F473342

General Info

Members Datasets Scaffolds Average Seq Length
660 323 659 390

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10016809|Ga0265338_100168093
Length 391
Sequence MTAPAVLALADGSIFRGHSIGAPGNTTGEVVFNTAITGYQEILTDPSYARQIVTLTYPHIGNTGVTPEDMESSQIYAAGLVVRDLSLVPSSWRASGSLNEFLLRGRIVAIAGIDTRRLTRLLREKGAQAGCIMTGEKMDETAAVRAARAFPGLKGMDLAKVVTTRAPYQWNDGSIGRDAAPVRAQQRLHVVAYDYGIKRNILRLISDQGCRVTVVPASTTSADVLALNPDGVFLSNGPGDPEPCDYAIKAIAELLETDVPIFGICLGHQLLGLASGARTVKMKFGHHGANHPVQELATGRVMITSQNHGFAVDEATLPQNLVATHRSLFDGTLQGVARTDRSAFSFQGHPEASPGPHDLRPLFETFVQAMVRRLQQQLRALRSSRKQSAER

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
79 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
182 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
183 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
197 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
198 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
211 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
212 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
215 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
222 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
223 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
224 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
227 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
228 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
232 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
233 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
246 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
252 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
253 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
305 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
308 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
311 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
312 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
313 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
319 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.79
Metatranscriptomes 1.06
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 0
Rhizoplane 3.79
Rhizosphere 86.06
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_933874 2162886006 Bacteria 1426
2 JGI25159J45721_1005457 3300002987 Bacteria 3992
3 rootH1_10023252 3300003316 Bacteria 4050
4 rootH1_10113855 3300003323 Bacteria 1327
5 rootH1_10145992 3300003323 Bacteria 4286
6 Ga0065165_1000005 3300005262 Bacteria 370361
7 Ga0065712_10123532 3300005290 Bacteria 1637
8 Ga0065707_10083371 3300005295 Bacteria 9412
9 Ga0065707_10084245 3300005295 Bacteria 7466
10 Ga0065707_10086319 3300005295 Bacteria 5535
11 Ga0070683_100132795 3300005329 Bacteria 2356
12 Ga0070690_100006774 3300005330 Bacteria 6513
13 Ga0070690_100008754 3300005330 Bacteria 5843
14 Ga0070690_100038508 3300005330 Bacteria 3018
15 Ga0070690_100069449 3300005330 Bacteria 2286
16 Ga0070670_100000026 3300005331 Bacteria 187946
17 Ga0070670_100052826 3300005331 Bacteria 3490
18 Ga0068869_100001531 3300005334 Bacteria 13721
19 Ga0068869_100049289 3300005334 Bacteria 3048
20 Ga0070666_10004984 3300005335 Bacteria 8120
21 Ga0070666_10013909 3300005335 Bacteria 5113
22 Ga0070666_10021429 3300005335 Bacteria 4190
23 Ga0070666_10063371 3300005335 Bacteria 2506
24 Ga0070666_10080748 3300005335 Bacteria 2223
25 Ga0070666_10097785 3300005335 Bacteria 2021
26 Ga0070680_100064698 3300005336 Bacteria 2997
27 Ga0070680_100092700 3300005336 Bacteria 2502
28 Ga0070680_100124261 3300005336 Bacteria 2155
29 Ga0070682_100016908 3300005337 Bacteria 4246
30 Ga0070682_100085373 3300005337 Bacteria 2053
31 Ga0068868_100003997 3300005338 Bacteria 10290
32 Ga0068868_100021382 3300005338 Bacteria 4871
33 Ga0070689_100000263 3300005340 Bacteria 30207
34 Ga0070689_100008129 3300005340 Bacteria 7372
35 Ga0070687_100111430 3300005343 Bacteria 1549
36 Ga0070661_100090912 3300005344 Bacteria 2260
37 Ga0070661_100102142 3300005344 Bacteria 2134
38 Ga0070692_10066758 3300005345 Bacteria 1908
39 Ga0070668_100004213 3300005347 Bacteria 10667
40 Ga0070669_100008527 3300005353 Bacteria 7317
41 Ga0070675_100001875 3300005354 Bacteria 15503
42 Ga0070675_100021713 3300005354 Bacteria 5128
43 Ga0070671_100001253 3300005355 Bacteria 19029
44 Ga0070671_100005822 3300005355 Bacteria 9818
45 Ga0070671_100008250 3300005355 Bacteria 8335
46 Ga0070671_100010104 3300005355 Bacteria 7580
47 Ga0070671_100010526 3300005355 Bacteria 7425
48 Ga0070674_100241757 3300005356 Bacteria 1414
49 Ga0070673_100135847 3300005364 Bacteria 2070
50 Ga0070667_100000002 3300005367 Bacteria 504831
51 Ga0070667_100000720 3300005367 Bacteria 31810
52 Ga0070667_100003642 3300005367 Bacteria 13114
53 Ga0070667_100072368 3300005367 Bacteria 2937
54 Ga0070709_10010657 3300005434 Bacteria 5097
55 Ga0070709_10012762 3300005434 Bacteria 4707
56 Ga0070714_100195152 3300005435 Bacteria 1849
57 Ga0070713_100004316 3300005436 Bacteria 9531
58 Ga0070713_100016072 3300005436 Bacteria 5620
59 Ga0070710_10003683 3300005437 Bacteria 7249
60 Ga0070705_100027352 3300005440 Bacteria 3113
61 Ga0070700_100011270 3300005441 Bacteria 4949
62 Ga0070700_100080301 3300005441 Bacteria 2104
63 Ga0070694_100099900 3300005444 Bacteria 2051
64 Ga0070694_100245692 3300005444 Bacteria 1352
65 Ga0070663_100093389 3300005455 Bacteria 2232
66 Ga0070678_100070124 3300005456 Bacteria 2619
67 Ga0070662_100042633 3300005457 Bacteria 3242
68 Ga0070662_100091203 3300005457 Bacteria 2288
69 Ga0070681_10014959 3300005458 Bacteria 7715
70 Ga0068867_100017933 3300005459 Bacteria 5030
71 Ga0070685_10000017 3300005466 Bacteria 110716
72 Ga0070685_10009087 3300005466 Bacteria 5128
73 Ga0070685_10024484 3300005466 Bacteria 3316
74 Ga0070679_100006742 3300005530 Bacteria 10709
75 Ga0070679_100012588 3300005530 Bacteria 8088
76 Ga0070679_100081686 3300005530 Bacteria 3221
77 Ga0070679_100189949 3300005530 Bacteria 2023
78 Ga0070684_100179436 3300005535 Bacteria 1925
79 Ga0068853_100093337 3300005539 Bacteria 2649
80 Ga0070672_100069104 3300005543 Bacteria 2803
81 Ga0070672_100077217 3300005543 Bacteria 2662
82 Ga0070672_100083583 3300005543 Bacteria 2563
83 Ga0070686_100010277 3300005544 Bacteria 5272
84 Ga0070695_100151994 3300005545 Bacteria 1616
85 Ga0070665_100003917 3300005548 Bacteria 15715
86 Ga0070665_100005912 3300005548 Bacteria 12536
87 Ga0070665_100006479 3300005548 Bacteria 11908
88 Ga0070665_100026780 3300005548 Bacteria 5807
89 Ga0070665_100084241 3300005548 Bacteria 3184
90 Ga0070665_100114571 3300005548 Bacteria 2698
91 Ga0068855_100002113 3300005563 Bacteria 24577
92 Ga0068855_100002310 3300005563 Bacteria 23575
93 Ga0068855_100004233 3300005563 Bacteria 17522
94 Ga0068855_100008348 3300005563 Bacteria 12524
95 Ga0068855_100172081 3300005563 Bacteria 2452
96 Ga0070664_100004667 3300005564 Bacteria 10997
97 Ga0070664_100014593 3300005564 Bacteria 6409
98 Ga0070664_100123586 3300005564 Bacteria 2268
99 Ga0068857_100055415 3300005577 Bacteria 3519
100 Ga0068854_100056225 3300005578 Bacteria 2835
101 Ga0068856_100004637 3300005614 Bacteria 13653
102 Ga0068856_100039178 3300005614 Bacteria 4652
103 Ga0068856_100074697 3300005614 Bacteria 3357
104 Ga0068856_100121331 3300005614 Bacteria 2615
105 Ga0070702_100000859 3300005615 Bacteria 11745
106 Ga0070702_100017081 3300005615 Bacteria 3736
107 Ga0070702_100178487 3300005615 Bacteria 1388
108 Ga0068852_100171413 3300005616 Bacteria 2034
109 Ga0068859_100000874 3300005617 Bacteria 30722
110 Ga0068859_100019271 3300005617 Bacteria 6854
111 Ga0068859_100026348 3300005617 Bacteria 5829
112 Ga0068859_100130588 3300005617 Bacteria 2583
113 Ga0068859_100230198 3300005617 Bacteria 1941
114 Ga0068864_100000002 3300005618 Bacteria 658857
115 Ga0068864_100005830 3300005618 Bacteria 10101
116 Ga0068864_100018543 3300005618 Bacteria 5816
117 Ga0068864_100061846 3300005618 Bacteria 3243
118 Ga0068866_10033150 3300005718 Bacteria 2503
119 Ga0068866_10076338 3300005718 Bacteria 1786
120 Ga0068861_100014180 3300005719 Bacteria 5590
121 Ga0068861_100015877 3300005719 Bacteria 5317
122 Ga0068861_100104874 3300005719 Bacteria 2256
123 Ga0068870_10002121 3300005840 Bacteria 8212
124 Ga0068863_100006917 3300005841 Bacteria 11116
125 Ga0068863_100007301 3300005841 Bacteria 10824
126 Ga0068863_100012364 3300005841 Bacteria 8244
127 Ga0068863_100013946 3300005841 Bacteria 7747
128 Ga0068863_100020718 3300005841 Bacteria 6280
129 Ga0068863_100130265 3300005841 Bacteria 2401
130 Ga0068858_100001638 3300005842 Bacteria 22845
131 Ga0068858_100004005 3300005842 Bacteria 14540
132 Ga0068858_100013113 3300005842 Bacteria 7817
133 Ga0068858_100017248 3300005842 Bacteria 6773
134 Ga0068858_100031011 3300005842 Bacteria 4965
135 Ga0068858_100084944 3300005842 Bacteria 2944
136 Ga0068860_100004745 3300005843 Bacteria 13852
137 Ga0068860_100017392 3300005843 Bacteria 7005
138 Ga0068860_100019554 3300005843 Bacteria 6565
139 Ga0068860_100035152 3300005843 Bacteria 4808
140 Ga0068860_100036508 3300005843 Bacteria 4708
141 Ga0068860_100040591 3300005843 Bacteria 4447
142 Ga0068860_100105850 3300005843 Bacteria 2686
143 Ga0068860_100202558 3300005843 Bacteria 1924
144 Ga0068862_100011434 3300005844 Bacteria 7327
145 Ga0068862_100017468 3300005844 Bacteria 5976
146 Ga0081455_10000043 3300005937 Bacteria 132283
147 Ga0081455_10041380 3300005937 Bacteria 4052
148 Ga0081455_10215988 3300005937 Bacteria 1425
149 Ga0081539_10000046 3300005985 Bacteria 275677
150 Ga0070717_10027349 3300006028 Bacteria 4558
151 Ga0070712_100002659 3300006175 Bacteria 11030
152 Ga0070712_100022076 3300006175 Bacteria 4188
153 Ga0097621_100009176 3300006237 Bacteria 7170
154 Ga0097621_100029908 3300006237 Bacteria 4306
155 Ga0097621_100034118 3300006237 Bacteria 4057
156 Ga0097621_100102463 3300006237 Bacteria 2410
157 Ga0097621_100119956 3300006237 Bacteria 2229
158 Ga0097621_100221094 3300006237 Bacteria 1650
159 Ga0068871_100063106 3300006358 Bacteria 3029
160 Ga0068871_100127377 3300006358 Bacteria 2156
161 Ga0068871_100137679 3300006358 Bacteria 2074
162 Ga0068871_100281303 3300006358 Bacteria 1455
163 Ga0075428_100003215 3300006844 Bacteria 17873
164 Ga0075428_100009769 3300006844 Bacteria 10665
165 Ga0075428_100058436 3300006844 Bacteria 4222
166 Ga0075430_100005652 3300006846 Bacteria 10560
167 Ga0075430_100088134 3300006846 Bacteria 2597
168 Ga0075431_100001747 3300006847 Bacteria 20431
169 Ga0075431_100009224 3300006847 Bacteria 9901
170 Ga0075433_10133273 3300006852 Bacteria 2208
171 Ga0075429_100010602 3300006880 Bacteria 7974
172 Ga0075429_100020882 3300006880 Bacteria 5682
173 Ga0068865_100011078 3300006881 Bacteria 5632
174 Ga0068865_100065293 3300006881 Bacteria 2563
175 Ga0097620_100000873 3300006931 Bacteria 30722
176 Ga0097620_100019273 3300006931 Bacteria 6854
177 Ga0097620_100026348 3300006931 Bacteria 5829
178 Ga0097620_100130574 3300006931 Bacteria 2583
179 Ga0097620_100230199 3300006931 Bacteria 1941
180 Ga0099794_10074571 3300007265 Bacteria 1666
181 Ga0099795_10000064 3300007788 Bacteria 18756
182 Ga0105250_10000023 3300009092 Bacteria 219389
183 Ga0105240_10010435 3300009093 Bacteria 13050
184 Ga0105240_10022715 3300009093 Bacteria 8309
185 Ga0105240_10070901 3300009093 Bacteria 4310
186 Ga0105240_10115396 3300009093 Bacteria 3242
187 Ga0105240_10299647 3300009093 Bacteria 1839
188 Ga0111539_10015226 3300009094 Bacteria 9583
