nmdc:mga0n895_89701_c1 | 3300050512 | Unclassified | 3075 |
| 628 | nmdc:mga0rr50_114067_c1 | 3300050513 | Bacteria | 2142 |
| 629 | nmdc:mga0rr50_363428_c1 | 3300050513 | Bacteria | 1218 |
| 630 | Ga0495612_0131865 | 3300053078 | Bacteria | 1080 |
| 631 | Ga0500578_0061164 | 3300053086 | Bacteria | 2405 |
| 632 | Ga0500643_004924 | 3300053087 | Bacteria | 5878 |
| 633 | Ga0500646_0164786 | 3300053090 | Bacteria | 742 |
| 634 | Ga0500647_0240330 | 3300053091 | Bacteria | 801 |
| 635 | Ga0500555_001303 | 3300053103 | Bacteria | 7904 |
| 636 | Ga0500556_0024575 | 3300053104 | Bacteria | 1981 |
| 637 | Ga0500569_120541 | 3300053109 | Bacteria | 873 |
| 638 | Ga0500595_004721 | 3300053119 | Bacteria | 6052 |
| 639 | Ga0500618_056362 | 3300053125 | Bacteria | 886 |
| 640 | Ga0500652_085101 | 3300053131 | Bacteria | 1318 |
| 641 | Ga0500564_061390 | 3300053138 | Bacteria | 1704 |
| 642 | Ga0500568_0100923 | 3300053139 | Bacteria | 1083 |
| 643 | Ga0500573_0047092 | 3300053140 | Bacteria | 2484 |
| 644 | Ga0500588_0154900 | 3300053146 | Bacteria | 831 |
| 645 | Ga0500590_001281 | 3300053148 | Bacteria | 10113 |
| 646 | Ga0500616_0017363 | 3300053153 | Bacteria | 4082 |
| 647 | Ga0500622_0150056 | 3300053156 | Bacteria | 1103 |
| 648 | Ga0500611_018524 | 3300053727 | Bacteria | 1285 |
| 649 | Ga0500645_001601 | 3300053730 | Bacteria | 11250 |
| 650 | Ga0500645_043241 | 3300053730 | Bacteria | 1327 |
| 651 | Ga0587083_0008217 | 3300059505 | Bacteria | 1626 |
| 652 | Ga0587067_006012 | 3300059640 | Bacteria | 1671 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042132 | Ga0450895_022856 | Ga0450895_022856_40_576 | 178 |
| 2 | 3300046810 | Ga0495660_0414248 | Ga0495660_0414248_18_578 | 186 |
| 3 | 3300046506 | Ga0495583_0061233 | Ga0495583_0061233_1085_1663 | 190 |
| 4 | 3300031548 | Ga0307408_100019349 | Ga0307408_1000193493 | 199 |
| 5 | 3300039437 | Ga0436365_1283872 | Ga0436365_1283872_10_618 | 200 |
| 6 | 3300041463 | Ga0451804_0292709 | Ga0451804_0292709_166_768 | 200 |
| 7 | 3300046528 | Ga0495642_0235611 | Ga0495642_0235611_173_784 | 200 |
| 8 | 3300005563 | Ga0068855_100004289 | Ga0068855_10000428912 | 206 |
| 9 | 3300009093 | Ga0105240_10347732 | Ga0105240_103477322 | 206 |
| 10 | 3300025913 | Ga0207695_10246269 | Ga0207695_102462692 | 206 |
| 11 | iso_pu_bacteria | 8054302542 | 8054305866 | 209 |
| 12 | 3300005458 | Ga0070681_10015665 | Ga0070681_100156659 | 210 |
| 13 | 3300005981 | Ga0081538_10053789 | Ga0081538_100537892 | 210 |
| 14 | 3300006844 | Ga0075428_100002056 | Ga0075428_10000205620 | 210 |
| 15 | 3300006846 | Ga0075430_100031724 | Ga0075430_1000317242 | 210 |
| 16 | 3300006847 | Ga0075431_100002077 | Ga0075431_10000207712 | 210 |
| 17 | 3300006880 | Ga0075429_100012253 | Ga0075429_1000122538 | 210 |
| 18 | 3300009094 | Ga0111539_10001638 | Ga0111539_100016387 | 210 |
| 19 | 3300009147 | Ga0114129_10005978 | Ga0114129_1000597815 | 210 |
| 20 | 3300025297 | Ga0209758_1000060 | Ga0209758_100006066 | 210 |
| 21 | 3300025304 | Ga0209257_1039200 | Ga0209257_10392002 | 210 |
| 22 | 3300027907 | Ga0207428_10007950 | Ga0207428_100079507 | 210 |
| 23 | 3300049579 | Ga0501043_0076859 | Ga0501043_0076859_1010_1654 | 210 |
| 24 | 3300049822 | Ga0501035_0095271 | Ga0501035_0095271_536_1180 | 210 |
| 25 | 3300050507 | nmdc:mga05p37_635_c1 | nmdc:mga05p37_635_c1_32651_33325 | 210 |
| 26 | 3300050508 | nmdc:mga09592_5882_c1 | nmdc:mga09592_5882_c1_4580_5254 | 210 |
| 27 | 3300050509 | nmdc:mga0qj67_63980_c1 | nmdc:mga0qj67_63980_c1_1473_2147 | 210 |
| 28 | 3300050510 | nmdc:mga06r32_2776_c1 | nmdc:mga06r32_2776_c1_3061_3735 | 210 |
| 29 | 3300050511 | nmdc:mga08y16_809_c1 | nmdc:mga08y16_809_c1_23888_24562 | 210 |
| 30 | 3300053086 | Ga0500578_0061164 | Ga0500578_0061164_1188_1832 | 210 |
| 31 | 3300053104 | Ga0500556_0024575 | Ga0500556_0024575_39_683 | 210 |
| 32 | 3300053139 | Ga0500568_0100923 | Ga0500568_0100923_333_977 | 210 |
| 33 | 3300053146 | Ga0500588_0154900 | Ga0500588_0154900_144_788 | 210 |
| 34 | iso_pu_bacteria | 2643221614 | 2644088555 | 210 |
| 35 | iso_pu_bacteria | 2643221661 | 2644343791 | 210 |
| 36 | iso_pu_bacteria | 2643221666 | 2644368731 | 210 |
| 37 | iso_pu_bacteria | 2941485952 | 2941487257 | 210 |
| 38 | 3300041492 | Ga0451835_0421712 | Ga0451835_0421712_111_758 | 211 |
| 39 | 3300041498 | Ga0451841_0329872 | Ga0451841_0329872_1396_2043 | 211 |
| 40 | 3300041505 | Ga0451849_0107676 | Ga0451849_0107676_392_1039 | 211 |
| 41 | 3300041512 | Ga0451853_0502947 | Ga0451853_0502947_25380_26027 | 211 |
| 42 | 3300005331 | Ga0070670_100119593 | Ga0070670_1001195932 | 212 |
| 43 | 3300005333 | Ga0070677_10000296 | Ga0070677_1000029615 | 212 |
| 44 | 3300005334 | Ga0068869_100388793 | Ga0068869_1003887931 | 212 |
| 45 | 3300005539 | Ga0068853_100029896 | Ga0068853_1000298966 | 212 |
| 46 | 3300005564 | Ga0070664_100819184 | Ga0070664_1008191842 | 212 |
| 47 | 3300013100 | Ga0157373_10435146 | Ga0157373_104351462 | 212 |
| 48 | 3300026142 | Ga0207698_10266784 | Ga0207698_102667843 | 212 |
| 49 | 3300031548 | Ga0307408_100180620 | Ga0307408_1001806203 | 212 |
| 50 | 3300031852 | Ga0307410_10089066 | Ga0307410_100890662 | 212 |
| 51 | 3300031903 | Ga0307407_10068336 | Ga0307407_100683362 | 212 |
| 52 | 3300032002 | Ga0307416_100087745 | Ga0307416_1000877452 | 212 |
| 53 | 3300032005 | Ga0307411_10158931 | Ga0307411_101589313 | 212 |
| 54 | 3300032005 | Ga0307411_10415303 | Ga0307411_104153031 | 212 |
| 55 | 3300002459 | JGI24751J29686_10000554 | JGI24751J29686_100005549 | 213 |
| 56 | 3300005331 | Ga0070670_100351860 | Ga0070670_1003518602 | 213 |
| 57 | 3300005539 | Ga0068853_100312462 | Ga0068853_1003124621 | 213 |
| 58 | 3300005563 | Ga0068855_100041798 | Ga0068855_1000417986 | 213 |
| 59 | 3300005563 | Ga0068855_100158900 | Ga0068855_1001589003 | 213 |
| 60 | 3300005614 | Ga0068856_100040516 | Ga0068856_1000405164 | 213 |
| 61 | 3300005616 | Ga0068852_100000205 | Ga0068852_10000020529 | 213 |
| 62 | 3300005616 | Ga0068852_100202928 | Ga0068852_1002029283 | 213 |
| 63 | 3300005841 | Ga0068863_100018013 | Ga0068863_1000180136 | 213 |
| 64 | 3300006058 | Ga0075432_10017447 | Ga0075432_100174473 | 213 |
| 65 | 3300006353 | Ga0075370_10038245 | Ga0075370_100382453 | 213 |
| 66 | 3300009093 | Ga0105240_10021718 | Ga0105240_100217186 | 213 |
| 67 | 3300009551 | Ga0105238_10097652 | Ga0105238_100976526 | 213 |
| 68 | 3300014326 | Ga0157380_10085151 | Ga0157380_100851511 | 213 |