189 Ga0111539_10036722 3300009094 Bacteria 5921
190 Ga0111539_10180942 3300009094 Bacteria 2462
191 Ga0111539_10617544 3300009094 Bacteria 1262
192 Ga0105245_10003428 3300009098 Bacteria 14208
193 Ga0105245_10003531 3300009098 Bacteria 13979
194 Ga0105245_10024207 3300009098 Bacteria 5330
195 Ga0105247_10000812 3300009101 Bacteria 23804
196 Ga0105247_10023669 3300009101 Bacteria 3701
197 Ga0105243_10177901 3300009148 Bacteria 1848
198 Ga0105242_10024499 3300009176 Bacteria 4767
199 Ga0105248_10001274 3300009177 Bacteria 28163
200 Ga0105248_10010033 3300009177 Bacteria 10429
201 Ga0105248_10022613 3300009177 Bacteria 6977
202 Ga0105248_10048843 3300009177 Bacteria 4746
203 Ga0105248_10122635 3300009177 Bacteria 2932
204 Ga0105248_10134845 3300009177 Bacteria 2785
205 Ga0105248_10479878 3300009177 Bacteria 1401
206 Ga0105237_10072969 3300009545 Bacteria 3425
207 Ga0105237_10222904 3300009545 Bacteria 1886
208 Ga0105237_10250118 3300009545 Bacteria 1775
209 Ga0105238_10012704 3300009551 Bacteria 8499
210 Ga0105238_10112485 3300009551 Bacteria 2702
211 Ga0105238_10182229 3300009551 Bacteria 2077
212 Ga0105238_10199339 3300009551 Bacteria 1977
213 Ga0105249_10021727 3300009553 Bacteria 5745
214 Ga0105249_10030234 3300009553 Bacteria 4895
215 Ga0105249_10048911 3300009553 Bacteria 3856
216 Ga0105249_10130073 3300009553 Bacteria 2402
217 Ga0105249_10151161 3300009553 Bacteria 2235
218 Ga0099796_10000064 3300010159 Bacteria 18870
219 Ga0105239_10045649 3300010375 Bacteria 4802
220 Ga0105239_10090904 3300010375 Bacteria 3368
221 Ga0105239_10275151 3300010375 Bacteria 1894
222 Ga0105239_10521620 3300010375 Bacteria 1352
223 Ga0105246_10003632 3300011119 Bacteria 9335
224 Ga0157370_10358494 3300013104 Bacteria 1344
225 Ga0157369_10020260 3300013105 Bacteria 7434
226 Ga0157369_10091026 3300013105 Bacteria 3257
227 Ga0157374_10002676 3300013296 Bacteria 14991
228 Ga0157374_10022975 3300013296 Bacteria 5569
229 Ga0157374_10062863 3300013296 Bacteria 3481
230 Ga0157374_10165244 3300013296 Bacteria 2157
231 Ga0157378_10004389 3300013297 Bacteria 12416
232 Ga0157378_10264533 3300013297 Bacteria 1652
233 Ga0163162_10028719 3300013306 Bacteria 5506
234 Ga0163162_10041271 3300013306 Bacteria 4616
235 Ga0163162_10042631 3300013306 Bacteria 4543
236 Ga0163162_10063692 3300013306 Bacteria 3731
237 Ga0163162_10139635 3300013306 Bacteria 2535
238 Ga0163162_10198055 3300013306 Bacteria 2137
239 Ga0157372_10172491 3300013307 Bacteria 2502
240 Ga0157375_10006198 3300013308 Bacteria 10419
241 Ga0157375_10023229 3300013308 Bacteria 5718
242 Ga0157375_10033274 3300013308 Bacteria 4897
243 Ga0157375_10058031 3300013308 Bacteria 3828
244 Ga0157375_10063704 3300013308 Bacteria 3669
245 Ga0157375_10129546 3300013308 Bacteria 2641
246 Ga0163163_10000264 3300014325 Bacteria 52945
247 Ga0163163_10023635 3300014325 Bacteria 5835
248 Ga0163163_10062810 3300014325 Bacteria 3681
249 Ga0163163_10188056 3300014325 Bacteria 2113
250 Ga0157380_10010360 3300014326 Bacteria 6705
251 Ga0157380_10019037 3300014326 Bacteria 5110
252 Ga0157380_10024535 3300014326 Bacteria 4564
253 Ga0157377_10109972 3300014745 Bacteria 1655
254 Ga0157379_10000613 3300014968 Bacteria 28842
255 Ga0157379_10001382 3300014968 Bacteria 19853
256 Ga0157379_10001842 3300014968 Bacteria 17527
257 Ga0157379_10047538 3300014968 Bacteria 3828
258 Ga0157379_10113967 3300014968 Bacteria 2430
259 Ga0157379_10118190 3300014968 Bacteria 2384
260 Ga0157376_10037640 3300014969 Bacteria 3930
261 Ga0157376_10047753 3300014969 Bacteria 3536
262 Ga0213874_10000731 3300021377 Bacteria 6643
263 Ga0213876_10048231 3300021384 Bacteria 2251
264 Ga0209130_1000046 3300025284 Bacteria 236658
265 Ga0207696_1000098 3300025711 Bacteria 175181
266 Ga0207682_10075214 3300025893 Bacteria 1437
267 Ga0207692_10019072 3300025898 Bacteria 3093
268 Ga0207642_10073020 3300025899 Bacteria 1640
269 Ga0207710_10000200 3300025900 Bacteria 56100
270 Ga0207710_10005579 3300025900 Bacteria 5415
271 Ga0207688_10032245 3300025901 Bacteria 2895
272 Ga0207680_10005217 3300025903 Bacteria 6197
273 Ga0207680_10021698 3300025903 Bacteria 3478
274 Ga0207680_10023718 3300025903 Bacteria 3355
275 Ga0207680_10068797 3300025903 Bacteria 2185
276 Ga0207647_10053465 3300025904 Bacteria 2489
277 Ga0207699_10010612 3300025906 Bacteria 4631
278 Ga0207643_10012443 3300025908 Bacteria 4599
279 Ga0207643_10121589 3300025908 Bacteria 1547
280 Ga0207707_10000045 3300025912 Bacteria 122598
281 Ga0207707_10007017 3300025912 Bacteria 9824
282 Ga0207707_10012094 3300025912 Bacteria 7507
283 Ga0207695_10047075 3300025913 Bacteria 4567
284 Ga0207695_10052514 3300025913 Bacteria 4270
285 Ga0207695_10078512 3300025913 Bacteria 3349
286 Ga0207695_10170960 3300025913 Bacteria 2099
287 Ga0207695_10216300 3300025913 Bacteria 1825
288 Ga0207671_10017617 3300025914 Bacteria 5500
289 Ga0207693_10017711 3300025915 Bacteria 5681
290 Ga0207693_10178695 3300025915 Bacteria 1670
291 Ga0207663_10106937 3300025916 Bacteria 1891
292 Ga0207660_10000958 3300025917 Bacteria 19113
293 Ga0207660_10072962 3300025917 Bacteria 2501
294 Ga0207660_10145694 3300025917 Bacteria 1815
295 Ga0207662_10022281 3300025918 Bacteria 3630
296 Ga0207649_10039433 3300025920 Bacteria 2864
297 Ga0207649_10078078 3300025920 Bacteria 2135
298 Ga0207652_10010022 3300025921 Bacteria 7631
299 Ga0207652_10010582 3300025921 Bacteria 7425
300 Ga0207652_10036915 3300025921 Bacteria 4133
301 Ga0207652_10209774 3300025921 Bacteria 1754
302 Ga0207681_10002680 3300025923 Bacteria 11274
303 Ga0207681_10008163 3300025923 Bacteria 6400
304 Ga0207681_10020588 3300025923 Bacteria 4183
305 Ga0207681_10020824 3300025923 Bacteria 4162
306 Ga0207650_10000002 3300025925 Bacteria 1439222
307 Ga0207650_10048847 3300025925 Bacteria 3122
308 Ga0207650_10075060 3300025925 Bacteria 2550
309 Ga0207659_10003977 3300025926 Bacteria 8918
310 Ga0207659_10067596 3300025926 Bacteria 2596
311 Ga0207687_10084153 3300025927 Bacteria 2305
312 Ga0207687_10138625 3300025927 Bacteria 1843
313 Ga0207700_10041661 3300025928 Bacteria 3361
314 Ga0207664_10000585 3300025929 Bacteria 25440
315 Ga0207664_10015366 3300025929 Bacteria 5553
316 Ga0207664_10171775 3300025929 Bacteria 1856
317 Ga0207644_10002895 3300025931 Bacteria 11061
318 Ga0207644_10055538 3300025931 Bacteria 2854
319 Ga0207644_10069460 3300025931 Bacteria 2572
320 Ga0207706_10043252 3300025933 Bacteria 3992
321 Ga0207686_10148430 3300025934 Bacteria 1629
322 Ga0207670_10015580 3300025936 Bacteria 4546
323 Ga0207669_10120589 3300025937 Bacteria 1779
324 Ga0207704_10010821 3300025938 Bacteria 4467
325 Ga0207704_10074205 3300025938 Bacteria 2170
326 Ga0207665_10025451 3300025939 Bacteria 3905
327 Ga0207665_10040500 3300025939 Bacteria 3109
328 Ga0207691_10015457 3300025940 Bacteria 7258
329 Ga0207691_10029366 3300025940 Bacteria 5144
330 Ga0207691_10285172 3300025940 Bacteria 1421
331 Ga0207711_10000061 3300025941 Bacteria 125523
332 Ga0207711_10007410 3300025941 Bacteria 9182
333 Ga0207711_10013097 3300025941 Bacteria 6889
334 Ga0207711_10024939 3300025941 Bacteria 5015
335 Ga0207711_10052359 3300025941 Bacteria 3498
336 Ga0207711_10158717 3300025941 Bacteria 2045
337 Ga0207689_10005143 3300025942 Bacteria 11759
338 Ga0207689_10153252 3300025942 Bacteria 1900
339 Ga0207689_10212450 3300025942 Bacteria 1599
340 Ga0207689_10225858 3300025942 Bacteria 1547
341 Ga0207661_10042350 3300025944 Bacteria 3590
342 Ga0207679_10001408 3300025945 Bacteria 15155
343 Ga0207679_10030141 3300025945 Bacteria 3785
344 Ga0207667_10000887 3300025949 Bacteria 38097
345 Ga0207667_10001163 3300025949 Bacteria 33062
346 Ga0207667_10010839 3300025949 Bacteria 10632
347 Ga0207667_10061826 3300025949 Bacteria 3917
348 Ga0207651_10005853 3300025960 Bacteria 6356
349 Ga0207712_10015524 3300025961 Bacteria 4916
350 Ga0207712_10020847 3300025961 Bacteria 4298
351 Ga0207712_10029484 3300025961 Bacteria 3681
352 Ga0207640_10074899 3300025981 Bacteria 2292
353 Ga0207658_10000001 3300025986 Bacteria 1439333
354 Ga0207658_10010618 3300025986 Bacteria 6258
355 Ga0207658_10019133 3300025986 Bacteria 4735
356 Ga0207677_10020565 3300026023 Bacteria 4010
357 Ga0207677_10076897 3300026023 Bacteria 2378
358 Ga0207677_10106082 3300026023 Bacteria 2081
359 Ga0207703_10000919 3300026035 Bacteria 28682
360 Ga0207703_10001227 3300026035 Bacteria 23976
361 Ga0207703_10010064 3300026035 Bacteria 7414
362 Ga0207703_10017376 3300026035 Bacteria 5616
363 Ga0207703_10073501 3300026035 Bacteria 2829
364 Ga0207703_10117747 3300026035 Bacteria 2276
365 Ga0207703_10135430 3300026035 Bacteria 2132
366 Ga0207678_10023231 3300026067 Bacteria 5424
367 Ga0207708_10058644 3300026075 Bacteria 2937
368 Ga0207708_10081703 3300026075 Bacteria 2484
369 Ga0207702_10145648 3300026078 Bacteria 2149
370 Ga0207641_10001010 3300026088 Bacteria 28635
371 Ga0207641_10054966 3300026088 Bacteria 3380
372 Ga0207641_10076110 3300026088 Bacteria 2900
373 Ga0207641_10111078 3300026088 Bacteria 2430
374 Ga0207641_10147808 3300026088 Bacteria 2126
375 Ga0207648_10024776 3300026089 Bacteria 5353
376 Ga0207648_10091879 3300026089 Bacteria 2654
377 Ga0207648_10258276 3300026089 Bacteria 1554
378 Ga0207676_10000001 3300026095 Bacteria 1439222
379 Ga0207676_10001992 3300026095 Bacteria 14870
380 Ga0207674_10055041 3300026116 Bacteria 4048
381 Ga0207674_10132419 3300026116 Bacteria 2456
382 Ga0207674_10134064 3300026116 Bacteria 2439
383 Ga0207675_100040897 3300026118 Bacteria 4331
384 Ga0207675_100045106 3300026118 Bacteria 4119
385 Ga0207675_100056867 3300026118 Bacteria 3649
386 Ga0207675_100323301 3300026118 Bacteria 1507
387 Ga0207683_10016715 3300026121 Bacteria 6243
388 Ga0207683_10333408 3300026121 Bacteria 1390
389 Ga0209179_1000186 3300027512 Bacteria 5763
390 Ga0207428_10031138 3300027907 Bacteria 4406
391 Ga0207428_10049106 3300027907 Bacteria 3382
392 Ga0207428_10107016 3300027907 Bacteria 2155
393 Ga0268266_10003850 3300028379 Bacteria 14650
394 Ga0268266_10007403 3300028379 Bacteria 9912
395 Ga0268266_10019683 3300028379 Bacteria 5751
396 Ga0268266_10026993 3300028379 Bacteria 4885
397 Ga0268266_10066429 3300028379 Bacteria 3119
398 Ga0268266_10280050 3300028379 Bacteria 1550
399 Ga0268266_10289764 3300028379 Bacteria 1524
400 Ga0268265_10000595 3300028380 Bacteria 36375
401 Ga0268265_10000930 3300028380 Bacteria 27042
402 Ga0268265_10006261 3300028380 Bacteria 8061
403 Ga0268265_10272645 3300028380 Bacteria 1510
404 Ga0268264_10000004 3300028381 Bacteria 1116842
405 Ga0268264_10000142 3300028381 Bacteria 170046
406 Ga0268264_10022832 3300028381 Bacteria 5105
407 Ga0268264_10025467 3300028381 Bacteria 4833
408 Ga0268264_10177075 3300028381 Bacteria 1934
409 Ga0268264_10189831 3300028381 Bacteria 1872
410 Ga0268264_10196952 3300028381 Bacteria 1840
411 Ga0265319_1008480 3300028563 Bacteria 4500
412 Ga0265334_10000009 3300028573 Bacteria 194312
413 Ga0265334_10008439 3300028573 Bacteria 4378
414 Ga0265318_10004000 3300028577 Bacteria 7245
415 Ga0307515_10028337 3300028794 Bacteria 9521
416 Ga0307515_10196046 3300028794 Bacteria 1911
417 Ga0265338_10008094 3300028800 Bacteria 12844
418 Ga0265338_10016809 3300028800 Bacteria 7925
419 Ga0307511_10001048 3300030521 Bacteria 29421
420 Ga0307511_10013658 3300030521 Bacteria 7928
421 Ga0265330_10011206 3300031235 Bacteria 4210
422 Ga0265320_10005381 3300031240 Bacteria 8227