| 69 | 3300025904 | Ga0207647_10104082 | Ga0207647_101040823 | 213 |
| 70 | 3300025904 | Ga0207647_10143217 | Ga0207647_101432173 | 213 |
| 71 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004127 | 213 |
| 72 | 3300025924 | Ga0207694_10009761 | Ga0207694_100097619 | 213 |
| 73 | 3300025925 | Ga0207650_10225536 | Ga0207650_102255362 | 213 |
| 74 | 3300025931 | Ga0207644_10144510 | Ga0207644_101445101 | 213 |
| 75 | 3300025949 | Ga0207667_10060493 | Ga0207667_100604934 | 213 |
| 76 | 3300025949 | Ga0207667_10084052 | Ga0207667_100840523 | 213 |
| 77 | 3300025949 | Ga0207667_10160702 | Ga0207667_101607024 | 213 |
| 78 | 3300025981 | Ga0207640_10001408 | Ga0207640_100014085 | 213 |
| 79 | 3300026041 | Ga0207639_10059793 | Ga0207639_100597933 | 213 |
| 80 | 3300026078 | Ga0207702_10018124 | Ga0207702_100181245 | 213 |
| 81 | 3300026088 | Ga0207641_10011616 | Ga0207641_100116161 | 213 |
| 82 | 3300026142 | Ga0207698_10000058 | Ga0207698_1000005864 | 213 |
| 83 | 3300026142 | Ga0207698_10207288 | Ga0207698_102072883 | 213 |
| 84 | 3300027907 | Ga0207428_10068855 | Ga0207428_100688555 | 213 |
| 85 | 3300031548 | Ga0307408_100033511 | Ga0307408_1000335116 | 213 |
| 86 | 3300031731 | Ga0307405_10015498 | Ga0307405_100154985 | 213 |
| 87 | 3300031824 | Ga0307413_10049509 | Ga0307413_100495093 | 213 |
| 88 | 3300031852 | Ga0307410_10017152 | Ga0307410_100171526 | 213 |
| 89 | 3300031901 | Ga0307406_10188619 | Ga0307406_101886192 | 213 |
| 90 | 3300031903 | Ga0307407_10238381 | Ga0307407_102383812 | 213 |
| 91 | 3300031911 | Ga0307412_10338605 | Ga0307412_103386052 | 213 |
| 92 | 3300031995 | Ga0307409_100219289 | Ga0307409_1002192893 | 213 |
| 93 | 3300032002 | Ga0307416_100056211 | Ga0307416_1000562112 | 213 |
| 94 | 3300032005 | Ga0307411_10055456 | Ga0307411_100554563 | 213 |
| 95 | 3300032126 | Ga0307415_100017801 | Ga0307415_1000178013 | 213 |
| 96 | 3300045051 | Ga0451576_1100674 | Ga0451576_1100674_138_785 | 213 |
| 97 | 3300046513 | Ga0495616_0098763 | Ga0495616_0098763_461_1111 | 213 |
| 98 | 3300048090 | Ga0495615_0000145 | Ga0495615_0000145_4749_5399 | 213 |
| 99 | 3300048903 | Ga0496100_0436834 | Ga0496100_0436834_106_756 | 213 |
| 100 | 3300048904 | Ga0496101_0115411 | Ga0496101_0115411_193_846 | 213 |
| 101 | 3300048911 | Ga0496108_0124428 | Ga0496108_0124428_511_1164 | 213 |
| 102 | 3300048915 | Ga0496112_0044793 | Ga0496112_0044793_2398_3051 | 213 |
| 103 | 3300048925 | Ga0496122_0001127 | Ga0496122_0001127_40422_41072 | 213 |
| 104 | 3300048926 | Ga0496123_0005504 | Ga0496123_0005504_1498_2148 | 213 |
| 105 | 3300048928 | Ga0496125_0178519 | Ga0496125_0178519_312_962 | 213 |
| 106 | 3300049770 | Ga0501273_022350 | Ga0501273_022350_134_781 | 213 |
| 107 | iso_pu_bacteria | 2643221688 | 2644496035 | 213 |
| 108 | iso_pu_bacteria | 2643221734 | 2644734761 | 213 |
| 109 | iso_pu_bacteria | 2989771324 | 2989773985 | 213 |
| 110 | iso_pu_bacteria | 8054558443 | 8054560623 | 213 |
| 111 | 3300005289 | Ga0065704_10082231 | Ga0065704_100822316 | 214 |
| 112 | 3300005330 | Ga0070690_100012391 | Ga0070690_1000123918 | 214 |
| 113 | 3300005331 | Ga0070670_100560945 | Ga0070670_1005609451 | 214 |
| 114 | 3300005335 | Ga0070666_10095113 | Ga0070666_100951133 | 214 |
| 115 | 3300005340 | Ga0070689_100060997 | Ga0070689_1000609974 | 214 |
| 116 | 3300005347 | Ga0070668_100274993 | Ga0070668_1002749932 | 214 |
| 117 | 3300005353 | Ga0070669_100000062 | Ga0070669_10000006259 | 214 |
| 118 | 3300005355 | Ga0070671_100000117 | Ga0070671_10000011726 | 214 |
| 119 | 3300005355 | Ga0070671_100010287 | Ga0070671_1000102874 | 214 |
| 120 | 3300005355 | Ga0070671_100303361 | Ga0070671_1003033612 | 214 |
| 121 | 3300005355 | Ga0070671_100408527 | Ga0070671_1004085272 | 214 |
| 122 | 3300005367 | Ga0070667_100254386 | Ga0070667_1002543862 | 214 |
| 123 | 3300005456 | Ga0070678_100327969 | Ga0070678_1003279692 | 214 |
| 124 | 3300005458 | Ga0070681_10018648 | Ga0070681_100186484 | 214 |
| 125 | 3300005466 | Ga0070685_10299081 | Ga0070685_102990812 | 214 |
| 126 | 3300005530 | Ga0070679_100042072 | Ga0070679_1000420721 | 214 |
| 127 | 3300005544 | Ga0070686_100012027 | Ga0070686_1000120275 | 214 |
| 128 | 3300005547 | Ga0070693_100114090 | Ga0070693_1001140902 | 214 |
| 129 | 3300005547 | Ga0070693_100180715 | Ga0070693_1001807152 | 214 |
| 130 | 3300005548 | Ga0070665_100138330 | Ga0070665_1001383302 | 214 |
| 131 | 3300005617 | Ga0068859_100017816 | Ga0068859_1000178165 | 214 |
| 132 | 3300005617 | Ga0068859_100257206 | Ga0068859_1002572062 | 214 |
| 133 | 3300005842 | Ga0068858_100010715 | Ga0068858_10001071511 | 214 |
| 134 | 3300005842 | Ga0068858_100042151 | Ga0068858_1000421516 | 214 |
| 135 | 3300005843 | Ga0068860_100219612 | Ga0068860_1002196123 | 214 |
| 136 | 3300005843 | Ga0068860_100651860 | Ga0068860_1006518602 | 214 |
| 137 | 3300006051 | Ga0075364_10000044 | Ga0075364_1000004424 | 214 |
| 138 | 3300006173 | Ga0070716_100558513 | Ga0070716_1005585131 | 214 |
| 139 | 3300006852 | Ga0075433_10484731 | Ga0075433_104847312 | 214 |
| 140 | 3300006871 | Ga0075434_100649135 | Ga0075434_1006491351 | 214 |
| 141 | 3300006881 | Ga0068865_100169780 | Ga0068865_1001697802 | 214 |
| 142 | 3300006931 | Ga0097620_100017816 | Ga0097620_1000178165 | 214 |
| 143 | 3300006931 | Ga0097620_100257195 | Ga0097620_1002571952 | 214 |
| 144 | 3300007076 | Ga0075435_100397104 | Ga0075435_1003971041 | 214 |
| 145 | 3300009147 | Ga0114129_11361538 | Ga0114129_113615382 | 214 |
| 146 | 3300009177 | Ga0105248_10068418 | Ga0105248_100684183 | 214 |
| 147 | 3300009553 | Ga0105249_11149672 | Ga0105249_111496721 | 214 |
| 148 | 3300013296 | Ga0157374_10125329 | Ga0157374_101253292 | 214 |
| 149 | 3300013306 | Ga0163162_10090493 | Ga0163162_100904932 | 214 |
| 150 | 3300014968 | Ga0157379_10124739 | Ga0157379_101247392 | 214 |
| 151 | 3300017792 | Ga0163161_10012196 | Ga0163161_100121967 | 214 |
| 152 | 3300025315 | Ga0207697_10075391 | Ga0207697_100753912 | 214 |
| 153 | 3300025903 | Ga0207680_10006416 | Ga0207680_100064167 | 214 |
| 154 | 3300025903 | Ga0207680_10093040 | Ga0207680_100930402 | 214 |
| 155 | 3300025912 | Ga0207707_10007774 | Ga0207707_100077748 | 214 |
| 156 | 3300025921 | Ga0207652_10129036 | Ga0207652_101290363 | 214 |
| 157 | 3300025923 | Ga0207681_10000540 | Ga0207681_1000054014 | 214 |
| 158 | 3300025925 | Ga0207650_10239669 | Ga0207650_102396692 | 214 |
| 159 | 3300025931 | Ga0207644_10000003 | Ga0207644_10000003312 | 214 |