423 Ga0265325_10004755 3300031241 Bacteria 8515
424 Ga0265329_10002567 3300031242 Bacteria 8192
425 Ga0265331_10005814 3300031250 Bacteria 7389
426 Ga0265331_10014542 3300031250 Bacteria 4185
427 Ga0265316_10067041 3300031344 Bacteria 2776
428 Ga0307513_10023567 3300031456 Bacteria 7187
429 Ga0307513_10058647 3300031456 Bacteria 4089
430 Ga0307513_10063665 3300031456 Bacteria 3891
431 Ga0307513_10224247 3300031456 Bacteria 1698
432 Ga0307513_10247309 3300031456 Bacteria 1583
433 Ga0307509_10000003 3300031507 Bacteria 577578
434 Ga0307509_10000641 3300031507 Bacteria 59448
435 Ga0307509_10009871 3300031507 Bacteria 11810
436 Ga0307408_100000192 3300031548 Bacteria 65993
437 Ga0307408_100002500 3300031548 Bacteria 12859
438 Ga0265313_10000628 3300031595 Bacteria 36547
439 Ga0316575_10021388 3300031665 Bacteria 2490
440 Ga0316579_10010462 3300031691 Bacteria 3923
441 Ga0265314_10008038 3300031711 Bacteria 9093
442 Ga0265342_10022142 3300031712 Bacteria 4045
443 Ga0316576_10049712 3300031727 Bacteria 3046
444 Ga0316578_10033770 3300031728 Bacteria 2933
445 Ga0316577_10005918 3300031733 Bacteria 6439
446 Ga0307413_10005102 3300031824 Bacteria 5810
447 Ga0307413_10015221 3300031824 Bacteria 3935
448 Ga0307413_10062879 3300031824 Bacteria 2299
449 Ga0307410_10015239 3300031852 Bacteria 4553
450 Ga0307406_10133435 3300031901 Bacteria 1746
451 Ga0307406_10193596 3300031901 Bacteria 1491
452 Ga0307409_100003031 3300031995 Bacteria 8975
453 Ga0307409_100012128 3300031995 Bacteria 5476
454 Ga0307409_100022235 3300031995 Bacteria 4367
455 Ga0307409_100116267 3300031995 Bacteria 2254
456 Ga0307416_100038211 3300032002 Bacteria 3702
457 Ga0307416_100222502 3300032002 Bacteria 1812
458 Ga0307416_100330085 3300032002 Bacteria 1532
459 Ga0307411_10018735 3300032005 Bacteria 3980
460 Ga0307415_100061016 3300032126 Bacteria 2609
461 Ga0316585_10016578 3300032137 Bacteria 2220
462 Ga0316580_10000911 3300032139 Bacteria 7314
463 Ga0316593_10002315 3300032168 Bacteria 4477
464 Ga0316593_10015239 3300032168 Bacteria 2309
465 Ga0307510_10000001 3300033180 Bacteria 1172244
466 Ga0307510_10074915 3300033180 Bacteria 3340
467 Ga0316592_1005784 3300033524 Bacteria 2360
468 Ga0316588_1010733 3300033528 Bacteria 1939
469 Ga0316596_1000949 3300033541 Bacteria 5531
470 Ga0316596_1018131 3300033541 Bacteria 1777
471 Ga0316596_1020823 3300033541 Bacteria 1670
472 Ga0373936_0012478 3300035113 Bacteria 3233
473 Ga0373954_0007684 3300035118 Bacteria 4719
474 Ga0373946_0025346 3300035171 Bacteria 2332
475 Ga0373955_0020267 3300035172 Bacteria 3340
476 Ga0316574_0024582 3300035398 Bacteria 3607
477 Ga0373931_0049223 3300035691 Bacteria 2237
478 Ga0373927_0000003 3300035695 Bacteria 480348
479 Ga0373937_0038055 3300036401 Bacteria 4385
480 Ga0373937_0281199 3300036401 Bacteria 1571
481 Ga0316582_0010036 3300036647 Bacteria 5168
482 Ga0316584_0032094 3300036712 Bacteria 3885
483 Ga0373925_0038198 3300037068 Bacteria 3549
484 Ga0395898_0004123 3300037466 Bacteria 15936
485 Ga0395898_0240714 3300037466 Bacteria 1726
486 Ga0400487_45262 3300039110 Bacteria 13997
487 Ga0436365_0469301 3300039437 Bacteria 2474
488 Ga0436365_0786183 3300039437 Bacteria 4674
489 Ga0436365_1435536 3300039437 Bacteria 12906
490 Ga0436360_0279954 3300039438 Bacteria 4447
491 Ga0436360_0549786 3300039438 Bacteria 3410
492 Ga0436360_0698059 3300039438 Bacteria 1853
493 Ga0436361_0721987 3300039447 Bacteria 2246
494 Ga0436363_0084971 3300039450 Bacteria 7369
495 Ga0436363_0494892 3300039450 Bacteria 6096
496 Ga0436363_1700653 3300039450 Bacteria 4275
497 Ga0436362_1046982 3300039453 Bacteria 3115
498 Ga0451795_1218549 3300041456 Bacteria 1516
499 Ga0451807_2231092 3300041486 Bacteria 1597
500 Ga0451833_0386923 3300041491 Bacteria 1818
501 Ga0451849_0709537 3300041505 Bacteria 2317
502 Ga0451853_3502465 3300041512 Bacteria 2730
503 Ga0450891_001517 3300042129 Bacteria 2394
504 Ga0466969_0005761 3300044656 Bacteria 6584
505 Ga0466969_0013042 3300044656 Bacteria 4378
506 Ga0466972_0044062 3300044658 Bacteria 2165
507 Ga0466966_0000529 3300044684 Bacteria 24396
508 Ga0466961_0001258 3300044693 Bacteria 15626
509 Ga0466964_0000154 3300044706 Bacteria 18708
510 Ga0466968_0060649 3300044735 Bacteria 1631
511 Ga0466970_0001657 3300044765 Bacteria 10691
512 Ga0466957_0003326 3300044842 Bacteria 8811
513 Ga0466959_0003395 3300045049 Bacteria 10407
514 Ga0466959_0005054 3300045049 Bacteria 8966
515 Ga0451576_0115495 3300045051 Bacteria 2794
516 Ga0495603_0136751 3300046455 Bacteria 1426
517 Ga0495638_0001637 3300046460 Bacteria 19921
518 Ga0495638_0061646 3300046460 Bacteria 2317
519 Ga0495580_0083956 3300046472 Bacteria 2219
520 Ga0495632_0025188 3300046519 Bacteria 3150
521 Ga0495632_0039739 3300046519 Bacteria 2373
522 Ga0495644_0014067 3300046523 Bacteria 3067
523 Ga0495621_0001194 3300046539 Bacteria 6707
524 Ga0495625_0002943 3300046660 Bacteria 17751
525 Ga0495625_0162039 3300046660 Bacteria 1498
526 Ga0495647_0023721 3300046681 Bacteria 2227
527 Ga0495647_0052323 3300046681 Bacteria 1590
528 Ga0495671_0017611 3300046692 Bacteria 3801
529 Ga0495649_0041952 3300046694 Bacteria 2501
530 Ga0495672_0043975 3300047320 Bacteria 2682
531 Ga0495681_0007310 3300047470 Bacteria 7078
532 Ga0495686_0110967 3300047472 Bacteria 1645
533 Ga0496100_0091479 3300048903 Bacteria 2076
534 Ga0496101_0029069 3300048904 Bacteria 3864
535 Ga0496102_0076297 3300048905 Bacteria 3083
536 Ga0496102_0360558 3300048905 Bacteria 1369
537 Ga0496103_0108286 3300048906 Bacteria 1763
538 Ga0496105_0045611 3300048908 Bacteria 3616
539 Ga0496106_0056740 3300048909 Bacteria 2961
540 Ga0496106_0085442 3300048909 Bacteria 2429
541 Ga0496107_0008333 3300048910 Bacteria 7172
542 Ga0496108_0034106 3300048911 Bacteria 4229
543 Ga0496108_0076127 3300048911 Bacteria 2836
544 Ga0496109_0023480 3300048912 Bacteria 5476
545 Ga0496109_0248603 3300048912 Bacteria 1674
546 Ga0496110_0002494 3300048913 Bacteria 13811
547 Ga0496110_0130103 3300048913 Bacteria 2272
548 Ga0496111_0009592 3300048914 Bacteria 6467
549 Ga0496111_0091704 3300048914 Bacteria 2227
550 Ga0496112_0088904 3300048915 Bacteria 3057
551 Ga0496112_0144713 3300048915 Bacteria 2345
552 Ga0496112_0154868 3300048915 Bacteria 2259
553 Ga0496112_0298100 3300048915 Bacteria 1558
554 Ga0496114_0017056 3300048917 Bacteria 5857
555 Ga0496115_0149142 3300048918 Bacteria 1930
556 Ga0496117_0000341 3300048920 Bacteria 82537
557 Ga0496118_0000040 3300048921 Bacteria 304516
558 Ga0496119_0014113 3300048922 Bacteria 6286
559 Ga0496119_0017618 3300048922 Bacteria 5366
560 Ga0496120_0000997 3300048923 Bacteria 38249
561 Ga0496120_0023246 3300048923 Bacteria 3882
562 Ga0496121_0000461 3300048924 Bacteria 79954
563 Ga0496121_0030237 3300048924 Bacteria 4978
564 Ga0496121_0059247 3300048924 Bacteria 3158
565 Ga0496121_0089353 3300048924 Bacteria 2412
566 Ga0496125_0007403 3300048928 Bacteria 11676
567 Ga0496125_0013466 3300048928 Bacteria 8037
568 Ga0496125_0086176 3300048928 Bacteria 2376
569 Ga0496125_0185861 3300048928 Bacteria 1378
570 Ga0496126_0004176 3300048929 Bacteria 17429
571 Ga0496126_0040128 3300048929 Bacteria 4340
572 Ga0501034_0069076 3300049571 Bacteria 3544
573 Ga0501036_0018058 3300049572 Bacteria 5905
574 Ga0501038_0002611 3300049574 Bacteria 16847
575 Ga0501038_0193593 3300049574 Bacteria 1635
576 Ga0501039_0027539 3300049575 Bacteria 4370
577 Ga0501040_0001093 3300049576 Bacteria 17147
578 Ga0501040_0035215 3300049576 Bacteria 3394
579 Ga0501041_0020561 3300049577 Bacteria 3948
580 Ga0501042_0023138 3300049578 Bacteria 4344
581 Ga0501042_0033413 3300049578 Bacteria 3646
582 Ga0501043_0055696 3300049579 Bacteria 3107
583 Ga0501046_0009023 3300049580 Bacteria 8646
584 Ga0501046_0128993 3300049580 Bacteria 1919
585 Ga0501047_0088927 3300049581 Bacteria 2966
586 Ga0501047_0262574 3300049581 Bacteria 1574
587 Ga0501048_0014976 3300049582 Bacteria 5734
588 Ga0501048_0021490 3300049582 Bacteria 4725
589 Ga0501067_0082082 3300049583 Bacteria 1787
590 Ga0501068_0000333 3300049584 Bacteria 23681
591 Ga0501068_0026548 3300049584 Bacteria 3413
592 Ga0501071_0005352 3300049587 Bacteria 8245
593 Ga0501071_0034226 3300049587 Bacteria 3614
594 Ga0501071_0058681 3300049587 Bacteria 2783
595 Ga0501072_0057490 3300049588 Bacteria 3065
596 Ga0501072_0114344 3300049588 Bacteria 2148
597 Ga0501073_0000202 3300049589 Bacteria 39531
598 Ga0501074_0001988 3300049590 Bacteria 14077
599 Ga0501074_0020850 3300049590 Bacteria 4760
600 Ga0501074_0068606 3300049590 Bacteria 2549
601 Ga0501075_0035574 3300049591 Bacteria 3715
602 Ga0501076_0002080 3300049592 Bacteria 13720
603 Ga0501076_0026948 3300049592 Bacteria 4455
604 Ga0501077_0004784 3300049593 Bacteria 8229
605 Ga0501077_0028768 3300049593 Bacteria 3532
606 Ga0501079_0000662 3300049741 Bacteria 23042
607 Ga0501079_0041383 3300049741 Bacteria 3556
608 Ga0501080_0003952 3300049742 Bacteria 13126
609 Ga0501080_0008047 3300049742 Bacteria 9551
610 Ga0501080_0312377 3300049742 Bacteria 1424
611 Ga0501081_0003686 3300049743 Bacteria 9806
612 Ga0501081_0074736 3300049743 Bacteria 2364
613 Ga0501083_0047613 3300049744 Bacteria 2897
614 Ga0501035_0021077 3300049822 Bacteria 5992
615 Ga0501045_0000225 3300049824 Bacteria 32621
616 Ga0501045_0069879 3300049824 Bacteria 2582
617 nmdc:mga05p37_18996_c1 3300050507 Bacteria 8312
618 nmdc:mga05p37_259472_c1 3300050507 Bacteria 2080
619 nmdc:mga09592_26686_c1 3300050508 Bacteria 4786
620 nmdc:mga0qj67_7656_c1 3300050509 Bacteria 7980
621 nmdc:mga0qj67_85963_c1 3300050509 Bacteria 2523
622 nmdc:mga06r32_21429_c1 3300050510 Bacteria 5966
623 nmdc:mga06r32_2847_c1 3300050510 Bacteria 15521
624 nmdc:mga08y16_15614_c1 3300050511 Bacteria 7986
625 nmdc:mga08y16_3224_c1 3300050511 Bacteria 16894
626 nmdc:mga08y16_41852_c1 3300050511 Bacteria 4798
627 nmdc:mga08y16_56183_c1 3300050511 Bacteria 4114
628 nmdc:mga08y16_77846_c1 3300050511 Bacteria 3457
629 nmdc:mga08y16_94224_c1 3300050511 Bacteria 3119
630 nmdc:mga08y16_94930_c1 3300050511 Bacteria 3107
631 nmdc:mga0n895_259835_c1 3300050512 Bacteria 1762
632 nmdc:mga0a205_144958_c1 3300050515 Bacteria 2275
633 Ga0495601_0149162 3300053077 Bacteria 1526
634 Ga0495612_0032606 3300053078 Bacteria 2106
635 Ga0495619_0183072 3300053085 Bacteria 1449
636 Ga0500583_0041758 3300053092 Bacteria 2085
637 Ga0500651_0142652 3300053093 Bacteria 1443
638 Ga0500641_0000635 3300053096 Bacteria 12697
639 Ga0500650_0000072 3300053098 Bacteria 30017
640 Ga0500556_0001074 3300053104 Bacteria 13838
641 Ga0500617_028087 3300053124 Bacteria 2505
642 Ga0500642_0023828 3300053130 Bacteria 2464
643 Ga0500658_0044035 3300053134 Bacteria 1799
644 Ga0500568_0008989 3300053139 Bacteria 4771
645 Ga0500568_0035955 3300053139 Bacteria 2018
646 Ga0500588_0011718 3300053146 Bacteria 2154
647 Ga0500616_0000569 3300053153 Bacteria 45203
648 Ga0500616_0045509 3300053153 Bacteria 2337
649 Ga0500622_0001101 3300053156 Bacteria 22477
650 Ga0500622_0008719 3300053156 Bacteria 5655
651 Ga0500622_0010198 3300053156 Bacteria 5165
652 Ga0500637_0001518 3300053178 Bacteria 9903
653 Ga0500637_0024615 3300053178 Bacteria 3300
654 Ga0501084_0004568 3300054114 Bacteria 11316
655 Ga0501084_0007407 3300054114 Bacteria 9047
656 Ga0501084_0029847 3300054114 Bacteria 4560
657 Ga0501082_0051119 3300060353 Bacteria 3562
658 Ga0466962_0001143 3300061719 Bacteria 12251
659 Ga0530510_0033069 3300061734 Bacteria 3722

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0262574 Ga0501047_0262574_570_1550 321
2 3300003323 rootH1_10113855 rootH1_101138551 358
3 3300005718 Ga0068866_10076338 Ga0068866_100763382 362
4 3300013296 Ga0157374_10165244 Ga0157374_101652442 362
5 3300025908 Ga0207643_10012443 Ga0207643_100124432 362
6 3300025923 Ga0207681_10020824 Ga0207681_100208242 362
7 3300025926 Ga0207659_10067596 Ga0207659_100675962 362
8 3300025940 Ga0207691_10285172 Ga0207691_102851721 362
9 3300026075 Ga0207708_10081703 Ga0207708_100817032 362
10 3300026089 Ga0207648_10258276 Ga0207648_102582762 362
11 3300026121 Ga0207683_10333408 Ga0207683_103334081 362
12 3300049587 Ga0501071_0058681 Ga0501071_0058681_864_1973 367
13 3300050515 nmdc:mga0a205_144958_c1 nmdc:mga0a205_144958_c1_463_1572 367
14 3300025915 Ga0207693_10178695 Ga0207693_101786951 368
15 3300002987 JGI25159J45721_1005457 JGI25159J45721_10054572 373
16 3300005262 Ga0065165_1000005 Ga0065165_100000551 373
17 3300025284 Ga0209130_1000046 Ga0209130_1000046101 373
18 3300031344 Ga0265316_10067041 Ga0265316_100670412 373
19 3300005331 Ga0070670_100000026 Ga0070670_100000026163 374
20 3300005335 Ga0070666_10021429 Ga0070666_100214291 374
21 3300005353 Ga0070669_100008527 Ga0070669_1000085272 374
22 3300005355 Ga0070671_100010526 Ga0070671_1000105263 374
23 3300005367 Ga0070667_100000002 Ga0070667_100000002311 374
24 3300005466 Ga0070685_10000017 Ga0070685_1000001770 374
25 3300005548 Ga0070665_100026780 Ga0070665_1000267802 374
26 3300005617 Ga0068859_100019271 Ga0068859_1000192712 374
27 3300005618 Ga0068864_100000002 Ga0068864_100000002163 374
28 3300005842 Ga0068858_100084944 Ga0068858_1000849442 374
29 3300005843 Ga0068860_100036508 Ga0068860_1000365082 374
30 3300005844 Ga0068862_100017468 Ga0068862_1000174682 374
31 3300006931 Ga0097620_100019273 Ga0097620_1000192732 374
32 3300009177 Ga0105248_10479878 Ga0105248_104798781 374
33 3300009553 Ga0105249_10030234 Ga0105249_100302342 374
34 3300014325 Ga0163163_10000264 Ga0163163_1000026446 374
35 3300025900 Ga0207710_10005579 Ga0207710_100055793 374
36 3300025903 Ga0207680_10023718 Ga0207680_100237182 374
37 3300025923 Ga0207681_10002680 Ga0207681_100026805 374
38 3300025925 Ga0207650_10000002 Ga0207650_10000002160 374
39 3300025931 Ga0207644_10002895 Ga0207644_100028957 374
40 3300025941 Ga0207711_10000061 Ga0207711_10000061111 374
41 3300025961 Ga0207712_10020847 Ga0207712_100208472 374
42 3300025986 Ga0207658_10000001 Ga0207658_100000011194 374
43 3300026035 Ga0207703_10135430 Ga0207703_101354302 374
44 3300026095 Ga0207676_10000001 Ga0207676_10000001160 374
45 3300028379 Ga0268266_10026993 Ga0268266_100269932 374
46 3300028380 Ga0268265_10000930 Ga0268265_100009307 374
47 3300028381 Ga0268264_10000004 Ga0268264_10000004150 374
48 3300049581 Ga0501047_0088927 Ga0501047_0088927_622_1752 374
49 3300053098 Ga0500650_0000072 Ga0500650_0000072_13739_14869 374
50 3300003323 rootH1_10145992 rootH1_101459922 375
51 3300006358 Ga0068871_100281303 Ga0068871_1002813031 375
52 3300026116 Ga0207674_10134064 Ga0207674_101340642 375
53 3300031665 Ga0316575_10021388 Ga0316575_100213882 375
54 3300039110 Ga0400487_45262 Ga0400487_45262_235_1374 375
55 3300042129 Ga0450891_001517 Ga0450891_001517_147_1355 375
56 iso_pu_bacteria 2738541276 2738716193 375
57 3300031548 Ga0307408_100000192 Ga0307408_1000001922 376
58 3300031548 Ga0307408_100002500 Ga0307408_1000025002 376
59 3300031901 Ga0307406_10133435 Ga0307406_101334351 376
60 3300032168 Ga0316593_10002315 Ga0316593_100023151 376
61 3300049571 Ga0501034_0069076 Ga0501034_0069076_151_1362 376
62 3300049822 Ga0501035_0021077 Ga0501035_0021077_4579_5715 376
63 3300032168 Ga0316593_10015239 Ga0316593_100152391 377
64 3300033541 Ga0316596_1020823 Ga0316596_10208232 378
65 3300003316 rootH1_10023252 rootH1_100232524 379
66 3300005617 Ga0068859_100000874 Ga0068859_10000087422 379
67 3300005841 Ga0068863_100012364 Ga0068863_1000123644 379
68 3300005842 Ga0068858_100001638 Ga0068858_10000163814 379
69 3300005843 Ga0068860_100004745 Ga0068860_1000047458 379
70 3300006931 Ga0097620_100000873 Ga0097620_10000087322 379
71 3300009093 Ga0105240_10299647 Ga0105240_102996472 379
72 3300009101 Ga0105247_10000812 Ga0105247_1000081213 379
73 3300009177 Ga0105248_10022613 Ga0105248_100226132 379
74 3300009177 Ga0105248_10134845 Ga0105248_101348452 379
75 3300009545 Ga0105237_10222904 Ga0105237_102229042 379
76 3300009553 Ga0105249_10021727 Ga0105249_100217274 379
77 3300009553 Ga0105249_10130073 Ga0105249_101300732 379
78 3300010375 Ga0105239_10521620 Ga0105239_105216201 379
79 3300013306 Ga0163162_10063692 Ga0163162_100636922 379
80 3300014968 Ga0157379_10001382 Ga0157379_1000138218 379
81 3300014968 Ga0157379_10118190 Ga0157379_101181901 379
82 3300025900 Ga0207710_10000200 Ga0207710_1000020024 379
83 3300025903 Ga0207680_10021698 Ga0207680_100216983 379
84 3300025931 Ga0207644_10055538 Ga0207644_100555382 379
85 3300025941 Ga0207711_10024939 Ga0207711_100249394 379
86 3300025961 Ga0207712_10015524 Ga0207712_100155244 379
87 3300025986 Ga0207658_10010618 Ga0207658_100106182 379
88 3300026035 Ga0207703_10000919 Ga0207703_1000091916 379
89 3300026088 Ga0207641_10054966 Ga0207641_100549663 379
90 3300028379 Ga0268266_10066429 Ga0268266_100664292 379
91 3300033541 Ga0316596_1018131 Ga0316596_10181312 379
92 3300035113 Ga0373936_0012478 Ga0373936_0012478_1114_2259 379
93 3300046519 Ga0495632_0025188 Ga0495632_0025188_526_1671 379
94 3300048920 Ga0496117_0000341 Ga0496117_0000341_79203_80348 379
95 3300048921 Ga0496118_0000040 Ga0496118_0000040_121090_122235 379
96 3300048922 Ga0496119_0014113 Ga0496119_0014113_2309_3454 379
97 3300048922 Ga0496119_0017618 Ga0496119_0017618_3946_5091 379
98 3300048923 Ga0496120_0000997 Ga0496120_0000997_7145_8290 379
99 3300048923 Ga0496120_0023246 Ga0496120_0023246_2457_3602 379
100 3300048924 Ga0496121_0000461 Ga0496121_0000461_2814_3959 379
101 3300048924 Ga0496121_0030237 Ga0496121_0030237_2136_3281 379
102 3300048924 Ga0496121_0059247 Ga0496121_0059247_1810_2955 379
103 3300048924 Ga0496121_0089353 Ga0496121_0089353_960_2105 379
104 3300048928 Ga0496125_0007403 Ga0496125_0007403_6810_7955 379
105 3300048928 Ga0496125_0013466 Ga0496125_0013466_6224_7369 379
106 3300048928 Ga0496125_0086176 Ga0496125_0086176_291_1436 379
107 3300048928 Ga0496125_0185861 Ga0496125_0185861_51_1196 379
108 3300048929 Ga0496126_0040128 Ga0496126_0040128_2645_3790 379
109 3300053178 Ga0500637_0001518 Ga0500637_0001518_191_1336 379
110 3300005330 Ga0070690_100038508 Ga0070690_1000385081 380
111 3300005334 Ga0068869_100049289 Ga0068869_1000492892 380
112 3300005335 Ga0070666_10063371 Ga0070666_100633712 380
113 3300005336 Ga0070680_100124261 Ga0070680_1001242612 380
114 3300005337 Ga0070682_100016908 Ga0070682_1000169082 380
115 3300005338 Ga0068868_100003997 Ga0068868_1000039976 380
116 3300005343 Ga0070687_100111430 Ga0070687_1001114302 380
117 3300005344 Ga0070661_100102142 Ga0070661_1001021421 380
118 3300005355 Ga0070671_100008250 Ga0070671_1000082504 380
119 3300005444 Ga0070694_100099900 Ga0070694_1000999001 380
120 3300005535 Ga0070684_100179436 Ga0070684_1001794362 380
121 3300005564 Ga0070664_100004667 Ga0070664_1000046675 380
122 3300005618 Ga0068864_100005830 Ga0068864_1000058303 380
123 3300005841 Ga0068863_100006917 Ga0068863_10000691711 380
124 3300005843 Ga0068860_100019554 Ga0068860_1000195545 380
125 3300006237 Ga0097621_100009176 Ga0097621_1000091765 380
126 3300006844 Ga0075428_100003215 Ga0075428_10000321512 380
127 3300006852 Ga0075433_10133273 Ga0075433_101332732 380
128 3300006880 Ga0075429_100020882 Ga0075429_1000208824 380
129 3300009094 Ga0111539_10015226 Ga0111539_100152268 380
130 3300009094 Ga0111539_10617544 Ga0111539_106175441 380
131 3300009098 Ga0105245_10003531 Ga0105245_100035318 380
132 3300009101 Ga0105247_10023669 Ga0105247_100236693 380
133 3300009148 Ga0105243_10177901 Ga0105243_101779012 380
134 3300009177 Ga0105248_10010033 Ga0105248_100100335 380
135 3300009551 Ga0105238_10182229 Ga0105238_101822292 380
136 3300010375 Ga0105239_10090904 Ga0105239_100909043 380
137 3300011119 Ga0105246_10003632 Ga0105246_100036328 380
138 3300013296 Ga0157374_10002676 Ga0157374_100026764 380
139 3300013297 Ga0157378_10264533 Ga0157378_102645331 380
140 3300013306 Ga0163162_10041271 Ga0163162_100412712 380
141 3300013308 Ga0157375_10033274 Ga0157375_100332742 380
142 3300014326 Ga0157380_10024535 Ga0157380_100245354 380
143 3300014745 Ga0157377_10109972 Ga0157377_101099722 380
144 3300025927 Ga0207687_10138625 Ga0207687_101386252 380
145 3300025937 Ga0207669_10120589 Ga0207669_101205892 380
146 3300025941 Ga0207711_10007410 Ga0207711_100074102 380
147 3300025942 Ga0207689_10153252 Ga0207689_101532522 380
148 3300026023 Ga0207677_10106082 Ga0207677_101060822 380
149 3300026035 Ga0207703_10010064 Ga0207703_100100647 380
150 3300026089 Ga0207648_10091879 Ga0207648_100918792 380
151 3300026116 Ga0207674_10132419 Ga0207674_101324192 380
152 3300028380 Ga0268265_10272645 Ga0268265_102726451 380
153 3300028381 Ga0268264_10177075 Ga0268264_101770752 380
154 3300031824 Ga0307413_10062879 Ga0307413_100628792 380
155 3300035172 Ga0373955_0020267 Ga0373955_0020267_750_1898 380
156 3300035691 Ga0373931_0049223 Ga0373931_0049223_832_1980 380
157 3300036401 Ga0373937_0038055 Ga0373937_0038055_1115_2263 380
158 3300048915 Ga0496112_0144713 Ga0496112_0144713_45_1193 380
159 3300049580 Ga0501046_0128993 Ga0501046_0128993_418_1566 380
160 3300049591 Ga0501075_0035574 Ga0501075_0035574_194_1342 380
161 3300050508 nmdc:mga09592_26686_c1 nmdc:mga09592_26686_c1_1851_2999 380
162 3300050511 nmdc:mga08y16_41852_c1 nmdc:mga08y16_41852_c1_1832_2980 380
163 3300050511 nmdc:mga08y16_94224_c1 nmdc:mga08y16_94224_c1_235_1383 380
164 3300053077 Ga0495601_0149162 Ga0495601_0149162_44_1195 380
165 3300053096 Ga0500641_0000635 Ga0500641_0000635_7767_8915 380
166 3300031691 Ga0316579_10010462 Ga0316579_100104622 381
167 3300031727 Ga0316576_10049712 Ga0316576_100497122 381