| 160 | 3300025931 | Ga0207644_10005239 | Ga0207644_100052394 | 214 |
| 161 | 3300025939 | Ga0207665_10349542 | Ga0207665_103495421 | 214 |
| 162 | 3300025941 | Ga0207711_10166096 | Ga0207711_101660963 | 214 |
| 163 | 3300025941 | Ga0207711_10210205 | Ga0207711_102102053 | 214 |
| 164 | 3300026035 | Ga0207703_10001573 | Ga0207703_1000157319 | 214 |
| 165 | 3300026035 | Ga0207703_10370316 | Ga0207703_103703163 | 214 |
| 166 | 3300028381 | Ga0268264_10049526 | Ga0268264_100495266 | 214 |
| 167 | 3300028794 | Ga0307515_10110041 | Ga0307515_101100414 | 214 |
| 168 | 3300030731 | Ga0316177_1042136 | Ga0316177_10421363 | 214 |
| 169 | 3300030733 | Ga0314311_1100888 | Ga0314311_11008882 | 214 |
| 170 | 3300031456 | Ga0307513_10029371 | Ga0307513_100293715 | 214 |
| 171 | 3300032004 | Ga0307414_10040479 | Ga0307414_100404793 | 214 |
| 172 | 3300041404 | Ga0439436_0067848 | Ga0439436_0067848_313_960 | 214 |
| 173 | 3300041512 | Ga0451853_1755985 | Ga0451853_1755985_114_758 | 214 |
| 174 | 3300042461 | Ga0439460_0099074 | Ga0439460_0099074_271_921 | 214 |
| 175 | 3300045051 | Ga0451576_0425087 | Ga0451576_0425087_703_1362 | 214 |
| 176 | 3300046500 | Ga0495596_0000133 | Ga0495596_0000133_5151_5804 | 214 |
| 177 | 3300046512 | Ga0495610_0000269 | Ga0495610_0000269_48926_49579 | 214 |
| 178 | 3300046522 | Ga0495643_0000207 | Ga0495643_0000207_45220_45873 | 214 |
| 179 | 3300046537 | Ga0495598_0140397 | Ga0495598_0140397_61_705 | 214 |
| 180 | 3300047470 | Ga0495681_0068937 | Ga0495681_0068937_213_857 | 214 |
| 181 | 3300048905 | Ga0496102_0076863 | Ga0496102_0076863_1181_1846 | 214 |
| 182 | 3300048907 | Ga0496104_0128928 | Ga0496104_0128928_1520_2182 | 214 |
| 183 | 3300048907 | Ga0496104_0194617 | Ga0496104_0194617_900_1565 | 214 |
| 184 | 3300048908 | Ga0496105_0006029 | Ga0496105_0006029_6651_7313 | 214 |
| 185 | 3300048910 | Ga0496107_0002992 | Ga0496107_0002992_131_793 | 214 |
| 186 | 3300048912 | Ga0496109_0097123 | Ga0496109_0097123_1156_1821 | 214 |
| 187 | 3300048912 | Ga0496109_0431069 | Ga0496109_0431069_120_782 | 214 |
| 188 | 3300048913 | Ga0496110_0194221 | Ga0496110_0194221_507_1172 | 214 |
| 189 | 3300048914 | Ga0496111_0109638 | Ga0496111_0109638_25_687 | 214 |
| 190 | 3300048916 | Ga0496113_0014100 | Ga0496113_0014100_3243_3905 | 214 |
| 191 | 3300048918 | Ga0496115_0217790 | Ga0496115_0217790_186_851 | 214 |
| 192 | 3300048925 | Ga0496122_0005695 | Ga0496122_0005695_3670_4317 | 214 |
| 193 | 3300048926 | Ga0496123_0001597 | Ga0496123_0001597_19004_19651 | 214 |
| 194 | 3300048929 | Ga0496126_0005453 | Ga0496126_0005453_8177_8842 | 214 |
| 195 | 3300050489 | nmdc:mga03683_80671_c1 | nmdc:mga03683_80671_c1_516_1205 | 214 |
| 196 | 3300050512 | nmdc:mga0n895_359238_c1 | nmdc:mga0n895_359238_c1_127_777 | 214 |
| 197 | 3300050513 | nmdc:mga0rr50_114067_c1 | nmdc:mga0rr50_114067_c1_1422_2072 | 214 |
| 198 | 3300050513 | nmdc:mga0rr50_363428_c1 | nmdc:mga0rr50_363428_c1_544_1194 | 214 |
| 199 | 3300053078 | Ga0495612_0131865 | Ga0495612_0131865_404_1048 | 214 |
| 200 | 3300053091 | Ga0500647_0240330 | Ga0500647_0240330_52_696 | 214 |
| 201 | 3300053125 | Ga0500618_056362 | Ga0500618_056362_216_872 | 214 |
| 202 | 3300053140 | Ga0500573_0047092 | Ga0500573_0047092_412_1059 | 214 |
| 203 | 3300053148 | Ga0500590_001281 | Ga0500590_001281_4344_5000 | 214 |
| 204 | 3300053156 | Ga0500622_0150056 | Ga0500622_0150056_45_692 | 214 |
| 205 | 3300005290 | Ga0065712_10142843 | Ga0065712_101428432 | 215 |
| 206 | 3300005330 | Ga0070690_100440401 | Ga0070690_1004404012 | 215 |
| 207 | 3300005331 | Ga0070670_100136046 | Ga0070670_1001360462 | 215 |
| 208 | 3300005331 | Ga0070670_100401105 | Ga0070670_1004011051 | 215 |
| 209 | 3300005338 | Ga0068868_100122406 | Ga0068868_1001224063 | 215 |
| 210 | 3300005345 | Ga0070692_10006718 | Ga0070692_100067184 | 215 |
| 211 | 3300005353 | Ga0070669_100172946 | Ga0070669_1001729462 | 215 |
| 212 | 3300005355 | Ga0070671_100368995 | Ga0070671_1003689952 | 215 |
| 213 | 3300005367 | Ga0070667_100006960 | Ga0070667_10000696010 | 215 |
| 214 | 3300005367 | Ga0070667_100082486 | Ga0070667_1000824864 | 215 |
| 215 | 3300005444 | Ga0070694_100075440 | Ga0070694_1000754402 | 215 |
| 216 | 3300005457 | Ga0070662_100204300 | Ga0070662_1002043002 | 215 |
| 217 | 3300005458 | Ga0070681_10068828 | Ga0070681_100688282 | 215 |
| 218 | 3300005539 | Ga0068853_100144538 | Ga0068853_1001445384 | 215 |
| 219 | 3300005543 | Ga0070672_100107475 | Ga0070672_1001074753 | 215 |
| 220 | 3300005546 | Ga0070696_100129314 | Ga0070696_1001293143 | 215 |
| 221 | 3300005564 | Ga0070664_100006979 | Ga0070664_10000697910 | 215 |
| 222 | 3300005577 | Ga0068857_100114160 | Ga0068857_1001141603 | 215 |
| 223 | 3300005617 | Ga0068859_100270907 | Ga0068859_1002709073 | 215 |
| 224 | 3300005842 | Ga0068858_100011909 | Ga0068858_1000119092 | 215 |
| 225 | 3300006881 | Ga0068865_100415026 | Ga0068865_1004150262 | 215 |
| 226 | 3300006931 | Ga0097620_100116698 | Ga0097620_1001166982 | 215 |
| 227 | 3300006931 | Ga0097620_100270912 | Ga0097620_1002709123 | 215 |
| 228 | 3300009094 | Ga0111539_10043318 | Ga0111539_100433185 | 215 |
| 229 | 3300009553 | Ga0105249_10518060 | Ga0105249_105180601 | 215 |
| 230 | 3300013100 | Ga0157373_10150056 | Ga0157373_101500562 | 215 |
| 231 | 3300013306 | Ga0163162_10495639 | Ga0163162_104956392 | 215 |
| 232 | 3300014745 | Ga0157377_10251280 | Ga0157377_102512802 | 215 |
| 233 | 3300014968 | Ga0157379_10113016 | Ga0157379_101130165 | 215 |
| 234 | 3300025923 | Ga0207681_10448678 | Ga0207681_104486781 | 215 |
| 235 | 3300025925 | Ga0207650_10093134 | Ga0207650_100931342 | 215 |
| 236 | 3300025925 | Ga0207650_10818361 | Ga0207650_108183612 | 215 |
| 237 | 3300025938 | Ga0207704_10796825 | Ga0207704_107968251 | 215 |
| 238 | 3300025941 | Ga0207711_10011069 | Ga0207711_1001106910 | 215 |
| 239 | 3300025945 | Ga0207679_10001563 | Ga0207679_1000156310 | 215 |
| 240 | 3300025960 | Ga0207651_10409426 | Ga0207651_104094262 | 215 |
| 241 | 3300025981 | Ga0207640_10426600 | Ga0207640_104266002 | 215 |
| 242 | 3300025986 | Ga0207658_10024383 | Ga0207658_100243834 | 215 |
| 243 | 3300025986 | Ga0207658_10135602 | Ga0207658_101356023 | 215 |
| 244 | 3300026023 | Ga0207677_10285082 | Ga0207677_102850822 | 215 |
| 245 | 3300026035 | Ga0207703_10014199 | Ga0207703_100141992 | 215 |
| 246 | 3300026041 | Ga0207639_10015419 | Ga0207639_100154194 | 215 |