168 3300031728 Ga0316578_10033770 Ga0316578_100337702 381
169 3300031733 Ga0316577_10005918 Ga0316577_100059182 381
170 3300032137 Ga0316585_10016578 Ga0316585_100165783 381
171 3300032139 Ga0316580_10000911 Ga0316580_100009114 381
172 3300033524 Ga0316592_1005784 Ga0316592_10057842 381
173 3300033528 Ga0316588_1010733 Ga0316588_10107332 381
174 3300033541 Ga0316596_1000949 Ga0316596_10009493 381
175 3300035398 Ga0316574_0024582 Ga0316574_0024582_924_2075 381
176 3300036647 Ga0316582_0010036 Ga0316582_0010036_2323_3474 381
177 3300036712 Ga0316584_0032094 Ga0316584_0032094_912_2063 381
178 3300053178 Ga0500637_0024615 Ga0500637_0024615_2019_3173 382
179 3300035695 Ga0373927_0000003 Ga0373927_0000003_364077_365234 383
180 3300005335 Ga0070666_10080748 Ga0070666_100807482 384
181 3300005355 Ga0070671_100005822 Ga0070671_1000058224 384
182 3300005367 Ga0070667_100000720 Ga0070667_1000007207 384
183 3300005455 Ga0070663_100093389 Ga0070663_1000933892 384
184 3300005539 Ga0068853_100093337 Ga0068853_1000933372 384
185 3300005548 Ga0070665_100114571 Ga0070665_1001145712 384
186 3300005563 Ga0068855_100172081 Ga0068855_1001720811 384
187 3300005578 Ga0068854_100056225 Ga0068854_1000562253 384
188 3300005614 Ga0068856_100121331 Ga0068856_1001213312 384
189 3300005616 Ga0068852_100171413 Ga0068852_1001714132 384
190 3300005617 Ga0068859_100026348 Ga0068859_1000263483 384
191 3300005841 Ga0068863_100020718 Ga0068863_1000207185 384
192 3300005842 Ga0068858_100004005 Ga0068858_1000040058 384
193 3300005843 Ga0068860_100035152 Ga0068860_1000351524 384
194 3300005937 Ga0081455_10215988 Ga0081455_102159881 384
195 3300006931 Ga0097620_100026348 Ga0097620_1000263483 384
196 3300025904 Ga0207647_10053465 Ga0207647_100534652 384
197 3300025912 Ga0207707_10007017 Ga0207707_100070176 384
198 3300025913 Ga0207695_10216300 Ga0207695_102163002 384
199 3300025944 Ga0207661_10042350 Ga0207661_100423501 384
200 3300025981 Ga0207640_10074899 Ga0207640_100748992 384
201 3300026035 Ga0207703_10001227 Ga0207703_1000122713 384
202 3300026067 Ga0207678_10023231 Ga0207678_100232312 384
203 3300026088 Ga0207641_10001010 Ga0207641_100010104 384
204 3300028379 Ga0268266_10003850 Ga0268266_100038508 384
205 3300028379 Ga0268266_10280050 Ga0268266_102800501 384
206 3300028381 Ga0268264_10000142 Ga0268264_10000142136 384
207 3300028794 Ga0307515_10028337 Ga0307515_100283378 384
208 3300030521 Ga0307511_10001048 Ga0307511_1000104814 384
209 3300030521 Ga0307511_10013658 Ga0307511_100136585 384
210 3300031456 Ga0307513_10063665 Ga0307513_100636651 384
211 3300031507 Ga0307509_10000003 Ga0307509_10000003111 384
212 3300033180 Ga0307510_10000001 Ga0307510_10000001935 384
213 3300033180 Ga0307510_10074915 Ga0307510_100749152 384
214 3300044656 Ga0466969_0005761 Ga0466969_0005761_687_1850 384
215 3300044684 Ga0466966_0000529 Ga0466966_0000529_12285_13448 384
216 3300044693 Ga0466961_0001258 Ga0466961_0001258_5432_6595 384
217 3300044706 Ga0466964_0000154 Ga0466964_0000154_9090_10253 384
218 3300044765 Ga0466970_0001657 Ga0466970_0001657_2099_3262 384
219 3300044842 Ga0466957_0003326 Ga0466957_0003326_4139_5302 384
220 3300045049 Ga0466959_0005054 Ga0466959_0005054_7274_8437 384
221 3300053139 Ga0500568_0008989 Ga0500568_0008989_2860_4020 384
222 3300053153 Ga0500616_0045509 Ga0500616_0045509_903_2120 384
223 3300061719 Ga0466962_0001143 Ga0466962_0001143_8469_9632 384
224 3300005435 Ga0070714_100195152 Ga0070714_1001951522 385
225 3300025929 Ga0207664_10000585 Ga0207664_1000058513 385
226 3300025929 Ga0207664_10171775 Ga0207664_101717752 385
227 3300035118 Ga0373954_0007684 Ga0373954_0007684_3165_4328 385
228 3300039437 Ga0436365_0469301 Ga0436365_0469301_153_1319 385
229 3300039450 Ga0436363_0084971 Ga0436363_0084971_2396_3562 385
230 3300041456 Ga0451795_1218549 Ga0451795_1218549_101_1294 385
231 3300041486 Ga0451807_2231092 Ga0451807_2231092_198_1367 385
232 3300046455 Ga0495603_0136751 Ga0495603_0136751_26_1195 385
233 3300053092 Ga0500583_0041758 Ga0500583_0041758_242_1486 385
234 3300053093 Ga0500651_0142652 Ga0500651_0142652_167_1411 385
235 3300053124 Ga0500617_028087 Ga0500617_028087_1149_2393 385
236 3300053130 Ga0500642_0023828 Ga0500642_0023828_14_1258 385
237 3300053134 Ga0500658_0044035 Ga0500658_0044035_184_1428 385
238 3300005615 Ga0070702_100178487 Ga0070702_1001784871 386
239 3300006237 Ga0097621_100034118 Ga0097621_1000341182 386
240 3300006358 Ga0068871_100063106 Ga0068871_1000631062 386
241 3300013296 Ga0157374_10062863 Ga0157374_100628632 386
242 3300014969 Ga0157376_10037640 Ga0157376_100376403 386
243 3300014969 Ga0157376_10047753 Ga0157376_100477533 386
244 3300025906 Ga0207699_10010612 Ga0207699_100106124 386
245 3300028573 Ga0265334_10000009 Ga0265334_10000009108 386
246 3300031595 Ga0265313_10000628 Ga0265313_100006287 386
247 3300041491 Ga0451833_0386923 Ga0451833_0386923_600_1778 386
248 3300046472 Ga0495580_0083956 Ga0495580_0083956_230_1399 386
249 3300046523 Ga0495644_0014067 Ga0495644_0014067_1676_2854 386
250 3300046539 Ga0495621_0001194 Ga0495621_0001194_3854_5032 386
251 3300046681 Ga0495647_0023721 Ga0495647_0023721_967_2142 386
252 3300046692 Ga0495671_0017611 Ga0495671_0017611_499_1677 386
253 3300047470 Ga0495681_0007310 Ga0495681_0007310_661_1839 386
254 3300047472 Ga0495686_0110967 Ga0495686_0110967_300_1478 386
255 3300048905 Ga0496102_0076297 Ga0496102_0076297_296_1465 386
256 3300048913 Ga0496110_0130103 Ga0496110_0130103_926_2092 386
257 3300053153 Ga0500616_0000569 Ga0500616_0000569_34759_35970 386
258 3300005337 Ga0070682_100085373 Ga0070682_1000853732 387
259 3300005548 Ga0070665_100003917 Ga0070665_1000039172 387
260 3300005548 Ga0070665_100084241 Ga0070665_1000842412 387
261 3300005937 Ga0081455_10000043 Ga0081455_10000043124 387
262 3300005985 Ga0081539_10000046 Ga0081539_1000004683 387
263 3300009093 Ga0105240_10010435 Ga0105240_100104352 387
264 3300009093 Ga0105240_10070901 Ga0105240_100709014 387
265 3300009545 Ga0105237_10250118 Ga0105237_102501182 387
266 3300013105 Ga0157369_10020260 Ga0157369_100202602 387
267 3300013307 Ga0157372_10172491 Ga0157372_101724912 387
268 3300028379 Ga0268266_10019683 Ga0268266_100196832 387
269 3300028794 Ga0307515_10196046 Ga0307515_101960462 387
270 3300031507 Ga0307509_10000641 Ga0307509_1000064124 387
271 3300032002 Ga0307416_100222502 Ga0307416_1002225022 387
272 3300039438 Ga0436360_0279954 Ga0436360_0279954_1428_2600 387
273 3300039438 Ga0436360_0698059 Ga0436360_0698059_287_1459 387
274 3300039447 Ga0436361_0721987 Ga0436361_0721987_80_1252 387
275 3300048929 Ga0496126_0004176 Ga0496126_0004176_13820_14989 387
276 3300049574 Ga0501038_0193593 Ga0501038_0193593_187_1359 387
277 3300049575 Ga0501039_0027539 Ga0501039_0027539_977_2149 387
278 3300049576 Ga0501040_0001093 Ga0501040_0001093_15169_16341 387
279 3300049577 Ga0501041_0020561 Ga0501041_0020561_670_1842 387
280 3300049578 Ga0501042_0023138 Ga0501042_0023138_2515_3687 387
281 3300049582 Ga0501048_0014976 Ga0501048_0014976_794_1966 387
282 3300049588 Ga0501072_0057490 Ga0501072_0057490_98_1270 387
283 3300049590 Ga0501074_0068606 Ga0501074_0068606_663_1835 387
284 3300049592 Ga0501076_0026948 Ga0501076_0026948_950_2122 387
285 3300049741 Ga0501079_0041383 Ga0501079_0041383_901_2073 387
286 3300049742 Ga0501080_0008047 Ga0501080_0008047_292_1464 387
287 3300049743 Ga0501081_0003686 Ga0501081_0003686_6561_7733 387
288 3300049824 Ga0501045_0069879 Ga0501045_0069879_982_2154 387
289 3300053078 Ga0495612_0032606 Ga0495612_0032606_850_2022 387
290 3300054114 Ga0501084_0029847 Ga0501084_0029847_2222_3394 387
291 3300060353 Ga0501082_0051119 Ga0501082_0051119_1304_2476 387
292 3300005295 Ga0065707_10083371 Ga0065707_100833718 388
293 3300005340 Ga0070689_100008129 Ga0070689_1000081294 388
294 3300005345 Ga0070692_10066758 Ga0070692_100667581 388
295 3300005354 Ga0070675_100021713 Ga0070675_1000217135 388
296 3300005356 Ga0070674_100241757 Ga0070674_1002417571 388
297 3300005440 Ga0070705_100027352 Ga0070705_1000273522 388
298 3300005441 Ga0070700_100011270 Ga0070700_1000112704 388
299 3300005444 Ga0070694_100245692 Ga0070694_1002456921 388
300 3300005457 Ga0070662_100091203 Ga0070662_1000912032 388
301 3300005466 Ga0070685_10024484 Ga0070685_100244842 388
302 3300005543 Ga0070672_100069104 Ga0070672_1000691042 388
303 3300005543 Ga0070672_100077217 Ga0070672_1000772172 388
304 3300005548 Ga0070665_100006479 Ga0070665_1000064797 388
305 3300005563 Ga0068855_100004233 Ga0068855_1000042334 388
306 3300005564 Ga0070664_100123586 Ga0070664_1001235862 388
307 3300005614 Ga0068856_100004637 Ga0068856_1000046372 388
308 3300005615 Ga0070702_100000859 Ga0070702_10000085911 388
309 3300005617 Ga0068859_100130588 Ga0068859_1001305882 388
310 3300005719 Ga0068861_100104874 Ga0068861_1001048742 388
311 3300005840 Ga0068870_10002121 Ga0068870_100021211 388
312 3300005843 Ga0068860_100105850 Ga0068860_1001058503 388
313 3300005937 Ga0081455_10041380 Ga0081455_100413804 388
314 3300006237 Ga0097621_100119956 Ga0097621_1001199561 388
315 3300006881 Ga0068865_100065293 Ga0068865_1000652932 388
316 3300006931 Ga0097620_100130574 Ga0097620_1001305742 388
317 3300009092 Ga0105250_10000023 Ga0105250_1000002394 388
318 3300009093 Ga0105240_10115396 Ga0105240_101153962 388
319 3300009094 Ga0111539_10180942 Ga0111539_101809422 388
320 3300009551 Ga0105238_10112485 Ga0105238_101124852 388
321 3300013306 Ga0163162_10139635 Ga0163162_101396352 388
322 3300013308 Ga0157375_10023229 Ga0157375_100232292 388
323 3300013308 Ga0157375_10058031 Ga0157375_100580312 388
324 3300014325 Ga0163163_10023635 Ga0163163_100236355 388
325 3300014326 Ga0157380_10010360 Ga0157380_100103607 388
326 3300014968 Ga0157379_10000613 Ga0157379_1000061319 388
327 3300025711 Ga0207696_1000098 Ga0207696_100009865 388
328 3300025893 Ga0207682_10075214 Ga0207682_100752142 388
329 3300025908 Ga0207643_10121589 Ga0207643_101215892 388
330 3300025913 Ga0207695_10170960 Ga0207695_101709601 388
331 3300025920 Ga0207649_10039433 Ga0207649_100394333 388
332 3300025923 Ga0207681_10020588 Ga0207681_100205884 388