| 247 | 3300026041 | Ga0207639_10125636 | Ga0207639_101256364 | 215 |
| 248 | 3300026089 | Ga0207648_10062597 | Ga0207648_100625974 | 215 |
| 249 | 3300026089 | Ga0207648_10520719 | Ga0207648_105207191 | 215 |
| 250 | 3300028380 | Ga0268265_10713173 | Ga0268265_107131732 | 215 |
| 251 | 3300031901 | Ga0307406_10086216 | Ga0307406_100862162 | 215 |
| 252 | 3300031901 | Ga0307406_10440243 | Ga0307406_104402432 | 215 |
| 253 | 3300031995 | Ga0307409_101109646 | Ga0307409_1011096462 | 215 |
| 254 | 3300032002 | Ga0307416_100540607 | Ga0307416_1005406072 | 215 |
| 255 | 3300035085 | Ga0373929_0051197 | Ga0373929_0051197_118_771 | 215 |
| 256 | 3300035691 | Ga0373931_0199264 | Ga0373931_0199264_493_1146 | 215 |
| 257 | 3300037312 | Ga0395899_0059468 | Ga0395899_0059468_483_1136 | 215 |
| 258 | 3300037312 | Ga0395899_0264882 | Ga0395899_0264882_73_726 | 215 |
| 259 | 3300037418 | Ga0395900_0009530 | Ga0395900_0009530_5248_5901 | 215 |
| 260 | 3300037418 | Ga0395900_0449868 | Ga0395900_0449868_379_1032 | 215 |
| 261 | 3300037466 | Ga0395898_0721605 | Ga0395898_0721605_181_834 | 215 |
| 262 | 3300037471 | Ga0395905_0111198 | Ga0395905_0111198_999_1652 | 215 |
| 263 | 3300038443 | Ga0395901_0093551 | Ga0395901_0093551_2124_2777 | 215 |
| 264 | 3300038705 | Ga0237819_00202 | Ga0237819_00202_10566_11216 | 215 |
| 265 | 3300044658 | Ga0466972_0024653 | Ga0466972_0024653_937_1590 | 215 |
| 266 | 3300046506 | Ga0495583_0000248 | Ga0495583_0000248_8811_9464 | 215 |
| 267 | 3300046648 | Ga0495611_0021608 | Ga0495611_0021608_1560_2213 | 215 |
| 268 | 3300046665 | Ga0495661_0062122 | Ga0495661_0062122_72_725 | 215 |
| 269 | 3300046684 | Ga0495669_0140121 | Ga0495669_0140121_136_789 | 215 |
| 270 | 3300046691 | Ga0495670_0041227 | Ga0495670_0041227_843_1496 | 215 |
| 271 | 3300047469 | Ga0495673_0006032 | Ga0495673_0006032_1668_2321 | 215 |
| 272 | 3300047472 | Ga0495686_0006965 | Ga0495686_0006965_5527_6180 | 215 |
| 273 | 3300047472 | Ga0495686_0053879 | Ga0495686_0053879_47_700 | 215 |
| 274 | 3300048912 | Ga0496109_0602598 | Ga0496109_0602598_105_758 | 215 |
| 275 | 3300048913 | Ga0496110_0413098 | Ga0496110_0413098_506_1159 | 215 |
| 276 | 3300049823 | Ga0501044_0165448 | Ga0501044_0165448_41_694 | 215 |
| 277 | 3300050511 | nmdc:mga08y16_463276_c1 | nmdc:mga08y16_463276_c1_268_921 | 215 |
| 278 | 3300053103 | Ga0500555_001303 | Ga0500555_001303_7162_7815 | 215 |
| 279 | 3300053153 | Ga0500616_0017363 | Ga0500616_0017363_2141_2794 | 215 |
| 280 | 3300059505 | Ga0587083_0008217 | Ga0587083_0008217_427_1119 | 215 |
| 281 | 3300059640 | Ga0587067_006012 | Ga0587067_006012_450_1142 | 215 |
| 282 | 3300003320 | rootH2_10161428 | rootH2_101614281 | 216 |
| 283 | 3300005329 | Ga0070683_100284833 | Ga0070683_1002848332 | 216 |
| 284 | 3300005354 | Ga0070675_100480855 | Ga0070675_1004808552 | 216 |
| 285 | 3300005356 | Ga0070674_100020282 | Ga0070674_1000202824 | 216 |
| 286 | 3300005364 | Ga0070673_100107076 | Ga0070673_1001070762 | 216 |
| 287 | 3300005456 | Ga0070678_100235625 | Ga0070678_1002356252 | 216 |
| 288 | 3300005467 | Ga0070706_100226495 | Ga0070706_1002264952 | 216 |
| 289 | 3300005468 | Ga0070707_100211915 | Ga0070707_1002119152 | 216 |
| 290 | 3300005471 | Ga0070698_100052414 | Ga0070698_1000524142 | 216 |
| 291 | 3300005543 | Ga0070672_100785509 | Ga0070672_1007855091 | 216 |
| 292 | 3300005548 | Ga0070665_100019658 | Ga0070665_1000196586 | 216 |
| 293 | 3300005614 | Ga0068856_100086059 | Ga0068856_1000860592 | 216 |
| 294 | 3300005844 | Ga0068862_100023138 | Ga0068862_1000231385 | 216 |
| 295 | 3300009147 | Ga0114129_11818959 | Ga0114129_118189591 | 216 |
| 296 | 3300017792 | Ga0163161_10326612 | Ga0163161_103266121 | 216 |
| 297 | 3300021384 | Ga0213876_10056529 | Ga0213876_100565294 | 216 |
| 298 | 3300025922 | Ga0207646_10355600 | Ga0207646_103556001 | 216 |
| 299 | 3300025937 | Ga0207669_10090513 | Ga0207669_100905131 | 216 |
| 300 | 3300025944 | Ga0207661_10175326 | Ga0207661_101753264 | 216 |
| 301 | 3300025960 | Ga0207651_10125186 | Ga0207651_101251862 | 216 |
| 302 | 3300026121 | Ga0207683_10088623 | Ga0207683_100886232 | 216 |
| 303 | 3300026121 | Ga0207683_10460785 | Ga0207683_104607851 | 216 |
| 304 | 3300028379 | Ga0268266_10096824 | Ga0268266_100968243 | 216 |
| 305 | 3300031548 | Ga0307408_100074082 | Ga0307408_1000740824 | 216 |
| 306 | 3300031730 | Ga0307516_10334779 | Ga0307516_103347792 | 216 |
| 307 | 3300031731 | Ga0307405_10043036 | Ga0307405_100430364 | 216 |
| 308 | 3300031731 | Ga0307405_10110700 | Ga0307405_101107001 | 216 |
| 309 | 3300031824 | Ga0307413_10013290 | Ga0307413_100132906 | 216 |
| 310 | 3300031824 | Ga0307413_10036182 | Ga0307413_100361822 | 216 |
| 311 | 3300031824 | Ga0307413_10037496 | Ga0307413_100374961 | 216 |
| 312 | 3300031824 | Ga0307413_10252929 | Ga0307413_102529292 | 216 |
| 313 | 3300031852 | Ga0307410_10001948 | Ga0307410_100019483 | 216 |
| 314 | 3300031901 | Ga0307406_10240561 | Ga0307406_102405612 | 216 |
| 315 | 3300031903 | Ga0307407_10175876 | Ga0307407_101758761 | 216 |
| 316 | 3300031903 | Ga0307407_10270905 | Ga0307407_102709051 | 216 |
| 317 | 3300031911 | Ga0307412_10056628 | Ga0307412_100566285 | 216 |
| 318 | 3300031911 | Ga0307412_10132517 | Ga0307412_101325173 | 216 |
| 319 | 3300031911 | Ga0307412_10159425 | Ga0307412_101594251 | 216 |
| 320 | 3300031911 | Ga0307412_10255778 | Ga0307412_102557782 | 216 |
| 321 | 3300031995 | Ga0307409_100025854 | Ga0307409_1000258541 | 216 |
| 322 | 3300031995 | Ga0307409_100039945 | Ga0307409_1000399455 | 216 |
| 323 | 3300031995 | Ga0307409_100063199 | Ga0307409_1000631993 | 216 |
| 324 | 3300032002 | Ga0307416_100036987 | Ga0307416_1000369872 | 216 |
| 325 | 3300032002 | Ga0307416_101638362 | Ga0307416_1016383621 | 216 |
| 326 | 3300032004 | Ga0307414_10002184 | Ga0307414_100021842 | 216 |
| 327 | 3300032004 | Ga0307414_10046318 | Ga0307414_100463184 | 216 |
| 328 | 3300032004 | Ga0307414_10074760 | Ga0307414_100747601 | 216 |
| 329 | 3300032004 | Ga0307414_10160538 | Ga0307414_101605382 | 216 |
| 330 | 3300032004 | Ga0307414_10280049 | Ga0307414_102800492 | 216 |
| 331 | 3300032004 | Ga0307414_10530294 | Ga0307414_105302942 | 216 |
| 332 | 3300032004 | Ga0307414_10731055 | Ga0307414_107310552 | 216 |
| 333 | 3300032004 | Ga0307414_11186623 | Ga0307414_111866231 | 216 |
| 334 | 3300032005 | Ga0307411_10052358 | Ga0307411_100523582 | 216 |
| 335 | 3300032005 | Ga0307411_10141227 | Ga0307411_101412272 | 216 |