333 3300025925 Ga0207650_10075060 Ga0207650_100750601 388
334 3300025936 Ga0207670_10015580 Ga0207670_100155802 388
335 3300025938 Ga0207704_10074205 Ga0207704_100742052 388
336 3300025940 Ga0207691_10029366 Ga0207691_100293663 388
337 3300025942 Ga0207689_10212450 Ga0207689_102124502 388
338 3300025942 Ga0207689_10225858 Ga0207689_102258582 388
339 3300025945 Ga0207679_10030141 Ga0207679_100301413 388
340 3300025949 Ga0207667_10001163 Ga0207667_1000116321 388
341 3300026088 Ga0207641_10147808 Ga0207641_101478082 388
342 3300026118 Ga0207675_100045106 Ga0207675_1000451062 388
343 3300026118 Ga0207675_100323301 Ga0207675_1003233012 388
344 3300027907 Ga0207428_10049106 Ga0207428_100491061 388
345 3300028379 Ga0268266_10007403 Ga0268266_100074035 388
346 3300028381 Ga0268264_10022832 Ga0268264_100228322 388
347 3300031456 Ga0307513_10023567 Ga0307513_100235675 388
348 3300031456 Ga0307513_10058647 Ga0307513_100586472 388
349 3300031507 Ga0307509_10009871 Ga0307509_100098712 388
350 3300031824 Ga0307413_10005102 Ga0307413_100051023 388
351 3300031824 Ga0307413_10015221 Ga0307413_100152212 388
352 3300031852 Ga0307410_10015239 Ga0307410_100152392 388
353 3300031995 Ga0307409_100003031 Ga0307409_1000030317 388
354 3300031995 Ga0307409_100012128 Ga0307409_1000121282 388
355 3300031995 Ga0307409_100022235 Ga0307409_1000222352 388
356 3300032002 Ga0307416_100038211 Ga0307416_1000382112 388
357 3300032005 Ga0307411_10018735 Ga0307411_100187352 388
358 3300041505 Ga0451849_0709537 Ga0451849_0709537_677_1849 388
359 3300041512 Ga0451853_3502465 Ga0451853_3502465_726_1898 388
360 3300046460 Ga0495638_0061646 Ga0495638_0061646_219_1406 388
361 3300046519 Ga0495632_0039739 Ga0495632_0039739_41_1207 388
362 3300046660 Ga0495625_0162039 Ga0495625_0162039_90_1277 388
363 3300046694 Ga0495649_0041952 Ga0495649_0041952_457_1644 388
364 3300047320 Ga0495672_0043975 Ga0495672_0043975_138_1313 388
365 3300049583 Ga0501067_0082082 Ga0501067_0082082_312_1499 388
366 3300049584 Ga0501068_0000333 Ga0501068_0000333_16920_18107 388
367 3300049587 Ga0501071_0034226 Ga0501071_0034226_845_2032 388
368 3300049589 Ga0501073_0000202 Ga0501073_0000202_24903_26090 388
369 3300049590 Ga0501074_0001988 Ga0501074_0001988_12869_14056 388
370 3300049593 Ga0501077_0004784 Ga0501077_0004784_3734_4921 388
371 3300049741 Ga0501079_0000662 Ga0501079_0000662_9792_10979 388
372 3300049742 Ga0501080_0003952 Ga0501080_0003952_1730_2917 388
373 3300049742 Ga0501080_0312377 Ga0501080_0312377_37_1224 388
374 3300049744 Ga0501083_0047613 Ga0501083_0047613_982_2169 388
375 3300050511 nmdc:mga08y16_56183_c1 nmdc:mga08y16_56183_c1_2272_3459 388
376 3300050511 nmdc:mga08y16_94930_c1 nmdc:mga08y16_94930_c1_159_1334 388
377 3300053156 Ga0500622_0008719 Ga0500622_0008719_3814_4980 388
378 3300054114 Ga0501084_0004568 Ga0501084_0004568_310_1497 388
379 3300005295 Ga0065707_10086319 Ga0065707_100863193 389
380 3300005329 Ga0070683_100132795 Ga0070683_1001327952 389
381 3300005336 Ga0070680_100064698 Ga0070680_1000646982 389
382 3300005458 Ga0070681_10014959 Ga0070681_100149596 389
383 3300005530 Ga0070679_100006742 Ga0070679_1000067426 389
384 3300005530 Ga0070679_100012588 Ga0070679_1000125884 389
385 3300005530 Ga0070679_100081686 Ga0070679_1000816863 389
386 3300005530 Ga0070679_100189949 Ga0070679_1001899492 389
387 3300005563 Ga0068855_100002113 Ga0068855_10000211316 389
388 3300005563 Ga0068855_100008348 Ga0068855_1000083489 389
389 3300006844 Ga0075428_100009769 Ga0075428_1000097694 389
390 3300006846 Ga0075430_100088134 Ga0075430_1000881342 389
391 3300006847 Ga0075431_100001747 Ga0075431_10000174714 389
392 3300009093 Ga0105240_10022715 Ga0105240_100227153 389
393 3300009094 Ga0111539_10036722 Ga0111539_100367224 389
394 3300009545 Ga0105237_10072969 Ga0105237_100729692 389
395 3300009551 Ga0105238_10012704 Ga0105238_100127042 389
396 3300009551 Ga0105238_10199339 Ga0105238_101993391 389
397 3300009553 Ga0105249_10151161 Ga0105249_101511611 389
398 3300013104 Ga0157370_10358494 Ga0157370_103584941 389
399 3300013105 Ga0157369_10091026 Ga0157369_100910262 389
400 3300014326 Ga0157380_10019037 Ga0157380_100190372 389
401 3300025912 Ga0207707_10000045 Ga0207707_1000004520 389
402 3300025913 Ga0207695_10047075 Ga0207695_100470751 389
403 3300025913 Ga0207695_10052514 Ga0207695_100525141 389
404 3300025914 Ga0207671_10017617 Ga0207671_100176171 389
405 3300025917 Ga0207660_10000958 Ga0207660_100009586 389
406 3300025921 Ga0207652_10010022 Ga0207652_100100226 389
407 3300025921 Ga0207652_10010582 Ga0207652_100105822 389
408 3300025921 Ga0207652_10036915 Ga0207652_100369153 389
409 3300025921 Ga0207652_10209774 Ga0207652_102097742 389
410 3300025949 Ga0207667_10000887 Ga0207667_100008877 389
411 3300025949 Ga0207667_10010839 Ga0207667_100108398 389
412 3300027907 Ga0207428_10031138 Ga0207428_100311382 389
413 3300028800 Ga0265338_10016809 Ga0265338_100168093 389
414 3300031250 Ga0265331_10014542 Ga0265331_100145422 389
415 3300031995 Ga0307409_100116267 Ga0307409_1001162672 389
416 3300044656 Ga0466969_0013042 Ga0466969_0013042_2772_3947 389
417 3300045049 Ga0466959_0003395 Ga0466959_0003395_4301_5476 389
418 3300046460 Ga0495638_0001637 Ga0495638_0001637_6323_7501 389
419 3300046660 Ga0495625_0002943 Ga0495625_0002943_9730_10908 389
420 3300050509 nmdc:mga0qj67_85963_c1 nmdc:mga0qj67_85963_c1_579_1760 389
421 3300050510 nmdc:mga06r32_2847_c1 nmdc:mga06r32_2847_c1_2432_3610 389
422 3300050511 nmdc:mga08y16_3224_c1 nmdc:mga08y16_3224_c1_13230_14408 389
423 3300005290 Ga0065712_10123532 Ga0065712_101235322 390
424 3300005330 Ga0070690_100008754 Ga0070690_1000087542 390
425 3300005331 Ga0070670_100052826 Ga0070670_1000528263 390
426 3300005334 Ga0068869_100001531 Ga0068869_10000153114 390
427 3300005335 Ga0070666_10097785 Ga0070666_100977852 390
428 3300005340 Ga0070689_100000263 Ga0070689_1000002632 390
429 3300005344 Ga0070661_100090912 Ga0070661_1000909122 390
430 3300005347 Ga0070668_100004213 Ga0070668_1000042137 390
431 3300005354 Ga0070675_100001875 Ga0070675_1000018752 390
432 3300005364 Ga0070673_100135847 Ga0070673_1001358472 390
433 3300005367 Ga0070667_100072368 Ga0070667_1000723682 390
434 3300005441 Ga0070700_100080301 Ga0070700_1000803012 390
435 3300005456 Ga0070678_100070124 Ga0070678_1000701242 390
436 3300005457 Ga0070662_100042633 Ga0070662_1000426333 390
437 3300005459 Ga0068867_100017933 Ga0068867_1000179332 390
438 3300005466 Ga0070685_10009087 Ga0070685_100090872 390
439 3300005543 Ga0070672_100083583 Ga0070672_1000835832 390
440 3300005544 Ga0070686_100010277 Ga0070686_1000102772 390
441 3300005564 Ga0070664_100014593 Ga0070664_1000145934 390
442 3300005577 Ga0068857_100055415 Ga0068857_1000554152 390
443 3300005615 Ga0070702_100017081 Ga0070702_1000170813 390
444 3300005618 Ga0068864_100018543 Ga0068864_1000185432 390
445 3300005718 Ga0068866_10033150 Ga0068866_100331502 390
446 3300005719 Ga0068861_100014180 Ga0068861_1000141804 390
447 3300005719 Ga0068861_100015877 Ga0068861_1000158772 390
448 3300005841 Ga0068863_100013946 Ga0068863_1000139462 390
449 3300005842 Ga0068858_100013113 Ga0068858_1000131136 390
450 3300005843 Ga0068860_100202558 Ga0068860_1002025582 390
451 3300005844 Ga0068862_100011434 Ga0068862_1000114344 390
452 3300006237 Ga0097621_100102463 Ga0097621_1001024632 390
453 3300006358 Ga0068871_100127377 Ga0068871_1001273772 390
454 3300006844 Ga0075428_100058436 Ga0075428_1000584363 390
455 3300006846 Ga0075430_100005652 Ga0075430_1000056527 390
456 3300006847 Ga0075431_100009224 Ga0075431_1000092244 390
457 3300006880 Ga0075429_100010602 Ga0075429_1000106022 390
458 3300009177 Ga0105248_10122635 Ga0105248_101226352 390
459 3300009553 Ga0105249_10048911 Ga0105249_100489112 390
460 3300010375 Ga0105239_10275151 Ga0105239_102751512 390
461 3300013306 Ga0163162_10042631 Ga0163162_100426312 390
462 3300013308 Ga0157375_10063704 Ga0157375_100637043 390
463 3300014325 Ga0163163_10188056 Ga0163163_101880562 390
464 3300014968 Ga0157379_10113967 Ga0157379_101139673 390
465 3300025899 Ga0207642_10073020 Ga0207642_100730202 390
466 3300025901 Ga0207688_10032245 Ga0207688_100322452 390
467 3300025903 Ga0207680_10005217 Ga0207680_100052172 390
468 3300025917 Ga0207660_10072962 Ga0207660_100729622 390
469 3300025917 Ga0207660_10145694 Ga0207660_101456942 390
470 3300025918 Ga0207662_10022281 Ga0207662_100222812 390
471 3300025920 Ga0207649_10078078 Ga0207649_100780782 390
472 3300025923 Ga0207681_10008163 Ga0207681_100081634 390
473 3300025925 Ga0207650_10048847 Ga0207650_100488472 390
474 3300025926 Ga0207659_10003977 Ga0207659_100039776 390
475 3300025933 Ga0207706_10043252 Ga0207706_100432522 390
476 3300025940 Ga0207691_10015457 Ga0207691_100154577 390
477 3300025941 Ga0207711_10013097 Ga0207711_100130973 390
478 3300025942 Ga0207689_10005143 Ga0207689_100051437 390
479 3300025945 Ga0207679_10001408 Ga0207679_100014087 390
480 3300025960 Ga0207651_10005853 Ga0207651_100058532 390
481 3300025961 Ga0207712_10029484 Ga0207712_100294842 390
482 3300026023 Ga0207677_10020565 Ga0207677_100205654 390
483 3300026035 Ga0207703_10017376 Ga0207703_100173764 390
484 3300026075 Ga0207708_10058644 Ga0207708_100586442 390
485 3300026088 Ga0207641_10076110 Ga0207641_100761102 390
486 3300026089 Ga0207648_10024776 Ga0207648_100247764 390
487 3300026095 Ga0207676_10001992 Ga0207676_100019929 390
488 3300026116 Ga0207674_10055041 Ga0207674_100550412 390
489 3300026118 Ga0207675_100040897 Ga0207675_1000408972 390
490 3300026118 Ga0207675_100056867 Ga0207675_1000568672 390
491 3300026121 Ga0207683_10016715 Ga0207683_100167154 390
492 3300027907 Ga0207428_10107016 Ga0207428_101070162 390
493 3300028380 Ga0268265_10000595 Ga0268265_1000059518 390
494 3300028380 Ga0268265_10006261 Ga0268265_100062612 390
495 3300028381 Ga0268264_10025467 Ga0268264_100254674 390
496 3300028563 Ga0265319_1008480 Ga0265319_10084802 390
497 3300028573 Ga0265334_10008439 Ga0265334_100084393 390
498 3300028577 Ga0265318_10004000 Ga0265318_100040004 390