| 336 | 3300032005 | Ga0307411_10166327 | Ga0307411_101663273 | 216 |
| 337 | 3300032005 | Ga0307411_10241825 | Ga0307411_102418252 | 216 |
| 338 | 3300032005 | Ga0307411_10270842 | Ga0307411_102708422 | 216 |
| 339 | 3300032126 | Ga0307415_100136652 | Ga0307415_1001366522 | 216 |
| 340 | 3300032126 | Ga0307415_100359846 | Ga0307415_1003598462 | 216 |
| 341 | 3300032126 | Ga0307415_100673029 | Ga0307415_1006730292 | 216 |
| 342 | 3300035083 | Ga0373926_0002550 | Ga0373926_0002550_73_729 | 216 |
| 343 | 3300035692 | Ga0373935_0042507 | Ga0373935_0042507_937_1593 | 216 |
| 344 | 3300035695 | Ga0373927_0036961 | Ga0373927_0036961_396_1052 | 216 |
| 345 | 3300035725 | Ga0373947_0025977 | Ga0373947_0025977_1039_1695 | 216 |
| 346 | 3300037068 | Ga0373925_0091476 | Ga0373925_0091476_14_670 | 216 |
| 347 | 3300037466 | Ga0395898_0042315 | Ga0395898_0042315_3471_4133 | 216 |
| 348 | 3300037853 | Ga0436364_1314768 | Ga0436364_1314768_1679_2341 | 216 |
| 349 | 3300038443 | Ga0395901_0027674 | Ga0395901_0027674_1832_2560 | 216 |
| 350 | 3300038443 | Ga0395901_0059770 | Ga0395901_0059770_1268_1930 | 216 |
| 351 | 3300039437 | Ga0436365_0184254 | Ga0436365_0184254_2634_3296 | 216 |
| 352 | 3300039437 | Ga0436365_1544431 | Ga0436365_1544431_1823_2485 | 216 |
| 353 | 3300039438 | Ga0436360_0732223 | Ga0436360_0732223_842_1504 | 216 |
| 354 | 3300039450 | Ga0436363_0998443 | Ga0436363_0998443_1257_1919 | 216 |
| 355 | 3300045976 | Ga0466967_0584792 | Ga0466967_0584792_75_755 | 216 |
| 356 | 3300046472 | Ga0495580_0094020 | Ga0495580_0094020_1147_1803 | 216 |
| 357 | 3300046522 | Ga0495643_0030312 | Ga0495643_0030312_2186_2842 | 216 |
| 358 | 3300046537 | Ga0495598_0016150 | Ga0495598_0016150_1169_1825 | 216 |
| 359 | 3300046690 | Ga0495624_0140779 | Ga0495624_0140779_465_1121 | 216 |
| 360 | 3300048905 | Ga0496102_0000036 | Ga0496102_0000036_3908_4564 | 216 |
| 361 | 3300048906 | Ga0496103_0000074 | Ga0496103_0000074_3882_4538 | 216 |
| 362 | 3300048919 | Ga0496116_0016066 | Ga0496116_0016066_1746_2402 | 216 |
| 363 | 3300048920 | Ga0496117_0000093 | Ga0496117_0000093_3874_4530 | 216 |
| 364 | 3300048921 | Ga0496118_0000070 | Ga0496118_0000070_3878_4534 | 216 |
| 365 | 3300048923 | Ga0496120_0088057 | Ga0496120_0088057_162_818 | 216 |
| 366 | 3300048927 | Ga0496124_0000225 | Ga0496124_0000225_3785_4441 | 216 |
| 367 | 3300048928 | Ga0496125_0075360 | Ga0496125_0075360_1814_2464 | 216 |
| 368 | 3300049569 | Ga0501032_0196018 | Ga0501032_0196018_128_790 | 216 |
| 369 | 3300049572 | Ga0501036_0215064 | Ga0501036_0215064_865_1527 | 216 |
| 370 | 3300049581 | Ga0501047_0003609 | Ga0501047_0003609_8025_8687 | 216 |
| 371 | 3300049588 | Ga0501072_0420131 | Ga0501072_0420131_131_796 | 216 |
| 372 | 3300049682 | Ga0501252_016015 | Ga0501252_016015_253_909 | 216 |
| 373 | 3300049765 | Ga0501268_041219 | Ga0501268_041219_167_823 | 216 |
| 374 | 2162886007 | SwRhRL2b_contig_214473 | SwRhRL2b_0150.00012470 | 217 |
| 375 | 2162886007 | SwRhRL2b_contig_70411 | SwRhRL2b_0993.00012600 | 217 |
| 376 | 3300003187 | JGI25151J46595_10000056 | JGI25151J46595_1000005617 | 217 |
| 377 | 3300003323 | rootH1_10022069 | rootH1_100220695 | 217 |
| 378 | 3300003771 | Ga0055526_1000435 | Ga0055526_100043516 | 217 |
| 379 | 3300003775 | Ga0055524_1000100 | Ga0055524_100010020 | 217 |
| 380 | 3300003784 | Ga0055534_1021645 | Ga0055534_10216452 | 217 |
| 381 | 3300005289 | Ga0065704_10070942 | Ga0065704_100709426 | 217 |
| 382 | 3300005289 | Ga0065704_10082305 | Ga0065704_100823054 | 217 |
| 383 | 3300005293 | Ga0065715_10318238 | Ga0065715_103182382 | 217 |
| 384 | 3300005327 | Ga0070658_10478062 | Ga0070658_104780621 | 217 |
| 385 | 3300005330 | Ga0070690_100026583 | Ga0070690_1000265833 | 217 |
| 386 | 3300005331 | Ga0070670_100000395 | Ga0070670_10000039537 | 217 |
| 387 | 3300005331 | Ga0070670_100064289 | Ga0070670_1000642892 | 217 |
| 388 | 3300005331 | Ga0070670_100256591 | Ga0070670_1002565911 | 217 |
| 389 | 3300005334 | Ga0068869_100480851 | Ga0068869_1004808511 | 217 |
| 390 | 3300005335 | Ga0070666_10422377 | Ga0070666_104223771 | 217 |
| 391 | 3300005339 | Ga0070660_100139733 | Ga0070660_1001397332 | 217 |
| 392 | 3300005347 | Ga0070668_100008709 | Ga0070668_1000087097 | 217 |
| 393 | 3300005347 | Ga0070668_100113440 | Ga0070668_1001134404 | 217 |
| 394 | 3300005353 | Ga0070669_100001837 | Ga0070669_10000183710 | 217 |
| 395 | 3300005353 | Ga0070669_100493370 | Ga0070669_1004933701 | 217 |
| 396 | 3300005354 | Ga0070675_100979975 | Ga0070675_1009799751 | 217 |
| 397 | 3300005355 | Ga0070671_100001984 | Ga0070671_10000198411 | 217 |
| 398 | 3300005355 | Ga0070671_100042872 | Ga0070671_1000428725 | 217 |
| 399 | 3300005355 | Ga0070671_100106535 | Ga0070671_1001065353 | 217 |
| 400 | 3300005355 | Ga0070671_100961766 | Ga0070671_1009617661 | 217 |
| 401 | 3300005356 | Ga0070674_100217387 | Ga0070674_1002173871 | 217 |
| 402 | 3300005366 | Ga0070659_100273483 | Ga0070659_1002734832 | 217 |
| 403 | 3300005367 | Ga0070667_100003679 | Ga0070667_1000036797 | 217 |
| 404 | 3300005367 | Ga0070667_100424236 | Ga0070667_1004242362 | 217 |
| 405 | 3300005367 | Ga0070667_100797421 | Ga0070667_1007974211 | 217 |
| 406 | 3300005435 | Ga0070714_100010586 | Ga0070714_1000105862 | 217 |
| 407 | 3300005436 | Ga0070713_100674983 | Ga0070713_1006749832 | 217 |
| 408 | 3300005437 | Ga0070710_10476347 | Ga0070710_104763472 | 217 |
| 409 | 3300005456 | Ga0070678_100879069 | Ga0070678_1008790691 | 217 |
| 410 | 3300005457 | Ga0070662_100312809 | Ga0070662_1003128091 | 217 |
| 411 | 3300005459 | Ga0068867_100394838 | Ga0068867_1003948381 | 217 |
| 412 | 3300005530 | Ga0070679_100003981 | Ga0070679_1000039815 | 217 |
| 413 | 3300005535 | Ga0070684_100142881 | Ga0070684_1001428814 | 217 |
| 414 | 3300005543 | Ga0070672_100823439 | Ga0070672_1008234391 | 217 |
| 415 | 3300005546 | Ga0070696_100400395 | Ga0070696_1004003952 | 217 |
| 416 | 3300005548 | Ga0070665_100001533 | Ga0070665_1000015333 | 217 |
| 417 | 3300005563 | Ga0068855_100000356 | Ga0068855_10000035614 | 217 |
| 418 | 3300005563 | Ga0068855_100043316 | Ga0068855_1000433162 | 217 |
| 419 | 3300005564 | Ga0070664_100239158 | Ga0070664_1002391583 | 217 |
| 420 | 3300005616 | Ga0068852_100163118 | Ga0068852_1001631182 | 217 |
| 421 | 3300005618 | Ga0068864_100023410 | Ga0068864_1000234103 | 217 |
| 422 | 3300005618 | Ga0068864_100108198 | Ga0068864_1001081982 | 217 |
| 423 | 3300005719 | Ga0068861_100164930 | Ga0068861_1001649303 | 217 |
| 424 | 3300005841 | Ga0068863_100028095 | Ga0068863_1000280954 | 217 |
| 425 | 3300005841 | Ga0068863_100619569 | Ga0068863_1006195691 | 217 |
| 426 | 3300005841 | Ga0068863_100708248 | Ga0068863_1007082482 | 217 |
| 427 | 3300005842 | Ga0068858_100301450 | Ga0068858_1003014501 | 217 |
| 428 | 3300005843 | Ga0068860_100075264 | Ga0068860_1000752643 | 217 |
| 429 | 3300005843 | Ga0068860_100623402 | Ga0068860_1006234021 | 217 |
| 430 | 3300005844 | Ga0068862_100180347 | Ga0068862_1001803472 | 217 |
| 431 | 3300005844 | Ga0068862_100589092 | Ga0068862_1005890921 | 217 |
| 432 | 3300006028 | Ga0070717_10088939 | Ga0070717_100889394 | 217 |
| 433 | 3300006175 | Ga0070712_100153722 | Ga0070712_1001537222 | 217 |
| 434 | 3300006237 | Ga0097621_100036587 | Ga0097621_1000365872 | 217 |
| 435 | 3300006237 | Ga0097621_100160914 | Ga0097621_1001609144 | 217 |
| 436 | 3300006358 | Ga0068871_100422860 | Ga0068871_1004228602 | 217 |
| 437 | 3300009011 | Ga0105251_10000063 | Ga0105251_1000006357 | 217 |
| 438 | 3300009093 | Ga0105240_10009203 | Ga0105240_100092035 | 217 |
| 439 | 3300009093 | Ga0105240_10081775 | Ga0105240_100817752 | 217 |
| 440 | 3300009093 | Ga0105240_10753058 | Ga0105240_107530581 | 217 |
| 441 | 3300009093 | Ga0105240_10784260 | Ga0105240_107842601 | 217 |
| 442 | 3300009174 | Ga0105241_10681997 | Ga0105241_106819971 | 217 |
| 443 | 3300009176 | Ga0105242_10153018 | Ga0105242_101530182 | 217 |
| 444 | 3300009177 | Ga0105248_10087974 | Ga0105248_100879743 | 217 |
| 445 | 3300009177 | Ga0105248_10120770 | Ga0105248_101207702 | 217 |
| 446 | 3300009553 | Ga0105249_10132350 | Ga0105249_101323502 | 217 |
| 447 | 3300009553 | Ga0105249_11711493 | Ga0105249_117114931 | 217 |
| 448 | 3300010375 | Ga0105239_10078200 | Ga0105239_100782002 | 217 |
| 449 | 3300010375 | Ga0105239_11174973 | Ga0105239_111749731 | 217 |
| 450 | 3300013104 | Ga0157370_10028848 | Ga0157370_100288486 | 217 |
| 451 | 3300013105 | Ga0157369_10017984 | Ga0157369_100179847 | 217 |
| 452 | 3300013296 | Ga0157374_10496641 | Ga0157374_104966411 | 217 |
| 453 | 3300013296 | Ga0157374_10767290 | Ga0157374_107672902 | 217 |
| 454 | 3300013306 | Ga0163162_10040145 | Ga0163162_100401454 | 217 |
| 455 | 3300013306 | Ga0163162_10077288 | Ga0163162_100772884 | 217 |
| 456 | 3300013306 | Ga0163162_10186517 | Ga0163162_101865172 | 217 |
| 457 | 3300013308 | Ga0157375_10032682 | Ga0157375_100326825 | 217 |
| 458 | 3300014325 | Ga0163163_10056706 | Ga0163163_100567061 | 217 |
| 459 | 3300014325 | Ga0163163_10114786 | Ga0163163_101147863 | 217 |
| 460 | 3300014497 | Ga0182008_10078123 | Ga0182008_100781232 | 217 |
| 461 | 3300014968 | Ga0157379_10001896 | Ga0157379_1000189614 | 217 |
| 462 | 3300014969 | Ga0157376_10160214 | Ga0157376_101602142 | 217 |
| 463 | 3300015261 | Ga0182006_1031330 | Ga0182006_10313302 | 217 |
| 464 | 3300015262 | Ga0182007_10017568 | Ga0182007_100175684 | 217 |
| 465 | 3300015262 | Ga0182007_10039500 | Ga0182007_100395002 | 217 |
| 466 | 3300021377 | Ga0213874_10061695 | Ga0213874_100616952 | 217 |
| 467 | 3300025253 | Ga0209677_101004 | Ga0209677_1010044 | 217 |
| 468 | 3300025256 | Ga0209759_1007926 | Ga0209759_10079266 | 217 |
| 469 | 3300025273 | Ga0209673_1011303 | Ga0209673_10113033 | 217 |
| 470 | 3300025273 | Ga0209673_1036940 | Ga0209673_10369402 | 217 |
| 471 | 3300025291 | Ga0209675_1000959 | Ga0209675_10009598 | 217 |
| 472 | 3300025292 | Ga0209676_1044142 | Ga0209676_10441421 | 217 |
| 473 | 3300025294 | Ga0209025_1000016 | Ga0209025_1000016236 | 217 |
| 474 | 3300025295 | Ga0209564_1000035 | Ga0209564_1000035213 | 217 |
| 475 | 3300025298 | Ga0209050_1052408 | Ga0209050_10524081 | 217 |
| 476 | 3300025299 | Ga0209256_1000025 | Ga0209256_1000025233 | 217 |
| 477 | 3300025711 | Ga0207696_1005518 | Ga0207696_10055184 | 217 |
| 478 | 3300025735 | Ga0207713_1000204 | Ga0207713_100020437 | 217 |
| 479 | 3300025735 | Ga0207713_1075655 | Ga0207713_10756551 | 217 |
| 480 | 3300025898 | Ga0207692_10158026 | Ga0207692_101580262 | 217 |
| 481 | 3300025905 | Ga0207685_10034859 | Ga0207685_100348592 | 217 |
| 482 | 3300025906 | Ga0207699_10012257 | Ga0207699_100122575 | 217 |
| 483 | 3300025909 | Ga0207705_10189909 | Ga0207705_101899092 | 217 |
| 484 | 3300025909 | Ga0207705_10413589 | Ga0207705_104135891 | 217 |
| 485 | 3300025913 | Ga0207695_10008723 | Ga0207695_1000872312 | 217 |
| 486 | 3300025913 | Ga0207695_10106364 | Ga0207695_101063641 | 217 |
| 487 | 3300025915 | Ga0207693_10112833 | Ga0207693_101128333 | 217 |
| 488 | 3300025916 | Ga0207663_10091231 | Ga0207663_100912312 | 217 |
| 489 | 3300025918 | Ga0207662_10579709 | Ga0207662_105797091 | 217 |
| 490 | 3300025921 | Ga0207652_10323364 | Ga0207652_103233642 | 217 |
| 491 | 3300025923 | Ga0207681_10001538 | Ga0207681_1000153812 | 217 |
| 492 | 3300025923 | Ga0207681_10191752 | Ga0207681_101917522 | 217 |
| 493 | 3300025925 | Ga0207650_10001767 | Ga0207650_100017671 | 217 |
| 494 | 3300025925 | Ga0207650_10049687 | Ga0207650_100496873 | 217 |
| 495 | 3300025927 | Ga0207687_10948148 | Ga0207687_109481481 | 217 |
| 496 | 3300025928 | Ga0207700_10009194 | Ga0207700_100091945 | 217 |
| 497 | 3300025929 | Ga0207664_10001394 | Ga0207664_1000139419 | 217 |
| 498 | 3300025929 | Ga0207664_10021334 | Ga0207664_100213344 | 217 |
| 499 | 3300025931 | Ga0207644_10007334 | Ga0207644_100073345 | 217 |
| 500 | 3300025931 | Ga0207644_10017827 | Ga0207644_100178272 | 217 |
| 501 | 3300025931 | Ga0207644_10020831 | Ga0207644_100208314 | 217 |
| 502 | 3300025931 | Ga0207644_10043035 | Ga0207644_100430353 | 217 |
| 503 | 3300025933 | Ga0207706_10236788 | Ga0207706_102367882 | 217 |
| 504 | 3300025939 | Ga0207665_10005611 | Ga0207665_100056115 | 217 |
| 505 | 3300025940 | Ga0207691_10015977 | Ga0207691_100159774 | 217 |
| 506 | 3300025941 | Ga0207711_10282498 | Ga0207711_102824982 | 217 |
| 507 | 3300025945 | Ga0207679_10212924 | Ga0207679_102129242 | 217 |
| 508 | 3300025949 | Ga0207667_10000072 | Ga0207667_10000072137 | 217 |
| 509 | 3300025949 | Ga0207667_10035850 | Ga0207667_100358505 | 217 |
| 510 | 3300025960 | Ga0207651_10112369 | Ga0207651_101123691 | 217 |
| 511 | 3300025961 | Ga0207712_10132070 | Ga0207712_101320701 | 217 |
| 512 | 3300025972 | Ga0207668_10004384 | Ga0207668_100043845 | 217 |
| 513 | 3300025972 | Ga0207668_10010268 | Ga0207668_100102684 | 217 |
| 514 | 3300025986 | Ga0207658_10002671 | Ga0207658_100026718 | 217 |