499 3300028800 Ga0265338_10008094 Ga0265338_100080949 390
500 3300031235 Ga0265330_10011206 Ga0265330_100112062 390
501 3300031240 Ga0265320_10005381 Ga0265320_100053817 390
502 3300031241 Ga0265325_10004755 Ga0265325_100047551 390
503 3300031242 Ga0265329_10002567 Ga0265329_100025674 390
504 3300031250 Ga0265331_10005814 Ga0265331_100058144 390
505 3300031456 Ga0307513_10247309 Ga0307513_102473091 390
506 3300031711 Ga0265314_10008038 Ga0265314_100080382 390
507 3300031712 Ga0265342_10022142 Ga0265342_100221422 390
508 3300031901 Ga0307406_10193596 Ga0307406_101935961 390
509 3300032002 Ga0307416_100330085 Ga0307416_1003300852 390
510 3300032126 Ga0307415_100061016 Ga0307415_1000610163 390
511 3300045051 Ga0451576_0115495 Ga0451576_0115495_904_2088 390
512 3300048909 Ga0496106_0056740 Ga0496106_0056740_12_1196 390
513 3300048911 Ga0496108_0034106 Ga0496108_0034106_2777_3961 390
514 3300048914 Ga0496111_0091704 Ga0496111_0091704_32_1216 390
515 3300048915 Ga0496112_0154868 Ga0496112_0154868_510_1694 390
516 3300050507 nmdc:mga05p37_18996_c1 nmdc:mga05p37_18996_c1_135_1316 390
517 3300050507 nmdc:mga05p37_259472_c1 nmdc:mga05p37_259472_c1_566_1750 390
518 3300050509 nmdc:mga0qj67_7656_c1 nmdc:mga0qj67_7656_c1_2657_3841 390
519 3300050510 nmdc:mga06r32_21429_c1 nmdc:mga06r32_21429_c1_3267_4451 390
520 3300050511 nmdc:mga08y16_15614_c1 nmdc:mga08y16_15614_c1_4540_5724 390
521 3300050511 nmdc:mga08y16_77846_c1 nmdc:mga08y16_77846_c1_58_1239 390
522 3300050512 nmdc:mga0n895_259835_c1 nmdc:mga0n895_259835_c1_243_1427 390
523 3300053139 Ga0500568_0035955 Ga0500568_0035955_576_1781 390
524 3300053146 Ga0500588_0011718 Ga0500588_0011718_761_1960 390
525 3300053156 Ga0500622_0001101 Ga0500622_0001101_12385_13590 390
526 3300053156 Ga0500622_0010198 Ga0500622_0010198_2228_3433 390
527 3300005330 Ga0070690_100006774 Ga0070690_1000067742 391
528 3300005330 Ga0070690_100069449 Ga0070690_1000694492 391
529 3300005335 Ga0070666_10004984 Ga0070666_100049844 391
530 3300005335 Ga0070666_10013909 Ga0070666_100139094 391
531 3300005338 Ga0068868_100021382 Ga0068868_1000213823 391
532 3300005355 Ga0070671_100001253 Ga0070671_10000125321 391
533 3300005355 Ga0070671_100010104 Ga0070671_1000101044 391
534 3300005367 Ga0070667_100003642 Ga0070667_1000036424 391
535 3300005436 Ga0070713_100004316 Ga0070713_1000043164 391
536 3300005437 Ga0070710_10003683 Ga0070710_100036834 391
537 3300005548 Ga0070665_100005912 Ga0070665_1000059123 391
538 3300005614 Ga0068856_100039178 Ga0068856_1000391782 391
539 3300005617 Ga0068859_100230198 Ga0068859_1002301981 391
540 3300005618 Ga0068864_100061846 Ga0068864_1000618462 391
541 3300005841 Ga0068863_100007301 Ga0068863_1000073016 391
542 3300005841 Ga0068863_100130265 Ga0068863_1001302652 391
543 3300005842 Ga0068858_100017248 Ga0068858_1000172482 391
544 3300005842 Ga0068858_100031011 Ga0068858_1000310113 391
545 3300005843 Ga0068860_100017392 Ga0068860_1000173923 391
546 3300005843 Ga0068860_100040591 Ga0068860_1000405911 391
547 3300006175 Ga0070712_100002659 Ga0070712_1000026596 391
548 3300006237 Ga0097621_100029908 Ga0097621_1000299083 391
549 3300006237 Ga0097621_100221094 Ga0097621_1002210942 391
550 3300006358 Ga0068871_100137679 Ga0068871_1001376792 391
551 3300006881 Ga0068865_100011078 Ga0068865_1000110784 391
552 3300006931 Ga0097620_100230199 Ga0097620_1002301993 391
553 3300009098 Ga0105245_10003428 Ga0105245_1000342813 391
554 3300009098 Ga0105245_10024207 Ga0105245_100242073 391
555 3300009176 Ga0105242_10024499 Ga0105242_100244994 391
556 3300009177 Ga0105248_10001274 Ga0105248_1000127415 391
557 3300009177 Ga0105248_10048843 Ga0105248_100488433 391
558 3300010375 Ga0105239_10045649 Ga0105239_100456492 391
559 3300013296 Ga0157374_10022975 Ga0157374_100229753 391
560 3300013297 Ga0157378_10004389 Ga0157378_100043896 391
561 3300013306 Ga0163162_10028719 Ga0163162_100287192 391
562 3300013306 Ga0163162_10198055 Ga0163162_101980552 391
563 3300013308 Ga0157375_10006198 Ga0157375_100061989 391
564 3300013308 Ga0157375_10129546 Ga0157375_101295462 391
565 3300014325 Ga0163163_10062810 Ga0163163_100628102 391
566 3300014968 Ga0157379_10001842 Ga0157379_1000184213 391
567 3300014968 Ga0157379_10047538 Ga0157379_100475383 391
568 3300025898 Ga0207692_10019072 Ga0207692_100190722 391
569 3300025903 Ga0207680_10068797 Ga0207680_100687972 391
570 3300025915 Ga0207693_10017711 Ga0207693_100177114 391
571 3300025916 Ga0207663_10106937 Ga0207663_101069371 391
572 3300025927 Ga0207687_10084153 Ga0207687_100841532 391
573 3300025928 Ga0207700_10041661 Ga0207700_100416612 391
574 3300025931 Ga0207644_10069460 Ga0207644_100694601 391
575 3300025934 Ga0207686_10148430 Ga0207686_101484302 391
576 3300025938 Ga0207704_10010821 Ga0207704_100108214 391
577 3300025939 Ga0207665_10025451 Ga0207665_100254514 391
578 3300025941 Ga0207711_10052359 Ga0207711_100523592 391
579 3300025941 Ga0207711_10158717 Ga0207711_101587172 391
580 3300025986 Ga0207658_10019133 Ga0207658_100191332 391
581 3300026023 Ga0207677_10076897 Ga0207677_100768973 391
582 3300026035 Ga0207703_10073501 Ga0207703_100735012 391
583 3300026035 Ga0207703_10117747 Ga0207703_101177472 391
584 3300026078 Ga0207702_10145648 Ga0207702_101456482 391
585 3300026088 Ga0207641_10111078 Ga0207641_101110781 391
586 3300028379 Ga0268266_10289764 Ga0268266_102897642 391
587 3300028381 Ga0268264_10189831 Ga0268264_101898312 391
588 3300028381 Ga0268264_10196952 Ga0268264_101969522 391
589 3300031456 Ga0307513_10224247 Ga0307513_102242472 391
590 3300035171 Ga0373946_0025346 Ga0373946_0025346_678_1862 391
591 3300036401 Ga0373937_0281199 Ga0373937_0281199_14_1198 391
592 3300037068 Ga0373925_0038198 Ga0373925_0038198_368_1552 391
593 3300039437 Ga0436365_0786183 Ga0436365_0786183_2907_4091 391
594 3300039438 Ga0436360_0549786 Ga0436360_0549786_1634_2845 391
595 3300039453 Ga0436362_1046982 Ga0436362_1046982_496_1680 391
596 3300046681 Ga0495647_0052323 Ga0495647_0052323_136_1320 391
597 3300048903 Ga0496100_0091479 Ga0496100_0091479_786_1970 391
598 3300048904 Ga0496101_0029069 Ga0496101_0029069_916_2100 391
599 3300048906 Ga0496103_0108286 Ga0496103_0108286_457_1641 391
600 3300048908 Ga0496105_0045611 Ga0496105_0045611_936_2120 391
601 3300048909 Ga0496106_0085442 Ga0496106_0085442_32_1216 391
602 3300048910 Ga0496107_0008333 Ga0496107_0008333_819_2003 391
603 3300048911 Ga0496108_0076127 Ga0496108_0076127_1539_2723 391
604 3300048912 Ga0496109_0023480 Ga0496109_0023480_3702_4886 391
605 3300048912 Ga0496109_0248603 Ga0496109_0248603_354_1535 391
606 3300048913 Ga0496110_0002494 Ga0496110_0002494_8604_9788 391
607 3300048914 Ga0496111_0009592 Ga0496111_0009592_495_1679 391
608 3300048915 Ga0496112_0088904 Ga0496112_0088904_1784_2968 391
609 3300048917 Ga0496114_0017056 Ga0496114_0017056_182_1366 391
610 3300048918 Ga0496115_0149142 Ga0496115_0149142_729_1913 391
611 3300053085 Ga0495619_0183072 Ga0495619_0183072_203_1387 391
612 2162886006 SwRhRL3b_contig_933874 SwRhRL3b_0100.00000040 392
613 3300005295 Ga0065707_10084245 Ga0065707_100842454 392
614 3300005336 Ga0070680_100092700 Ga0070680_1000927002 392
615 3300005434 Ga0070709_10010657 Ga0070709_100106573 392
616 3300005434 Ga0070709_10012762 Ga0070709_100127622 392
617 3300005436 Ga0070713_100016072 Ga0070713_1000160722 392
618 3300005545 Ga0070695_100151994 Ga0070695_1001519942 392
619 3300005563 Ga0068855_100002310 Ga0068855_1000023102 392
620 3300005614 Ga0068856_100074697 Ga0068856_1000746973 392
621 3300006028 Ga0070717_10027349 Ga0070717_100273492 392
622 3300006175 Ga0070712_100022076 Ga0070712_1000220764 392
623 3300007265 Ga0099794_10074571 Ga0099794_100745712 392
624 3300007788 Ga0099795_10000064 Ga0099795_100000645 392
625 3300010159 Ga0099796_10000064 Ga0099796_1000006415 392
626 3300021377 Ga0213874_10000731 Ga0213874_100007313 392
627 3300021384 Ga0213876_10048231 Ga0213876_100482312 392
628 3300025912 Ga0207707_10012094 Ga0207707_100120944 392
629 3300025913 Ga0207695_10078512 Ga0207695_100785122 392
630 3300025929 Ga0207664_10015366 Ga0207664_100153663 392
631 3300025939 Ga0207665_10040500 Ga0207665_100405002 392
632 3300025949 Ga0207667_10061826 Ga0207667_100618262 392
633 3300027512 Ga0209179_1000186 Ga0209179_10001862 392
634 3300037466 Ga0395898_0004123 Ga0395898_0004123_6662_7846 392
635 3300037466 Ga0395898_0240714 Ga0395898_0240714_470_1654 392
636 3300039437 Ga0436365_1435536 Ga0436365_1435536_8832_10031 392
637 3300039450 Ga0436363_0494892 Ga0436363_0494892_1153_2340 392
638 3300039450 Ga0436363_1700653 Ga0436363_1700653_2840_4027 392
639 3300044658 Ga0466972_0044062 Ga0466972_0044062_176_1423 392
640 3300044735 Ga0466968_0060649 Ga0466968_0060649_239_1429 392
641 3300048905 Ga0496102_0360558 Ga0496102_0360558_74_1258 392
642 3300048915 Ga0496112_0298100 Ga0496112_0298100_324_1514 392
643 3300049572 Ga0501036_0018058 Ga0501036_0018058_900_2087 392
644 3300049574 Ga0501038_0002611 Ga0501038_0002611_14290_15477 392
645 3300049576 Ga0501040_0035215 Ga0501040_0035215_710_1897 392
646 3300049578 Ga0501042_0033413 Ga0501042_0033413_759_1946 392
647 3300049579 Ga0501043_0055696 Ga0501043_0055696_1025_2212 392
648 3300049580 Ga0501046_0009023 Ga0501046_0009023_526_1713 392
649 3300049582 Ga0501048_0021490 Ga0501048_0021490_829_2016 392
650 3300049584 Ga0501068_0026548 Ga0501068_0026548_1319_2506 392
651 3300049587 Ga0501071_0005352 Ga0501071_0005352_634_1821 392
652 3300049588 Ga0501072_0114344 Ga0501072_0114344_592_1779 392
653 3300049590 Ga0501074_0020850 Ga0501074_0020850_590_1777 392
654 3300049592 Ga0501076_0002080 Ga0501076_0002080_10647_11834 392
655 3300049593 Ga0501077_0028768 Ga0501077_0028768_1618_2805 392
656 3300049743 Ga0501081_0074736 Ga0501081_0074736_999_2186 392
657 3300049824 Ga0501045_0000225 Ga0501045_0000225_10880_12067 392
658 3300053104 Ga0500556_0001074 Ga0500556_0001074_11821_13011 392
659 3300054114 Ga0501084_0007407 Ga0501084_0007407_708_1895 392
660 3300061734 Ga0530510_0033069 Ga0530510_0033069_650_1837 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00988