| 515 | 3300025986 | Ga0207658_10257027 | Ga0207658_102570272 | 217 |
| 516 | 3300026035 | Ga0207703_10151271 | Ga0207703_101512712 | 217 |
| 517 | 3300026041 | Ga0207639_10165956 | Ga0207639_101659562 | 217 |
| 518 | 3300026088 | Ga0207641_10015462 | Ga0207641_100154624 | 217 |
| 519 | 3300026088 | Ga0207641_10856669 | Ga0207641_108566691 | 217 |
| 520 | 3300026088 | Ga0207641_10870980 | Ga0207641_108709801 | 217 |
| 521 | 3300026089 | Ga0207648_10436772 | Ga0207648_104367722 | 217 |
| 522 | 3300026095 | Ga0207676_10114020 | Ga0207676_101140202 | 217 |
| 523 | 3300026116 | Ga0207674_10271340 | Ga0207674_102713402 | 217 |
| 524 | 3300026118 | Ga0207675_100023706 | Ga0207675_1000237063 | 217 |
| 525 | 3300026121 | Ga0207683_10308999 | Ga0207683_103089992 | 217 |
| 526 | 3300026142 | Ga0207698_10069777 | Ga0207698_100697772 | 217 |
| 527 | 3300027907 | Ga0207428_10053263 | Ga0207428_100532633 | 217 |
| 528 | 3300028379 | Ga0268266_10037534 | Ga0268266_100375345 | 217 |
| 529 | 3300028379 | Ga0268266_10057731 | Ga0268266_100577313 | 217 |
| 530 | 3300028379 | Ga0268266_10149781 | Ga0268266_101497813 | 217 |
| 531 | 3300028379 | Ga0268266_10397297 | Ga0268266_103972972 | 217 |
| 532 | 3300028380 | Ga0268265_10133439 | Ga0268265_101334391 | 217 |
| 533 | 3300028380 | Ga0268265_10589106 | Ga0268265_105891062 | 217 |
| 534 | 3300028381 | Ga0268264_10054785 | Ga0268264_100547853 | 217 |
| 535 | 3300028381 | Ga0268264_11292816 | Ga0268264_112928161 | 217 |
| 536 | 3300028666 | Ga0265336_10000013 | Ga0265336_10000013229 | 217 |
| 537 | 3300028786 | Ga0307517_10000714 | Ga0307517_1000071444 | 217 |
| 538 | 3300028786 | Ga0307517_10029338 | Ga0307517_100293389 | 217 |
| 539 | 3300029957 | Ga0265324_10001467 | Ga0265324_100014679 | 217 |
| 540 | 3300031247 | Ga0265340_10081597 | Ga0265340_100815972 | 217 |
| 541 | 3300031456 | Ga0307513_10007960 | Ga0307513_100079608 | 217 |
| 542 | 3300031456 | Ga0307513_10067966 | Ga0307513_100679664 | 217 |
| 543 | 3300031901 | Ga0307406_10679323 | Ga0307406_106793232 | 217 |
| 544 | 3300031911 | Ga0307412_10034140 | Ga0307412_100341403 | 217 |
| 545 | 3300032004 | Ga0307414_10511138 | Ga0307414_105111381 | 217 |
| 546 | 3300032126 | Ga0307415_100466879 | Ga0307415_1004668792 | 217 |
| 547 | 3300033180 | Ga0307510_10018891 | Ga0307510_100188913 | 217 |
| 548 | 3300033547 | Ga0316212_1025267 | Ga0316212_10252671 | 217 |
| 549 | 3300035692 | Ga0373935_0005636 | Ga0373935_0005636_4030_4689 | 217 |
| 550 | 3300035725 | Ga0373947_0003512 | Ga0373947_0003512_4735_5394 | 217 |
| 551 | 3300036401 | Ga0373937_0064678 | Ga0373937_0064678_1443_2102 | 217 |
| 552 | 3300037068 | Ga0373925_0061155 | Ga0373925_0061155_585_1244 | 217 |
| 553 | 3300037312 | Ga0395899_0000059 | Ga0395899_0000059_186976_187635 | 217 |
| 554 | 3300037312 | Ga0395899_0058474 | Ga0395899_0058474_130_789 | 217 |
| 555 | 3300037312 | Ga0395899_0149841 | Ga0395899_0149841_156_815 | 217 |
| 556 | 3300037418 | Ga0395900_0000017 | Ga0395900_0000017_186976_187635 | 217 |
| 557 | 3300037466 | Ga0395898_0000030 | Ga0395898_0000030_186951_187610 | 217 |
| 558 | 3300037466 | Ga0395898_0128157 | Ga0395898_0128157_1560_2219 | 217 |
| 559 | 3300037471 | Ga0395905_0000056 | Ga0395905_0000056_21596_22255 | 217 |
| 560 | 3300037471 | Ga0395905_0021062 | Ga0395905_0021062_5225_5878 | 217 |
| 561 | 3300038443 | Ga0395901_0000015 | Ga0395901_0000015_181968_182627 | 217 |
| 562 | 3300038443 | Ga0395901_0008990 | Ga0395901_0008990_3364_4023 | 217 |
| 563 | 3300038443 | Ga0395901_0101554 | Ga0395901_0101554_1307_1966 | 217 |
| 564 | 3300039450 | Ga0436363_1232870 | Ga0436363_1232870_459_1112 | 217 |
| 565 | 3300042115 | Ga0450911_000004 | Ga0450911_000004_15394_16053 | 217 |
| 566 | 3300042156 | Ga0439446_0002115 | Ga0439446_0002115_503_1162 | 217 |
| 567 | 3300042532 | Ga0450893_0000541 | Ga0450893_0000541_2742_3401 | 217 |
| 568 | 3300042876 | Ga0451577_0003093 | Ga0451577_0003093_14529_15188 | 217 |
| 569 | 3300044712 | Ga0453684_0315649 | Ga0453684_0315649_161_820 | 217 |
| 570 | 3300046455 | Ga0495603_0132385 | Ga0495603_0132385_706_1365 | 217 |
| 571 | 3300046459 | Ga0495629_0003965 | Ga0495629_0003965_5622_6281 | 217 |
| 572 | 3300046460 | Ga0495638_0010420 | Ga0495638_0010420_3396_4055 | 217 |
| 573 | 3300046463 | Ga0495653_0000971 | Ga0495653_0000971_16067_16726 | 217 |
| 574 | 3300046472 | Ga0495580_0003388 | Ga0495580_0003388_11205_11864 | 217 |
| 575 | 3300046472 | Ga0495580_0161141 | Ga0495580_0161141_449_1108 | 217 |
| 576 | 3300046473 | Ga0495582_0311670 | Ga0495582_0311670_212_871 | 217 |
| 577 | 3300046477 | Ga0495664_0068698 | Ga0495664_0068698_1208_1867 | 217 |
| 578 | 3300046507 | Ga0495606_0068677 | Ga0495606_0068677_482_1141 | 217 |
| 579 | 3300046516 | Ga0495628_0005790 | Ga0495628_0005790_4335_4994 | 217 |
| 580 | 3300046516 | Ga0495628_0390702 | Ga0495628_0390702_303_962 | 217 |
| 581 | 3300046517 | Ga0495630_0022456 | Ga0495630_0022456_2086_2745 | 217 |
| 582 | 3300046528 | Ga0495642_0001985 | Ga0495642_0001985_5641_6300 | 217 |
| 583 | 3300046529 | Ga0495652_0006057 | Ga0495652_0006057_4974_5633 | 217 |
| 584 | 3300046531 | Ga0495665_0000517 | Ga0495665_0000517_2928_3587 | 217 |
| 585 | 3300046536 | Ga0495587_0063821 | Ga0495587_0063821_1082_1741 | 217 |
| 586 | 3300046543 | Ga0495645_0061554 | Ga0495645_0061554_842_1501 | 217 |
| 587 | 3300046616 | Ga0495668_0073805 | Ga0495668_0073805_1062_1721 | 217 |
| 588 | 3300046642 | Ga0495634_0149495 | Ga0495634_0149495_53_712 | 217 |
| 589 | 3300046648 | Ga0495611_0069385 | Ga0495611_0069385_432_1094 | 217 |
| 590 | 3300046660 | Ga0495625_0088227 | Ga0495625_0088227_181_843 | 217 |
| 591 | 3300046660 | Ga0495625_0390709 | Ga0495625_0390709_128_787 | 217 |
| 592 | 3300046663 | Ga0495635_0004635 | Ga0495635_0004635_1225_1884 | 217 |
| 593 | 3300046679 | Ga0495623_0001766 | Ga0495623_0001766_3037_3696 | 217 |
| 594 | 3300046680 | Ga0495646_0006311 | Ga0495646_0006311_6542_7201 | 217 |
| 595 | 3300046684 | Ga0495669_0203694 | Ga0495669_0203694_157_816 | 217 |
| 596 | 3300046694 | Ga0495649_0000649 | Ga0495649_0000649_2739_3404 | 217 |
| 597 | 3300047319 | Ga0495674_0002426 | Ga0495674_0002426_1471_2130 | 217 |
| 598 | 3300047322 | Ga0495680_0002387 | Ga0495680_0002387_17523_18182 | 217 |
| 599 | 3300047445 | Ga0495677_0013823 | Ga0495677_0013823_14_673 | 217 |
| 600 | 3300047445 | Ga0495677_0091936 | Ga0495677_0091936_369_1031 | 217 |