CPSase_sm_chain

Carbamoyl-phosphate synthase small chain, CPSase domain

7

132

0.99

PF00117

GATase

Glutamine amidotransferase class-I

191

369

0.97

PF07722

Peptidase_C26

Peptidase C26

233

351

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1c30-assembly1.cif.gz_B crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s 0.9647 3 377
1jdb-assembly1.cif.gz_F carbamoyl phosphate synthetase from escherichia coli 0.9643 3 374
1t36-assembly1.cif.gz_B crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate 0.9614 3 374
1a9x-assembly1.cif.gz_B carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis 0.9611 3 374
1cs0-assembly4.cif.gz_B crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde 0.961 3 374
ID Description Score Start End Superfamily
af_Q2FZ73_174_352_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9641 193 368 3.40.50.880
af_P0A6F1_2_151_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9625 3 151 3.50.30.20
af_Q58425_140_353_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9555 148 372 3.40.50.880
af_P0A6F1_2_151_3.50.30.20 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain 0.9501 3 151 3.50.30.20
1a9xD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9462 152 374 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V8A7U4-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.9928 189 341 GO:0004088
GO:0005524
AF-A0A377E2M5-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.9908 209 315 GO:0004088
GO:0005524
AF-A0A7Z9XQK1-F1-model_v4 carbamoyl-phosphate synthase (ammonia) (EC 6.3.4.16) 0.9902 190 350 GO:0004088
GO:0005524
GO:0005737
GO:0006221
GO:0006541
GO:0046872
AF-A0A530QES6-F1-model_v4 carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) 0.9884 254 344 GO:0005524
GO:0016874
AF-A0A258TXK5-F1-model_v4 deleted 0.9793 207 372

Feature Viewer

pLDDT pTM Quality
88.84 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map