| 601 | 3300047673 | Ga0495593_0000294 | Ga0495593_0000294_14468_15127 | 217 |
| 602 | 3300048088 | Ga0495602_0001221 | Ga0495602_0001221_15840_16499 | 217 |
| 603 | 3300048903 | Ga0496100_0033901 | Ga0496100_0033901_856_1509 | 217 |
| 604 | 3300048905 | Ga0496102_0001749 | Ga0496102_0001749_9325_9978 | 217 |
| 605 | 3300048905 | Ga0496102_0331510 | Ga0496102_0331510_559_1218 | 217 |
| 606 | 3300048906 | Ga0496103_0000180 | Ga0496103_0000180_8970_9623 | 217 |
| 607 | 3300048907 | Ga0496104_0000744 | Ga0496104_0000744_3115_3768 | 217 |
| 608 | 3300048907 | Ga0496104_0073477 | Ga0496104_0073477_948_1607 | 217 |
| 609 | 3300048907 | Ga0496104_0131197 | Ga0496104_0131197_172_828 | 217 |
| 610 | 3300048908 | Ga0496105_0672057 | Ga0496105_0672057_23_679 | 217 |
| 611 | 3300048908 | Ga0496105_0746487 | Ga0496105_0746487_48_707 | 217 |
| 612 | 3300048909 | Ga0496106_0327380 | Ga0496106_0327380_362_1021 | 217 |
| 613 | 3300048910 | Ga0496107_0016944 | Ga0496107_0016944_2778_3431 | 217 |
| 614 | 3300048910 | Ga0496107_0498716 | Ga0496107_0498716_144_803 | 217 |
| 615 | 3300048911 | Ga0496108_0034048 | Ga0496108_0034048_1601_2260 | 217 |
| 616 | 3300048911 | Ga0496108_0256350 | Ga0496108_0256350_275_934 | 217 |
| 617 | 3300048912 | Ga0496109_0102783 | Ga0496109_0102783_773_1432 | 217 |
| 618 | 3300048913 | Ga0496110_0046884 | Ga0496110_0046884_2898_3557 | 217 |
| 619 | 3300048915 | Ga0496112_0016770 | Ga0496112_0016770_2188_2841 | 217 |
| 620 | 3300048915 | Ga0496112_0022704 | Ga0496112_0022704_4454_5113 | 217 |
| 621 | 3300048916 | Ga0496113_0003090 | Ga0496113_0003090_2945_3598 | 217 |
| 622 | 3300048920 | Ga0496117_0000948 | Ga0496117_0000948_34604_35263 | 217 |
| 623 | 3300048920 | Ga0496117_0008584 | Ga0496117_0008584_8998_9651 | 217 |
| 624 | 3300048921 | Ga0496118_0033171 | Ga0496118_0033171_383_1036 | 217 |
| 625 | 3300048921 | Ga0496118_0155199 | Ga0496118_0155199_119_778 | 217 |
| 626 | 3300048922 | Ga0496119_0000956 | Ga0496119_0000956_24149_24802 | 217 |
| 627 | 3300048922 | Ga0496119_0000981 | Ga0496119_0000981_1403_2062 | 217 |
| 628 | 3300048923 | Ga0496120_0001723 | Ga0496120_0001723_15176_15835 | 217 |
| 629 | 3300048923 | Ga0496120_0003868 | Ga0496120_0003868_7827_8480 | 217 |
| 630 | 3300048924 | Ga0496121_0010576 | Ga0496121_0010576_8636_9289 | 217 |
| 631 | 3300048925 | Ga0496122_0000928 | Ga0496122_0000928_32819_33478 | 217 |
| 632 | 3300048925 | Ga0496122_0007341 | Ga0496122_0007341_8778_9431 | 217 |
| 633 | 3300048926 | Ga0496123_0000695 | Ga0496123_0000695_34674_35333 | 217 |
| 634 | 3300048926 | Ga0496123_0037545 | Ga0496123_0037545_148_801 | 217 |
| 635 | 3300048927 | Ga0496124_0000535 | Ga0496124_0000535_13379_14032 | 217 |
| 636 | 3300048927 | Ga0496124_0000901 | Ga0496124_0000901_15632_16291 | 217 |
| 637 | 3300048927 | Ga0496124_0133967 | Ga0496124_0133967_492_1154 | 217 |
| 638 | 3300048928 | Ga0496125_0102566 | Ga0496125_0102566_1306_2001 | 217 |
| 639 | 3300048929 | Ga0496126_0000173 | Ga0496126_0000173_8958_9611 | 217 |
| 640 | 3300048929 | Ga0496126_0049678 | Ga0496126_0049678_2458_3117 | 217 |
| 641 | 3300048929 | Ga0496126_0229263 | Ga0496126_0229263_703_1362 | 217 |
| 642 | 3300049569 | Ga0501032_0018311 | Ga0501032_0018311_3679_4338 | 217 |
| 643 | 3300049571 | Ga0501034_0001639 | Ga0501034_0001639_3315_3968 | 217 |
| 644 | 3300049571 | Ga0501034_0971483 | Ga0501034_0971483_24_683 | 217 |
| 645 | 3300049575 | Ga0501039_0422023 | Ga0501039_0422023_21_680 | 217 |
| 646 | 3300049705 | Ga0501225_0000130 | Ga0501225_0000130_20698_21357 | 217 |
| 647 | 3300049823 | Ga0501044_0001364 | Ga0501044_0001364_13412_14065 | 217 |
| 648 | 3300049853 | Ga0501226_000003 | Ga0501226_000003_44334_44993 | 217 |
| 649 | 3300050508 | nmdc:mga09592_460880_c1 | nmdc:mga09592_460880_c1_153_857 | 217 |
| 650 | 3300050510 | nmdc:mga06r32_669674_c1 | nmdc:mga06r32_669674_c1_19_678 | 217 |
| 651 | 3300050511 | nmdc:mga08y16_78535_c1 | nmdc:mga08y16_78535_c1_2508_3212 | 217 |
| 652 | 3300050512 | nmdc:mga0n895_89701_c1 | nmdc:mga0n895_89701_c1_1897_2556 | 217 |
| 653 | 3300053087 | Ga0500643_004924 | Ga0500643_004924_4465_5124 | 217 |
| 654 | 3300053090 | Ga0500646_0164786 | Ga0500646_0164786_69_728 | 217 |
| 655 | 3300053109 | Ga0500569_120541 | Ga0500569_120541_46_699 | 217 |
| 656 | 3300053119 | Ga0500595_004721 | Ga0500595_004721_1874_2533 | 217 |
| 657 | 3300053131 | Ga0500652_085101 | Ga0500652_085101_219_872 | 217 |
| 658 | 3300053138 | Ga0500564_061390 | Ga0500564_061390_58_717 | 217 |
| 659 | 3300053727 | Ga0500611_018524 | Ga0500611_018524_492_1151 | 217 |
| 660 | 3300053730 | Ga0500645_001601 | Ga0500645_001601_10552_11211 | 217 |
| 661 | 3300053730 | Ga0500645_043241 | Ga0500645_043241_44_703 | 217 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4qq7-assembly1.cif.gz_B | crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione | 0.8881 | 1 | 199 |
| 3mdk-assembly1.cif.gz_A | structure of stringent starvation protein a (sspa) from pseudomonas putida | 0.8849 | 3 | 198 |
| 4n0v-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 | 0.8817 | 4 | 195 |
| 1k0d-assembly1.cif.gz_A | ure2p in complex with glutathione | 0.8764 | 2 | 198 |
| 4mk3-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from cupriavidus metallidurans ch34, target efi-507362, with bound glutathione sulfinic acid (gso2h) | 0.8758 | 4 | 198 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1JZD9_114_209_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9132 | 1 | 75 | 3.40.30.10 |
| af_I1KAF0_1_75_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.894 | 4 | 73 | 3.40.30.10 |
| af_Q4DKI7_229_312_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8933 | 5 | 85 | 3.40.30.10 |
| af_P0ACA3_4_88_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8912 | 2 | 78 | 3.40.30.10 |
| af_Q7JYX0_7_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.8898 | 5 | 75 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V3PRV6-F1-model_v4 | Glutathione S-transferase | 0.992 | 2 | 217 |
GO:0016740
|
| AF-A0A2S5MK32-F1-model_v4 | Glutathione S-transferase | 0.9893 | 97 | 217 |
GO:0016740
|
| AF-A0A0Q5V3F2-F1-model_v4 | Glutathione S-transferase | 0.9883 | 4 | 217 |
GO:0016740
|
| AF-A0A6M4GF70-F1-model_v4 | Glutathione S-transferase family protein | 0.986 | 4 | 211 |
GO:0016740
|
| AF-A0A4Q3N107-F1-model_v4 | Glutathione S-transferase family protein | 0.9848 | 81 | 211 |
GO:0016740
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar