F473342
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 660 | 323 | 659 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10016809|Ga0265338_100168093 |
| Length | 391 |
| Sequence | MTAPAVLALADGSIFRGHSIGAPGNTTGEVVFNTAITGYQEILTDPSYARQIVTLTYPHIGNTGVTPEDMESSQIYAAGLVVRDLSLVPSSWRASGSLNEFLLRGRIVAIAGIDTRRLTRLLREKGAQAGCIMTGEKMDETAAVRAARAFPGLKGMDLAKVVTTRAPYQWNDGSIGRDAAPVRAQQRLHVVAYDYGIKRNILRLISDQGCRVTVVPASTTSADVLALNPDGVFLSNGPGDPEPCDYAIKAIAELLETDVPIFGICLGHQLLGLASGARTVKMKFGHHGANHPVQELATGRVMITSQNHGFAVDEATLPQNLVATHRSLFDGTLQGVARTDRSAFSFQGHPEASPGPHDLRPLFETFVQAMVRRLQQQLRALRSSRKQSAER |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2738541276 | Cellvibrio sp. YR554 | Isolate | Unclassified |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 78 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 79 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 168 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 172 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 182 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 183 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 184 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 191 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 197 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 198 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 207 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 212 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 213 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 216 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 217 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 221 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 222 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 224 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 227 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 228 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 231 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 232 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 233 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 234 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 253 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 254 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 255 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 256 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 257 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 260 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 261 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 265 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 266 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 267 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 268 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 269 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 270 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 308 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 309 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 310 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 311 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 313 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 314 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 316 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 319 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 320 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.79 |
| Metatranscriptomes | 1.06 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.18 |
| Nodule | 0 |
| Rhizoplane | 3.79 |
| Rhizosphere | 86.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_933874 | 2162886006 | Bacteria | 1426 |
| 2 | JGI25159J45721_1005457 | 3300002987 | Bacteria | 3992 |
| 3 | rootH1_10023252 | 3300003316 | Bacteria | 4050 |
| 4 | rootH1_10113855 | 3300003323 | Bacteria | 1327 |
| 5 | rootH1_10145992 | 3300003323 | Bacteria | 4286 |
| 6 | Ga0065165_1000005 | 3300005262 | Bacteria | 370361 |
| 7 | Ga0065712_10123532 | 3300005290 | Bacteria | 1637 |
| 8 | Ga0065707_10083371 | 3300005295 | Bacteria | 9412 |
| 9 | Ga0065707_10084245 | 3300005295 | Bacteria | 7466 |
| 10 | Ga0065707_10086319 | 3300005295 | Bacteria | 5535 |
| 11 | Ga0070683_100132795 | 3300005329 | Bacteria | 2356 |
| 12 | Ga0070690_100006774 | 3300005330 | Bacteria | 6513 |
| 13 | Ga0070690_100008754 | 3300005330 | Bacteria | 5843 |
| 14 | Ga0070690_100038508 | 3300005330 | Bacteria | 3018 |
| 15 | Ga0070690_100069449 | 3300005330 | Bacteria | 2286 |
| 16 | Ga0070670_100000026 | 3300005331 | Bacteria | 187946 |
| 17 | Ga0070670_100052826 | 3300005331 | Bacteria | 3490 |
| 18 | Ga0068869_100001531 | 3300005334 | Bacteria | 13721 |
| 19 | Ga0068869_100049289 | 3300005334 | Bacteria | 3048 |
| 20 | Ga0070666_10004984 | 3300005335 | Bacteria | 8120 |
| 21 | Ga0070666_10013909 | 3300005335 | Bacteria | 5113 |
| 22 | Ga0070666_10021429 | 3300005335 | Bacteria | 4190 |
| 23 | Ga0070666_10063371 | 3300005335 | Bacteria | 2506 |
| 24 | Ga0070666_10080748 | 3300005335 | Bacteria | 2223 |
| 25 | Ga0070666_10097785 | 3300005335 | Bacteria | 2021 |
| 26 | Ga0070680_100064698 | 3300005336 | Bacteria | 2997 |
| 27 | Ga0070680_100092700 | 3300005336 | Bacteria | 2502 |
| 28 | Ga0070680_100124261 | 3300005336 | Bacteria | 2155 |
| 29 | Ga0070682_100016908 | 3300005337 | Bacteria | 4246 |
| 30 | Ga0070682_100085373 | 3300005337 | Bacteria | 2053 |
| 31 | Ga0068868_100003997 | 3300005338 | Bacteria | 10290 |
| 32 | Ga0068868_100021382 | 3300005338 | Bacteria | 4871 |
| 33 | Ga0070689_100000263 | 3300005340 | Bacteria | 30207 |
| 34 | Ga0070689_100008129 | 3300005340 | Bacteria | 7372 |
| 35 | Ga0070687_100111430 | 3300005343 | Bacteria | 1549 |
| 36 | Ga0070661_100090912 | 3300005344 | Bacteria | 2260 |
| 37 | Ga0070661_100102142 | 3300005344 | Bacteria | 2134 |
| 38 | Ga0070692_10066758 | 3300005345 | Bacteria | 1908 |
| 39 | Ga0070668_100004213 | 3300005347 | Bacteria | 10667 |
| 40 | Ga0070669_100008527 | 3300005353 | Bacteria | 7317 |
| 41 | Ga0070675_100001875 | 3300005354 | Bacteria | 15503 |
| 42 | Ga0070675_100021713 | 3300005354 | Bacteria | 5128 |
| 43 | Ga0070671_100001253 | 3300005355 | Bacteria | 19029 |
| 44 | Ga0070671_100005822 | 3300005355 | Bacteria | 9818 |
| 45 | Ga0070671_100008250 | 3300005355 | Bacteria | 8335 |
| 46 | Ga0070671_100010104 | 3300005355 | Bacteria | 7580 |
| 47 | Ga0070671_100010526 | 3300005355 | Bacteria | 7425 |
| 48 | Ga0070674_100241757 | 3300005356 | Bacteria | 1414 |
| 49 | Ga0070673_100135847 | 3300005364 | Bacteria | 2070 |
| 50 | Ga0070667_100000002 | 3300005367 | Bacteria | 504831 |
| 51 | Ga0070667_100000720 | 3300005367 | Bacteria | 31810 |
| 52 | Ga0070667_100003642 | 3300005367 | Bacteria | 13114 |
| 53 | Ga0070667_100072368 | 3300005367 | Bacteria | 2937 |
| 54 | Ga0070709_10010657 | 3300005434 | Bacteria | 5097 |
| 55 | Ga0070709_10012762 | 3300005434 | Bacteria | 4707 |
| 56 | Ga0070714_100195152 | 3300005435 | Bacteria | 1849 |
| 57 | Ga0070713_100004316 | 3300005436 | Bacteria | 9531 |
| 58 | Ga0070713_100016072 | 3300005436 | Bacteria | 5620 |
| 59 | Ga0070710_10003683 | 3300005437 | Bacteria | 7249 |
| 60 | Ga0070705_100027352 | 3300005440 | Bacteria | 3113 |
| 61 | Ga0070700_100011270 | 3300005441 | Bacteria | 4949 |
| 62 | Ga0070700_100080301 | 3300005441 | Bacteria | 2104 |
| 63 | Ga0070694_100099900 | 3300005444 | Bacteria | 2051 |
| 64 | Ga0070694_100245692 | 3300005444 | Bacteria | 1352 |
| 65 | Ga0070663_100093389 | 3300005455 | Bacteria | 2232 |
| 66 | Ga0070678_100070124 | 3300005456 | Bacteria | 2619 |
| 67 | Ga0070662_100042633 | 3300005457 | Bacteria | 3242 |
| 68 | Ga0070662_100091203 | 3300005457 | Bacteria | 2288 |
| 69 | Ga0070681_10014959 | 3300005458 | Bacteria | 7715 |
| 70 | Ga0068867_100017933 | 3300005459 | Bacteria | 5030 |
| 71 | Ga0070685_10000017 | 3300005466 | Bacteria | 110716 |
| 72 | Ga0070685_10009087 | 3300005466 | Bacteria | 5128 |
| 73 | Ga0070685_10024484 | 3300005466 | Bacteria | 3316 |
| 74 | Ga0070679_100006742 | 3300005530 | Bacteria | 10709 |
| 75 | Ga0070679_100012588 | 3300005530 | Bacteria | 8088 |
| 76 | Ga0070679_100081686 | 3300005530 | Bacteria | 3221 |
| 77 | Ga0070679_100189949 | 3300005530 | Bacteria | 2023 |
| 78 | Ga0070684_100179436 | 3300005535 | Bacteria | 1925 |
| 79 | Ga0068853_100093337 | 3300005539 | Bacteria | 2649 |
| 80 | Ga0070672_100069104 | 3300005543 | Bacteria | 2803 |
| 81 | Ga0070672_100077217 | 3300005543 | Bacteria | 2662 |
| 82 | Ga0070672_100083583 | 3300005543 | Bacteria | 2563 |
| 83 | Ga0070686_100010277 | 3300005544 | Bacteria | 5272 |
| 84 | Ga0070695_100151994 | 3300005545 | Bacteria | 1616 |
| 85 | Ga0070665_100003917 | 3300005548 | Bacteria | 15715 |
| 86 | Ga0070665_100005912 | 3300005548 | Bacteria | 12536 |
| 87 | Ga0070665_100006479 | 3300005548 | Bacteria | 11908 |
| 88 | Ga0070665_100026780 | 3300005548 | Bacteria | 5807 |
| 89 | Ga0070665_100084241 | 3300005548 | Bacteria | 3184 |
| 90 | Ga0070665_100114571 | 3300005548 | Bacteria | 2698 |
| 91 | Ga0068855_100002113 | 3300005563 | Bacteria | 24577 |
| 92 | Ga0068855_100002310 | 3300005563 | Bacteria | 23575 |
| 93 | Ga0068855_100004233 | 3300005563 | Bacteria | 17522 |
| 94 | Ga0068855_100008348 | 3300005563 | Bacteria | 12524 |
| 95 | Ga0068855_100172081 | 3300005563 | Bacteria | 2452 |
| 96 | Ga0070664_100004667 | 3300005564 | Bacteria | 10997 |
| 97 | Ga0070664_100014593 | 3300005564 | Bacteria | 6409 |
| 98 | Ga0070664_100123586 | 3300005564 | Bacteria | 2268 |
| 99 | Ga0068857_100055415 | 3300005577 | Bacteria | 3519 |
| 100 | Ga0068854_100056225 | 3300005578 | Bacteria | 2835 |
| 101 | Ga0068856_100004637 | 3300005614 | Bacteria | 13653 |
| 102 | Ga0068856_100039178 | 3300005614 | Bacteria | 4652 |
| 103 | Ga0068856_100074697 | 3300005614 | Bacteria | 3357 |
| 104 | Ga0068856_100121331 | 3300005614 | Bacteria | 2615 |
| 105 | Ga0070702_100000859 | 3300005615 | Bacteria | 11745 |
| 106 | Ga0070702_100017081 | 3300005615 | Bacteria | 3736 |
| 107 | Ga0070702_100178487 | 3300005615 | Bacteria | 1388 |
| 108 | Ga0068852_100171413 | 3300005616 | Bacteria | 2034 |
| 109 | Ga0068859_100000874 | 3300005617 | Bacteria | 30722 |
| 110 | Ga0068859_100019271 | 3300005617 | Bacteria | 6854 |
| 111 | Ga0068859_100026348 | 3300005617 | Bacteria | 5829 |
| 112 | Ga0068859_100130588 | 3300005617 | Bacteria | 2583 |
| 113 | Ga0068859_100230198 | 3300005617 | Bacteria | 1941 |
| 114 | Ga0068864_100000002 | 3300005618 | Bacteria | 658857 |
| 115 | Ga0068864_100005830 | 3300005618 | Bacteria | 10101 |
| 116 | Ga0068864_100018543 | 3300005618 | Bacteria | 5816 |
| 117 | Ga0068864_100061846 | 3300005618 | Bacteria | 3243 |
| 118 | Ga0068866_10033150 | 3300005718 | Bacteria | 2503 |
| 119 | Ga0068866_10076338 | 3300005718 | Bacteria | 1786 |
| 120 | Ga0068861_100014180 | 3300005719 | Bacteria | 5590 |
| 121 | Ga0068861_100015877 | 3300005719 | Bacteria | 5317 |
| 122 | Ga0068861_100104874 | 3300005719 | Bacteria | 2256 |
| 123 | Ga0068870_10002121 | 3300005840 | Bacteria | 8212 |
| 124 | Ga0068863_100006917 | 3300005841 | Bacteria | 11116 |
| 125 | Ga0068863_100007301 | 3300005841 | Bacteria | 10824 |
| 126 | Ga0068863_100012364 | 3300005841 | Bacteria | 8244 |
| 127 | Ga0068863_100013946 | 3300005841 | Bacteria | 7747 |
| 128 | Ga0068863_100020718 | 3300005841 | Bacteria | 6280 |
| 129 | Ga0068863_100130265 | 3300005841 | Bacteria | 2401 |
| 130 | Ga0068858_100001638 | 3300005842 | Bacteria | 22845 |
| 131 | Ga0068858_100004005 | 3300005842 | Bacteria | 14540 |
| 132 | Ga0068858_100013113 | 3300005842 | Bacteria | 7817 |
| 133 | Ga0068858_100017248 | 3300005842 | Bacteria | 6773 |
| 134 | Ga0068858_100031011 | 3300005842 | Bacteria | 4965 |
| 135 | Ga0068858_100084944 | 3300005842 | Bacteria | 2944 |
| 136 | Ga0068860_100004745 | 3300005843 | Bacteria | 13852 |
| 137 | Ga0068860_100017392 | 3300005843 | Bacteria | 7005 |
| 138 | Ga0068860_100019554 | 3300005843 | Bacteria | 6565 |
| 139 | Ga0068860_100035152 | 3300005843 | Bacteria | 4808 |
| 140 | Ga0068860_100036508 | 3300005843 | Bacteria | 4708 |
| 141 | Ga0068860_100040591 | 3300005843 | Bacteria | 4447 |
| 142 | Ga0068860_100105850 | 3300005843 | Bacteria | 2686 |
| 143 | Ga0068860_100202558 | 3300005843 | Bacteria | 1924 |
| 144 | Ga0068862_100011434 | 3300005844 | Bacteria | 7327 |
| 145 | Ga0068862_100017468 | 3300005844 | Bacteria | 5976 |
| 146 | Ga0081455_10000043 | 3300005937 | Bacteria | 132283 |
| 147 | Ga0081455_10041380 | 3300005937 | Bacteria | 4052 |
| 148 | Ga0081455_10215988 | 3300005937 | Bacteria | 1425 |
| 149 | Ga0081539_10000046 | 3300005985 | Bacteria | 275677 |
| 150 | Ga0070717_10027349 | 3300006028 | Bacteria | 4558 |
| 151 | Ga0070712_100002659 | 3300006175 | Bacteria | 11030 |
| 152 | Ga0070712_100022076 | 3300006175 | Bacteria | 4188 |
| 153 | Ga0097621_100009176 | 3300006237 | Bacteria | 7170 |
| 154 | Ga0097621_100029908 | 3300006237 | Bacteria | 4306 |
| 155 | Ga0097621_100034118 | 3300006237 | Bacteria | 4057 |
| 156 | Ga0097621_100102463 | 3300006237 | Bacteria | 2410 |
| 157 | Ga0097621_100119956 | 3300006237 | Bacteria | 2229 |
| 158 | Ga0097621_100221094 | 3300006237 | Bacteria | 1650 |
| 159 | Ga0068871_100063106 | 3300006358 | Bacteria | 3029 |
| 160 | Ga0068871_100127377 | 3300006358 | Bacteria | 2156 |
| 161 | Ga0068871_100137679 | 3300006358 | Bacteria | 2074 |
| 162 | Ga0068871_100281303 | 3300006358 | Bacteria | 1455 |
| 163 | Ga0075428_100003215 | 3300006844 | Bacteria | 17873 |
| 164 | Ga0075428_100009769 | 3300006844 | Bacteria | 10665 |
| 165 | Ga0075428_100058436 | 3300006844 | Bacteria | 4222 |
| 166 | Ga0075430_100005652 | 3300006846 | Bacteria | 10560 |
| 167 | Ga0075430_100088134 | 3300006846 | Bacteria | 2597 |
| 168 | Ga0075431_100001747 | 3300006847 | Bacteria | 20431 |
| 169 | Ga0075431_100009224 | 3300006847 | Bacteria | 9901 |
| 170 | Ga0075433_10133273 | 3300006852 | Bacteria | 2208 |
| 171 | Ga0075429_100010602 | 3300006880 | Bacteria | 7974 |
| 172 | Ga0075429_100020882 | 3300006880 | Bacteria | 5682 |
| 173 | Ga0068865_100011078 | 3300006881 | Bacteria | 5632 |
| 174 | Ga0068865_100065293 | 3300006881 | Bacteria | 2563 |
| 175 | Ga0097620_100000873 | 3300006931 | Bacteria | 30722 |
| 176 | Ga0097620_100019273 | 3300006931 | Bacteria | 6854 |
| 177 | Ga0097620_100026348 | 3300006931 | Bacteria | 5829 |
| 178 | Ga0097620_100130574 | 3300006931 | Bacteria | 2583 |
| 179 | Ga0097620_100230199 | 3300006931 | Bacteria | 1941 |
| 180 | Ga0099794_10074571 | 3300007265 | Bacteria | 1666 |
| 181 | Ga0099795_10000064 | 3300007788 | Bacteria | 18756 |
| 182 | Ga0105250_10000023 | 3300009092 | Bacteria | 219389 |
| 183 | Ga0105240_10010435 | 3300009093 | Bacteria | 13050 |
| 184 | Ga0105240_10022715 | 3300009093 | Bacteria | 8309 |
| 185 | Ga0105240_10070901 | 3300009093 | Bacteria | 4310 |
| 186 | Ga0105240_10115396 | 3300009093 | Bacteria | 3242 |
| 187 | Ga0105240_10299647 | 3300009093 | Bacteria | 1839 |
| 188 | Ga0111539_10015226 | 3300009094 | Bacteria | 9583 |
| 189 | Ga0111539_10036722 | 3300009094 | Bacteria | 5921 |
| 190 | Ga0111539_10180942 | 3300009094 | Bacteria | 2462 |
| 191 | Ga0111539_10617544 | 3300009094 | Bacteria | 1262 |
| 192 | Ga0105245_10003428 | 3300009098 | Bacteria | 14208 |
| 193 | Ga0105245_10003531 | 3300009098 | Bacteria | 13979 |
| 194 | Ga0105245_10024207 | 3300009098 | Bacteria | 5330 |
| 195 | Ga0105247_10000812 | 3300009101 | Bacteria | 23804 |
| 196 | Ga0105247_10023669 | 3300009101 | Bacteria | 3701 |
| 197 | Ga0105243_10177901 | 3300009148 | Bacteria | 1848 |
| 198 | Ga0105242_10024499 | 3300009176 | Bacteria | 4767 |
| 199 | Ga0105248_10001274 | 3300009177 | Bacteria | 28163 |
| 200 | Ga0105248_10010033 | 3300009177 | Bacteria | 10429 |
| 201 | Ga0105248_10022613 | 3300009177 | Bacteria | 6977 |
| 202 | Ga0105248_10048843 | 3300009177 | Bacteria | 4746 |
| 203 | Ga0105248_10122635 | 3300009177 | Bacteria | 2932 |
| 204 | Ga0105248_10134845 | 3300009177 | Bacteria | 2785 |
| 205 | Ga0105248_10479878 | 3300009177 | Bacteria | 1401 |
| 206 | Ga0105237_10072969 | 3300009545 | Bacteria | 3425 |
| 207 | Ga0105237_10222904 | 3300009545 | Bacteria | 1886 |
| 208 | Ga0105237_10250118 | 3300009545 | Bacteria | 1775 |
| 209 | Ga0105238_10012704 | 3300009551 | Bacteria | 8499 |
| 210 | Ga0105238_10112485 | 3300009551 | Bacteria | 2702 |
| 211 | Ga0105238_10182229 | 3300009551 | Bacteria | 2077 |
| 212 | Ga0105238_10199339 | 3300009551 | Bacteria | 1977 |
| 213 | Ga0105249_10021727 | 3300009553 | Bacteria | 5745 |
| 214 | Ga0105249_10030234 | 3300009553 | Bacteria | 4895 |
| 215 | Ga0105249_10048911 | 3300009553 | Bacteria | 3856 |
| 216 | Ga0105249_10130073 | 3300009553 | Bacteria | 2402 |
| 217 | Ga0105249_10151161 | 3300009553 | Bacteria | 2235 |
| 218 | Ga0099796_10000064 | 3300010159 | Bacteria | 18870 |
| 219 | Ga0105239_10045649 | 3300010375 | Bacteria | 4802 |
| 220 | Ga0105239_10090904 | 3300010375 | Bacteria | 3368 |
| 221 | Ga0105239_10275151 | 3300010375 | Bacteria | 1894 |
| 222 | Ga0105239_10521620 | 3300010375 | Bacteria | 1352 |
| 223 | Ga0105246_10003632 | 3300011119 | Bacteria | 9335 |
| 224 | Ga0157370_10358494 | 3300013104 | Bacteria | 1344 |
| 225 | Ga0157369_10020260 | 3300013105 | Bacteria | 7434 |
| 226 | Ga0157369_10091026 | 3300013105 | Bacteria | 3257 |
| 227 | Ga0157374_10002676 | 3300013296 | Bacteria | 14991 |
| 228 | Ga0157374_10022975 | 3300013296 | Bacteria | 5569 |
| 229 | Ga0157374_10062863 | 3300013296 | Bacteria | 3481 |
| 230 | Ga0157374_10165244 | 3300013296 | Bacteria | 2157 |
| 231 | Ga0157378_10004389 | 3300013297 | Bacteria | 12416 |
| 232 | Ga0157378_10264533 | 3300013297 | Bacteria | 1652 |
| 233 | Ga0163162_10028719 | 3300013306 | Bacteria | 5506 |
| 234 | Ga0163162_10041271 | 3300013306 | Bacteria | 4616 |
| 235 | Ga0163162_10042631 | 3300013306 | Bacteria | 4543 |
| 236 | Ga0163162_10063692 | 3300013306 | Bacteria | 3731 |
| 237 | Ga0163162_10139635 | 3300013306 | Bacteria | 2535 |
| 238 | Ga0163162_10198055 | 3300013306 | Bacteria | 2137 |
| 239 | Ga0157372_10172491 | 3300013307 | Bacteria | 2502 |
| 240 | Ga0157375_10006198 | 3300013308 | Bacteria | 10419 |
| 241 | Ga0157375_10023229 | 3300013308 | Bacteria | 5718 |
| 242 | Ga0157375_10033274 | 3300013308 | Bacteria | 4897 |
| 243 | Ga0157375_10058031 | 3300013308 | Bacteria | 3828 |
| 244 | Ga0157375_10063704 | 3300013308 | Bacteria | 3669 |
| 245 | Ga0157375_10129546 | 3300013308 | Bacteria | 2641 |
| 246 | Ga0163163_10000264 | 3300014325 | Bacteria | 52945 |
| 247 | Ga0163163_10023635 | 3300014325 | Bacteria | 5835 |
| 248 | Ga0163163_10062810 | 3300014325 | Bacteria | 3681 |
| 249 | Ga0163163_10188056 | 3300014325 | Bacteria | 2113 |
| 250 | Ga0157380_10010360 | 3300014326 | Bacteria | 6705 |
| 251 | Ga0157380_10019037 | 3300014326 | Bacteria | 5110 |
| 252 | Ga0157380_10024535 | 3300014326 | Bacteria | 4564 |
| 253 | Ga0157377_10109972 | 3300014745 | Bacteria | 1655 |
| 254 | Ga0157379_10000613 | 3300014968 | Bacteria | 28842 |
| 255 | Ga0157379_10001382 | 3300014968 | Bacteria | 19853 |
| 256 | Ga0157379_10001842 | 3300014968 | Bacteria | 17527 |
| 257 | Ga0157379_10047538 | 3300014968 | Bacteria | 3828 |
| 258 | Ga0157379_10113967 | 3300014968 | Bacteria | 2430 |
| 259 | Ga0157379_10118190 | 3300014968 | Bacteria | 2384 |
| 260 | Ga0157376_10037640 | 3300014969 | Bacteria | 3930 |
| 261 | Ga0157376_10047753 | 3300014969 | Bacteria | 3536 |
| 262 | Ga0213874_10000731 | 3300021377 | Bacteria | 6643 |
| 263 | Ga0213876_10048231 | 3300021384 | Bacteria | 2251 |
| 264 | Ga0209130_1000046 | 3300025284 | Bacteria | 236658 |
| 265 | Ga0207696_1000098 | 3300025711 | Bacteria | 175181 |
| 266 | Ga0207682_10075214 | 3300025893 | Bacteria | 1437 |
| 267 | Ga0207692_10019072 | 3300025898 | Bacteria | 3093 |
| 268 | Ga0207642_10073020 | 3300025899 | Bacteria | 1640 |
| 269 | Ga0207710_10000200 | 3300025900 | Bacteria | 56100 |
| 270 | Ga0207710_10005579 | 3300025900 | Bacteria | 5415 |
| 271 | Ga0207688_10032245 | 3300025901 | Bacteria | 2895 |
| 272 | Ga0207680_10005217 | 3300025903 | Bacteria | 6197 |
| 273 | Ga0207680_10021698 | 3300025903 | Bacteria | 3478 |
| 274 | Ga0207680_10023718 | 3300025903 | Bacteria | 3355 |
| 275 | Ga0207680_10068797 | 3300025903 | Bacteria | 2185 |
| 276 | Ga0207647_10053465 | 3300025904 | Bacteria | 2489 |
| 277 | Ga0207699_10010612 | 3300025906 | Bacteria | 4631 |
| 278 | Ga0207643_10012443 | 3300025908 | Bacteria | 4599 |
| 279 | Ga0207643_10121589 | 3300025908 | Bacteria | 1547 |
| 280 | Ga0207707_10000045 | 3300025912 | Bacteria | 122598 |
| 281 | Ga0207707_10007017 | 3300025912 | Bacteria | 9824 |
| 282 | Ga0207707_10012094 | 3300025912 | Bacteria | 7507 |
| 283 | Ga0207695_10047075 | 3300025913 | Bacteria | 4567 |
| 284 | Ga0207695_10052514 | 3300025913 | Bacteria | 4270 |
| 285 | Ga0207695_10078512 | 3300025913 | Bacteria | 3349 |
| 286 | Ga0207695_10170960 | 3300025913 | Bacteria | 2099 |
| 287 | Ga0207695_10216300 | 3300025913 | Bacteria | 1825 |
| 288 | Ga0207671_10017617 | 3300025914 | Bacteria | 5500 |
| 289 | Ga0207693_10017711 | 3300025915 | Bacteria | 5681 |
| 290 | Ga0207693_10178695 | 3300025915 | Bacteria | 1670 |
| 291 | Ga0207663_10106937 | 3300025916 | Bacteria | 1891 |
| 292 | Ga0207660_10000958 | 3300025917 | Bacteria | 19113 |
| 293 | Ga0207660_10072962 | 3300025917 | Bacteria | 2501 |
| 294 | Ga0207660_10145694 | 3300025917 | Bacteria | 1815 |
| 295 | Ga0207662_10022281 | 3300025918 | Bacteria | 3630 |
| 296 | Ga0207649_10039433 | 3300025920 | Bacteria | 2864 |
| 297 | Ga0207649_10078078 | 3300025920 | Bacteria | 2135 |
| 298 | Ga0207652_10010022 | 3300025921 | Bacteria | 7631 |
| 299 | Ga0207652_10010582 | 3300025921 | Bacteria | 7425 |
| 300 | Ga0207652_10036915 | 3300025921 | Bacteria | 4133 |
| 301 | Ga0207652_10209774 | 3300025921 | Bacteria | 1754 |
| 302 | Ga0207681_10002680 | 3300025923 | Bacteria | 11274 |
| 303 | Ga0207681_10008163 | 3300025923 | Bacteria | 6400 |
| 304 | Ga0207681_10020588 | 3300025923 | Bacteria | 4183 |
| 305 | Ga0207681_10020824 | 3300025923 | Bacteria | 4162 |
| 306 | Ga0207650_10000002 | 3300025925 | Bacteria | 1439222 |
| 307 | Ga0207650_10048847 | 3300025925 | Bacteria | 3122 |
| 308 | Ga0207650_10075060 | 3300025925 | Bacteria | 2550 |
| 309 | Ga0207659_10003977 | 3300025926 | Bacteria | 8918 |
| 310 | Ga0207659_10067596 | 3300025926 | Bacteria | 2596 |
| 311 | Ga0207687_10084153 | 3300025927 | Bacteria | 2305 |
| 312 | Ga0207687_10138625 | 3300025927 | Bacteria | 1843 |
| 313 | Ga0207700_10041661 | 3300025928 | Bacteria | 3361 |
| 314 | Ga0207664_10000585 | 3300025929 | Bacteria | 25440 |
| 315 | Ga0207664_10015366 | 3300025929 | Bacteria | 5553 |
| 316 | Ga0207664_10171775 | 3300025929 | Bacteria | 1856 |
| 317 | Ga0207644_10002895 | 3300025931 | Bacteria | 11061 |
| 318 | Ga0207644_10055538 | 3300025931 | Bacteria | 2854 |
| 319 | Ga0207644_10069460 | 3300025931 | Bacteria | 2572 |
| 320 | Ga0207706_10043252 | 3300025933 | Bacteria | 3992 |
| 321 | Ga0207686_10148430 | 3300025934 | Bacteria | 1629 |
| 322 | Ga0207670_10015580 | 3300025936 | Bacteria | 4546 |
| 323 | Ga0207669_10120589 | 3300025937 | Bacteria | 1779 |
| 324 | Ga0207704_10010821 | 3300025938 | Bacteria | 4467 |
| 325 | Ga0207704_10074205 | 3300025938 | Bacteria | 2170 |
| 326 | Ga0207665_10025451 | 3300025939 | Bacteria | 3905 |
| 327 | Ga0207665_10040500 | 3300025939 | Bacteria | 3109 |
| 328 | Ga0207691_10015457 | 3300025940 | Bacteria | 7258 |
| 329 | Ga0207691_10029366 | 3300025940 | Bacteria | 5144 |
| 330 | Ga0207691_10285172 | 3300025940 | Bacteria | 1421 |
| 331 | Ga0207711_10000061 | 3300025941 | Bacteria | 125523 |
| 332 | Ga0207711_10007410 | 3300025941 | Bacteria | 9182 |
| 333 | Ga0207711_10013097 | 3300025941 | Bacteria | 6889 |
| 334 | Ga0207711_10024939 | 3300025941 | Bacteria | 5015 |
| 335 | Ga0207711_10052359 | 3300025941 | Bacteria | 3498 |
| 336 | Ga0207711_10158717 | 3300025941 | Bacteria | 2045 |
| 337 | Ga0207689_10005143 | 3300025942 | Bacteria | 11759 |
| 338 | Ga0207689_10153252 | 3300025942 | Bacteria | 1900 |
| 339 | Ga0207689_10212450 | 3300025942 | Bacteria | 1599 |
| 340 | Ga0207689_10225858 | 3300025942 | Bacteria | 1547 |
| 341 | Ga0207661_10042350 | 3300025944 | Bacteria | 3590 |
| 342 | Ga0207679_10001408 | 3300025945 | Bacteria | 15155 |
| 343 | Ga0207679_10030141 | 3300025945 | Bacteria | 3785 |
| 344 | Ga0207667_10000887 | 3300025949 | Bacteria | 38097 |
| 345 | Ga0207667_10001163 | 3300025949 | Bacteria | 33062 |
| 346 | Ga0207667_10010839 | 3300025949 | Bacteria | 10632 |
| 347 | Ga0207667_10061826 | 3300025949 | Bacteria | 3917 |
| 348 | Ga0207651_10005853 | 3300025960 | Bacteria | 6356 |
| 349 | Ga0207712_10015524 | 3300025961 | Bacteria | 4916 |
| 350 | Ga0207712_10020847 | 3300025961 | Bacteria | 4298 |
| 351 | Ga0207712_10029484 | 3300025961 | Bacteria | 3681 |
| 352 | Ga0207640_10074899 | 3300025981 | Bacteria | 2292 |
| 353 | Ga0207658_10000001 | 3300025986 | Bacteria | 1439333 |
| 354 | Ga0207658_10010618 | 3300025986 | Bacteria | 6258 |
| 355 | Ga0207658_10019133 | 3300025986 | Bacteria | 4735 |
| 356 | Ga0207677_10020565 | 3300026023 | Bacteria | 4010 |
| 357 | Ga0207677_10076897 | 3300026023 | Bacteria | 2378 |
| 358 | Ga0207677_10106082 | 3300026023 | Bacteria | 2081 |
| 359 | Ga0207703_10000919 | 3300026035 | Bacteria | 28682 |
| 360 | Ga0207703_10001227 | 3300026035 | Bacteria | 23976 |
| 361 | Ga0207703_10010064 | 3300026035 | Bacteria | 7414 |
| 362 | Ga0207703_10017376 | 3300026035 | Bacteria | 5616 |
| 363 | Ga0207703_10073501 | 3300026035 | Bacteria | 2829 |
| 364 | Ga0207703_10117747 | 3300026035 | Bacteria | 2276 |
| 365 | Ga0207703_10135430 | 3300026035 | Bacteria | 2132 |
| 366 | Ga0207678_10023231 | 3300026067 | Bacteria | 5424 |
| 367 | Ga0207708_10058644 | 3300026075 | Bacteria | 2937 |
| 368 | Ga0207708_10081703 | 3300026075 | Bacteria | 2484 |
| 369 | Ga0207702_10145648 | 3300026078 | Bacteria | 2149 |
| 370 | Ga0207641_10001010 | 3300026088 | Bacteria | 28635 |
| 371 | Ga0207641_10054966 | 3300026088 | Bacteria | 3380 |
| 372 | Ga0207641_10076110 | 3300026088 | Bacteria | 2900 |
| 373 | Ga0207641_10111078 | 3300026088 | Bacteria | 2430 |
| 374 | Ga0207641_10147808 | 3300026088 | Bacteria | 2126 |
| 375 | Ga0207648_10024776 | 3300026089 | Bacteria | 5353 |
| 376 | Ga0207648_10091879 | 3300026089 | Bacteria | 2654 |
| 377 | Ga0207648_10258276 | 3300026089 | Bacteria | 1554 |
| 378 | Ga0207676_10000001 | 3300026095 | Bacteria | 1439222 |
| 379 | Ga0207676_10001992 | 3300026095 | Bacteria | 14870 |
| 380 | Ga0207674_10055041 | 3300026116 | Bacteria | 4048 |
| 381 | Ga0207674_10132419 | 3300026116 | Bacteria | 2456 |
| 382 | Ga0207674_10134064 | 3300026116 | Bacteria | 2439 |
| 383 | Ga0207675_100040897 | 3300026118 | Bacteria | 4331 |
| 384 | Ga0207675_100045106 | 3300026118 | Bacteria | 4119 |
| 385 | Ga0207675_100056867 | 3300026118 | Bacteria | 3649 |
| 386 | Ga0207675_100323301 | 3300026118 | Bacteria | 1507 |
| 387 | Ga0207683_10016715 | 3300026121 | Bacteria | 6243 |
| 388 | Ga0207683_10333408 | 3300026121 | Bacteria | 1390 |
| 389 | Ga0209179_1000186 | 3300027512 | Bacteria | 5763 |
| 390 | Ga0207428_10031138 | 3300027907 | Bacteria | 4406 |
| 391 | Ga0207428_10049106 | 3300027907 | Bacteria | 3382 |
| 392 | Ga0207428_10107016 | 3300027907 | Bacteria | 2155 |
| 393 | Ga0268266_10003850 | 3300028379 | Bacteria | 14650 |
| 394 | Ga0268266_10007403 | 3300028379 | Bacteria | 9912 |
| 395 | Ga0268266_10019683 | 3300028379 | Bacteria | 5751 |
| 396 | Ga0268266_10026993 | 3300028379 | Bacteria | 4885 |
| 397 | Ga0268266_10066429 | 3300028379 | Bacteria | 3119 |
| 398 | Ga0268266_10280050 | 3300028379 | Bacteria | 1550 |
| 399 | Ga0268266_10289764 | 3300028379 | Bacteria | 1524 |
| 400 | Ga0268265_10000595 | 3300028380 | Bacteria | 36375 |
| 401 | Ga0268265_10000930 | 3300028380 | Bacteria | 27042 |
| 402 | Ga0268265_10006261 | 3300028380 | Bacteria | 8061 |
| 403 | Ga0268265_10272645 | 3300028380 | Bacteria | 1510 |
| 404 | Ga0268264_10000004 | 3300028381 | Bacteria | 1116842 |
| 405 | Ga0268264_10000142 | 3300028381 | Bacteria | 170046 |
| 406 | Ga0268264_10022832 | 3300028381 | Bacteria | 5105 |
| 407 | Ga0268264_10025467 | 3300028381 | Bacteria | 4833 |
| 408 | Ga0268264_10177075 | 3300028381 | Bacteria | 1934 |
| 409 | Ga0268264_10189831 | 3300028381 | Bacteria | 1872 |
| 410 | Ga0268264_10196952 | 3300028381 | Bacteria | 1840 |
| 411 | Ga0265319_1008480 | 3300028563 | Bacteria | 4500 |
| 412 | Ga0265334_10000009 | 3300028573 | Bacteria | 194312 |
| 413 | Ga0265334_10008439 | 3300028573 | Bacteria | 4378 |
| 414 | Ga0265318_10004000 | 3300028577 | Bacteria | 7245 |
| 415 | Ga0307515_10028337 | 3300028794 | Bacteria | 9521 |
| 416 | Ga0307515_10196046 | 3300028794 | Bacteria | 1911 |
| 417 | Ga0265338_10008094 | 3300028800 | Bacteria | 12844 |
| 418 | Ga0265338_10016809 | 3300028800 | Bacteria | 7925 |
| 419 | Ga0307511_10001048 | 3300030521 | Bacteria | 29421 |
| 420 | Ga0307511_10013658 | 3300030521 | Bacteria | 7928 |
| 421 | Ga0265330_10011206 | 3300031235 | Bacteria | 4210 |
| 422 | Ga0265320_10005381 | 3300031240 | Bacteria | 8227 |
| 423 | Ga0265325_10004755 | 3300031241 | Bacteria | 8515 |
| 424 | Ga0265329_10002567 | 3300031242 | Bacteria | 8192 |
| 425 | Ga0265331_10005814 | 3300031250 | Bacteria | 7389 |
| 426 | Ga0265331_10014542 | 3300031250 | Bacteria | 4185 |
| 427 | Ga0265316_10067041 | 3300031344 | Bacteria | 2776 |
| 428 | Ga0307513_10023567 | 3300031456 | Bacteria | 7187 |
| 429 | Ga0307513_10058647 | 3300031456 | Bacteria | 4089 |
| 430 | Ga0307513_10063665 | 3300031456 | Bacteria | 3891 |
| 431 | Ga0307513_10224247 | 3300031456 | Bacteria | 1698 |
| 432 | Ga0307513_10247309 | 3300031456 | Bacteria | 1583 |
| 433 | Ga0307509_10000003 | 3300031507 | Bacteria | 577578 |
| 434 | Ga0307509_10000641 | 3300031507 | Bacteria | 59448 |
| 435 | Ga0307509_10009871 | 3300031507 | Bacteria | 11810 |
| 436 | Ga0307408_100000192 | 3300031548 | Bacteria | 65993 |
| 437 | Ga0307408_100002500 | 3300031548 | Bacteria | 12859 |
| 438 | Ga0265313_10000628 | 3300031595 | Bacteria | 36547 |
| 439 | Ga0316575_10021388 | 3300031665 | Bacteria | 2490 |
| 440 | Ga0316579_10010462 | 3300031691 | Bacteria | 3923 |
| 441 | Ga0265314_10008038 | 3300031711 | Bacteria | 9093 |
| 442 | Ga0265342_10022142 | 3300031712 | Bacteria | 4045 |
| 443 | Ga0316576_10049712 | 3300031727 | Bacteria | 3046 |
| 444 | Ga0316578_10033770 | 3300031728 | Bacteria | 2933 |
| 445 | Ga0316577_10005918 | 3300031733 | Bacteria | 6439 |
| 446 | Ga0307413_10005102 | 3300031824 | Bacteria | 5810 |
| 447 | Ga0307413_10015221 | 3300031824 | Bacteria | 3935 |
| 448 | Ga0307413_10062879 | 3300031824 | Bacteria | 2299 |
| 449 | Ga0307410_10015239 | 3300031852 | Bacteria | 4553 |
| 450 | Ga0307406_10133435 | 3300031901 | Bacteria | 1746 |
| 451 | Ga0307406_10193596 | 3300031901 | Bacteria | 1491 |
| 452 | Ga0307409_100003031 | 3300031995 | Bacteria | 8975 |
| 453 | Ga0307409_100012128 | 3300031995 | Bacteria | 5476 |
| 454 | Ga0307409_100022235 | 3300031995 | Bacteria | 4367 |
| 455 | Ga0307409_100116267 | 3300031995 | Bacteria | 2254 |
| 456 | Ga0307416_100038211 | 3300032002 | Bacteria | 3702 |
| 457 | Ga0307416_100222502 | 3300032002 | Bacteria | 1812 |
| 458 | Ga0307416_100330085 | 3300032002 | Bacteria | 1532 |
| 459 | Ga0307411_10018735 | 3300032005 | Bacteria | 3980 |
| 460 | Ga0307415_100061016 | 3300032126 | Bacteria | 2609 |
| 461 | Ga0316585_10016578 | 3300032137 | Bacteria | 2220 |
| 462 | Ga0316580_10000911 | 3300032139 | Bacteria | 7314 |
| 463 | Ga0316593_10002315 | 3300032168 | Bacteria | 4477 |
| 464 | Ga0316593_10015239 | 3300032168 | Bacteria | 2309 |
| 465 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 466 | Ga0307510_10074915 | 3300033180 | Bacteria | 3340 |
| 467 | Ga0316592_1005784 | 3300033524 | Bacteria | 2360 |
| 468 | Ga0316588_1010733 | 3300033528 | Bacteria | 1939 |
| 469 | Ga0316596_1000949 | 3300033541 | Bacteria | 5531 |
| 470 | Ga0316596_1018131 | 3300033541 | Bacteria | 1777 |
| 471 | Ga0316596_1020823 | 3300033541 | Bacteria | 1670 |
| 472 | Ga0373936_0012478 | 3300035113 | Bacteria | 3233 |
| 473 | Ga0373954_0007684 | 3300035118 | Bacteria | 4719 |
| 474 | Ga0373946_0025346 | 3300035171 | Bacteria | 2332 |
| 475 | Ga0373955_0020267 | 3300035172 | Bacteria | 3340 |
| 476 | Ga0316574_0024582 | 3300035398 | Bacteria | 3607 |
| 477 | Ga0373931_0049223 | 3300035691 | Bacteria | 2237 |
| 478 | Ga0373927_0000003 | 3300035695 | Bacteria | 480348 |
| 479 | Ga0373937_0038055 | 3300036401 | Bacteria | 4385 |
| 480 | Ga0373937_0281199 | 3300036401 | Bacteria | 1571 |
| 481 | Ga0316582_0010036 | 3300036647 | Bacteria | 5168 |
| 482 | Ga0316584_0032094 | 3300036712 | Bacteria | 3885 |
| 483 | Ga0373925_0038198 | 3300037068 | Bacteria | 3549 |
| 484 | Ga0395898_0004123 | 3300037466 | Bacteria | 15936 |
| 485 | Ga0395898_0240714 | 3300037466 | Bacteria | 1726 |
| 486 | Ga0400487_45262 | 3300039110 | Bacteria | 13997 |
| 487 | Ga0436365_0469301 | 3300039437 | Bacteria | 2474 |
| 488 | Ga0436365_0786183 | 3300039437 | Bacteria | 4674 |
| 489 | Ga0436365_1435536 | 3300039437 | Bacteria | 12906 |
| 490 | Ga0436360_0279954 | 3300039438 | Bacteria | 4447 |
| 491 | Ga0436360_0549786 | 3300039438 | Bacteria | 3410 |
| 492 | Ga0436360_0698059 | 3300039438 | Bacteria | 1853 |
| 493 | Ga0436361_0721987 | 3300039447 | Bacteria | 2246 |
| 494 | Ga0436363_0084971 | 3300039450 | Bacteria | 7369 |
| 495 | Ga0436363_0494892 | 3300039450 | Bacteria | 6096 |
| 496 | Ga0436363_1700653 | 3300039450 | Bacteria | 4275 |
| 497 | Ga0436362_1046982 | 3300039453 | Bacteria | 3115 |
| 498 | Ga0451795_1218549 | 3300041456 | Bacteria | 1516 |
| 499 | Ga0451807_2231092 | 3300041486 | Bacteria | 1597 |
| 500 | Ga0451833_0386923 | 3300041491 | Bacteria | 1818 |
| 501 | Ga0451849_0709537 | 3300041505 | Bacteria | 2317 |
| 502 | Ga0451853_3502465 | 3300041512 | Bacteria | 2730 |
| 503 | Ga0450891_001517 | 3300042129 | Bacteria | 2394 |
| 504 | Ga0466969_0005761 | 3300044656 | Bacteria | 6584 |
| 505 | Ga0466969_0013042 | 3300044656 | Bacteria | 4378 |
| 506 | Ga0466972_0044062 | 3300044658 | Bacteria | 2165 |
| 507 | Ga0466966_0000529 | 3300044684 | Bacteria | 24396 |
| 508 | Ga0466961_0001258 | 3300044693 | Bacteria | 15626 |
| 509 | Ga0466964_0000154 | 3300044706 | Bacteria | 18708 |
| 510 | Ga0466968_0060649 | 3300044735 | Bacteria | 1631 |
| 511 | Ga0466970_0001657 | 3300044765 | Bacteria | 10691 |
| 512 | Ga0466957_0003326 | 3300044842 | Bacteria | 8811 |
| 513 | Ga0466959_0003395 | 3300045049 | Bacteria | 10407 |
| 514 | Ga0466959_0005054 | 3300045049 | Bacteria | 8966 |
| 515 | Ga0451576_0115495 | 3300045051 | Bacteria | 2794 |
| 516 | Ga0495603_0136751 | 3300046455 | Bacteria | 1426 |
| 517 | Ga0495638_0001637 | 3300046460 | Bacteria | 19921 |
| 518 | Ga0495638_0061646 | 3300046460 | Bacteria | 2317 |
| 519 | Ga0495580_0083956 | 3300046472 | Bacteria | 2219 |
| 520 | Ga0495632_0025188 | 3300046519 | Bacteria | 3150 |
| 521 | Ga0495632_0039739 | 3300046519 | Bacteria | 2373 |
| 522 | Ga0495644_0014067 | 3300046523 | Bacteria | 3067 |
| 523 | Ga0495621_0001194 | 3300046539 | Bacteria | 6707 |
| 524 | Ga0495625_0002943 | 3300046660 | Bacteria | 17751 |
| 525 | Ga0495625_0162039 | 3300046660 | Bacteria | 1498 |
| 526 | Ga0495647_0023721 | 3300046681 | Bacteria | 2227 |
| 527 | Ga0495647_0052323 | 3300046681 | Bacteria | 1590 |
| 528 | Ga0495671_0017611 | 3300046692 | Bacteria | 3801 |
| 529 | Ga0495649_0041952 | 3300046694 | Bacteria | 2501 |
| 530 | Ga0495672_0043975 | 3300047320 | Bacteria | 2682 |
| 531 | Ga0495681_0007310 | 3300047470 | Bacteria | 7078 |
| 532 | Ga0495686_0110967 | 3300047472 | Bacteria | 1645 |
| 533 | Ga0496100_0091479 | 3300048903 | Bacteria | 2076 |
| 534 | Ga0496101_0029069 | 3300048904 | Bacteria | 3864 |
| 535 | Ga0496102_0076297 | 3300048905 | Bacteria | 3083 |
| 536 | Ga0496102_0360558 | 3300048905 | Bacteria | 1369 |
| 537 | Ga0496103_0108286 | 3300048906 | Bacteria | 1763 |
| 538 | Ga0496105_0045611 | 3300048908 | Bacteria | 3616 |
| 539 | Ga0496106_0056740 | 3300048909 | Bacteria | 2961 |
| 540 | Ga0496106_0085442 | 3300048909 | Bacteria | 2429 |
| 541 | Ga0496107_0008333 | 3300048910 | Bacteria | 7172 |
| 542 | Ga0496108_0034106 | 3300048911 | Bacteria | 4229 |
| 543 | Ga0496108_0076127 | 3300048911 | Bacteria | 2836 |
| 544 | Ga0496109_0023480 | 3300048912 | Bacteria | 5476 |
| 545 | Ga0496109_0248603 | 3300048912 | Bacteria | 1674 |
| 546 | Ga0496110_0002494 | 3300048913 | Bacteria | 13811 |
| 547 | Ga0496110_0130103 | 3300048913 | Bacteria | 2272 |
| 548 | Ga0496111_0009592 | 3300048914 | Bacteria | 6467 |
| 549 | Ga0496111_0091704 | 3300048914 | Bacteria | 2227 |
| 550 | Ga0496112_0088904 | 3300048915 | Bacteria | 3057 |
| 551 | Ga0496112_0144713 | 3300048915 | Bacteria | 2345 |
| 552 | Ga0496112_0154868 | 3300048915 | Bacteria | 2259 |
| 553 | Ga0496112_0298100 | 3300048915 | Bacteria | 1558 |
| 554 | Ga0496114_0017056 | 3300048917 | Bacteria | 5857 |
| 555 | Ga0496115_0149142 | 3300048918 | Bacteria | 1930 |
| 556 | Ga0496117_0000341 | 3300048920 | Bacteria | 82537 |
| 557 | Ga0496118_0000040 | 3300048921 | Bacteria | 304516 |
| 558 | Ga0496119_0014113 | 3300048922 | Bacteria | 6286 |
| 559 | Ga0496119_0017618 | 3300048922 | Bacteria | 5366 |
| 560 | Ga0496120_0000997 | 3300048923 | Bacteria | 38249 |
| 561 | Ga0496120_0023246 | 3300048923 | Bacteria | 3882 |
| 562 | Ga0496121_0000461 | 3300048924 | Bacteria | 79954 |
| 563 | Ga0496121_0030237 | 3300048924 | Bacteria | 4978 |
| 564 | Ga0496121_0059247 | 3300048924 | Bacteria | 3158 |
| 565 | Ga0496121_0089353 | 3300048924 | Bacteria | 2412 |
| 566 | Ga0496125_0007403 | 3300048928 | Bacteria | 11676 |
| 567 | Ga0496125_0013466 | 3300048928 | Bacteria | 8037 |
| 568 | Ga0496125_0086176 | 3300048928 | Bacteria | 2376 |
| 569 | Ga0496125_0185861 | 3300048928 | Bacteria | 1378 |
| 570 | Ga0496126_0004176 | 3300048929 | Bacteria | 17429 |
| 571 | Ga0496126_0040128 | 3300048929 | Bacteria | 4340 |
| 572 | Ga0501034_0069076 | 3300049571 | Bacteria | 3544 |
| 573 | Ga0501036_0018058 | 3300049572 | Bacteria | 5905 |
| 574 | Ga0501038_0002611 | 3300049574 | Bacteria | 16847 |
| 575 | Ga0501038_0193593 | 3300049574 | Bacteria | 1635 |
| 576 | Ga0501039_0027539 | 3300049575 | Bacteria | 4370 |
| 577 | Ga0501040_0001093 | 3300049576 | Bacteria | 17147 |
| 578 | Ga0501040_0035215 | 3300049576 | Bacteria | 3394 |
| 579 | Ga0501041_0020561 | 3300049577 | Bacteria | 3948 |
| 580 | Ga0501042_0023138 | 3300049578 | Bacteria | 4344 |
| 581 | Ga0501042_0033413 | 3300049578 | Bacteria | 3646 |
| 582 | Ga0501043_0055696 | 3300049579 | Bacteria | 3107 |
| 583 | Ga0501046_0009023 | 3300049580 | Bacteria | 8646 |
| 584 | Ga0501046_0128993 | 3300049580 | Bacteria | 1919 |
| 585 | Ga0501047_0088927 | 3300049581 | Bacteria | 2966 |
| 586 | Ga0501047_0262574 | 3300049581 | Bacteria | 1574 |
| 587 | Ga0501048_0014976 | 3300049582 | Bacteria | 5734 |
| 588 | Ga0501048_0021490 | 3300049582 | Bacteria | 4725 |
| 589 | Ga0501067_0082082 | 3300049583 | Bacteria | 1787 |
| 590 | Ga0501068_0000333 | 3300049584 | Bacteria | 23681 |
| 591 | Ga0501068_0026548 | 3300049584 | Bacteria | 3413 |
| 592 | Ga0501071_0005352 | 3300049587 | Bacteria | 8245 |
| 593 | Ga0501071_0034226 | 3300049587 | Bacteria | 3614 |
| 594 | Ga0501071_0058681 | 3300049587 | Bacteria | 2783 |
| 595 | Ga0501072_0057490 | 3300049588 | Bacteria | 3065 |
| 596 | Ga0501072_0114344 | 3300049588 | Bacteria | 2148 |
| 597 | Ga0501073_0000202 | 3300049589 | Bacteria | 39531 |
| 598 | Ga0501074_0001988 | 3300049590 | Bacteria | 14077 |
| 599 | Ga0501074_0020850 | 3300049590 | Bacteria | 4760 |
| 600 | Ga0501074_0068606 | 3300049590 | Bacteria | 2549 |
| 601 | Ga0501075_0035574 | 3300049591 | Bacteria | 3715 |
| 602 | Ga0501076_0002080 | 3300049592 | Bacteria | 13720 |
| 603 | Ga0501076_0026948 | 3300049592 | Bacteria | 4455 |
| 604 | Ga0501077_0004784 | 3300049593 | Bacteria | 8229 |
| 605 | Ga0501077_0028768 | 3300049593 | Bacteria | 3532 |
| 606 | Ga0501079_0000662 | 3300049741 | Bacteria | 23042 |
| 607 | Ga0501079_0041383 | 3300049741 | Bacteria | 3556 |
| 608 | Ga0501080_0003952 | 3300049742 | Bacteria | 13126 |
| 609 | Ga0501080_0008047 | 3300049742 | Bacteria | 9551 |
| 610 | Ga0501080_0312377 | 3300049742 | Bacteria | 1424 |
| 611 | Ga0501081_0003686 | 3300049743 | Bacteria | 9806 |
| 612 | Ga0501081_0074736 | 3300049743 | Bacteria | 2364 |
| 613 | Ga0501083_0047613 | 3300049744 | Bacteria | 2897 |
| 614 | Ga0501035_0021077 | 3300049822 | Bacteria | 5992 |
| 615 | Ga0501045_0000225 | 3300049824 | Bacteria | 32621 |
| 616 | Ga0501045_0069879 | 3300049824 | Bacteria | 2582 |
| 617 | nmdc:mga05p37_18996_c1 | 3300050507 | Bacteria | 8312 |
| 618 | nmdc:mga05p37_259472_c1 | 3300050507 | Bacteria | 2080 |
| 619 | nmdc:mga09592_26686_c1 | 3300050508 | Bacteria | 4786 |
| 620 | nmdc:mga0qj67_7656_c1 | 3300050509 | Bacteria | 7980 |
| 621 | nmdc:mga0qj67_85963_c1 | 3300050509 | Bacteria | 2523 |
| 622 | nmdc:mga06r32_21429_c1 | 3300050510 | Bacteria | 5966 |
| 623 | nmdc:mga06r32_2847_c1 | 3300050510 | Bacteria | 15521 |
| 624 | nmdc:mga08y16_15614_c1 | 3300050511 | Bacteria | 7986 |
| 625 | nmdc:mga08y16_3224_c1 | 3300050511 | Bacteria | 16894 |
| 626 | nmdc:mga08y16_41852_c1 | 3300050511 | Bacteria | 4798 |
| 627 | nmdc:mga08y16_56183_c1 | 3300050511 | Bacteria | 4114 |
| 628 | nmdc:mga08y16_77846_c1 | 3300050511 | Bacteria | 3457 |
| 629 | nmdc:mga08y16_94224_c1 | 3300050511 | Bacteria | 3119 |
| 630 | nmdc:mga08y16_94930_c1 | 3300050511 | Bacteria | 3107 |
| 631 | nmdc:mga0n895_259835_c1 | 3300050512 | Bacteria | 1762 |
| 632 | nmdc:mga0a205_144958_c1 | 3300050515 | Bacteria | 2275 |
| 633 | Ga0495601_0149162 | 3300053077 | Bacteria | 1526 |
| 634 | Ga0495612_0032606 | 3300053078 | Bacteria | 2106 |
| 635 | Ga0495619_0183072 | 3300053085 | Bacteria | 1449 |
| 636 | Ga0500583_0041758 | 3300053092 | Bacteria | 2085 |
| 637 | Ga0500651_0142652 | 3300053093 | Bacteria | 1443 |
| 638 | Ga0500641_0000635 | 3300053096 | Bacteria | 12697 |
| 639 | Ga0500650_0000072 | 3300053098 | Bacteria | 30017 |
| 640 | Ga0500556_0001074 | 3300053104 | Bacteria | 13838 |
| 641 | Ga0500617_028087 | 3300053124 | Bacteria | 2505 |
| 642 | Ga0500642_0023828 | 3300053130 | Bacteria | 2464 |
| 643 | Ga0500658_0044035 | 3300053134 | Bacteria | 1799 |
| 644 | Ga0500568_0008989 | 3300053139 | Bacteria | 4771 |
| 645 | Ga0500568_0035955 | 3300053139 | Bacteria | 2018 |
| 646 | Ga0500588_0011718 | 3300053146 | Bacteria | 2154 |
| 647 | Ga0500616_0000569 | 3300053153 | Bacteria | 45203 |
| 648 | Ga0500616_0045509 | 3300053153 | Bacteria | 2337 |
| 649 | Ga0500622_0001101 | 3300053156 | Bacteria | 22477 |
| 650 | Ga0500622_0008719 | 3300053156 | Bacteria | 5655 |
| 651 | Ga0500622_0010198 | 3300053156 | Bacteria | 5165 |
| 652 | Ga0500637_0001518 | 3300053178 | Bacteria | 9903 |
| 653 | Ga0500637_0024615 | 3300053178 | Bacteria | 3300 |
| 654 | Ga0501084_0004568 | 3300054114 | Bacteria | 11316 |
| 655 | Ga0501084_0007407 | 3300054114 | Bacteria | 9047 |
| 656 | Ga0501084_0029847 | 3300054114 | Bacteria | 4560 |
| 657 | Ga0501082_0051119 | 3300060353 | Bacteria | 3562 |
| 658 | Ga0466962_0001143 | 3300061719 | Bacteria | 12251 |
| 659 | Ga0530510_0033069 | 3300061734 | Bacteria | 3722 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0262574 | Ga0501047_0262574_570_1550 | 321 |
| 2 | 3300003323 | rootH1_10113855 | rootH1_101138551 | 358 |
| 3 | 3300005718 | Ga0068866_10076338 | Ga0068866_100763382 | 362 |
| 4 | 3300013296 | Ga0157374_10165244 | Ga0157374_101652442 | 362 |
| 5 | 3300025908 | Ga0207643_10012443 | Ga0207643_100124432 | 362 |
| 6 | 3300025923 | Ga0207681_10020824 | Ga0207681_100208242 | 362 |
| 7 | 3300025926 | Ga0207659_10067596 | Ga0207659_100675962 | 362 |
| 8 | 3300025940 | Ga0207691_10285172 | Ga0207691_102851721 | 362 |
| 9 | 3300026075 | Ga0207708_10081703 | Ga0207708_100817032 | 362 |
| 10 | 3300026089 | Ga0207648_10258276 | Ga0207648_102582762 | 362 |
| 11 | 3300026121 | Ga0207683_10333408 | Ga0207683_103334081 | 362 |
| 12 | 3300049587 | Ga0501071_0058681 | Ga0501071_0058681_864_1973 | 367 |
| 13 | 3300050515 | nmdc:mga0a205_144958_c1 | nmdc:mga0a205_144958_c1_463_1572 | 367 |
| 14 | 3300025915 | Ga0207693_10178695 | Ga0207693_101786951 | 368 |
| 15 | 3300002987 | JGI25159J45721_1005457 | JGI25159J45721_10054572 | 373 |
| 16 | 3300005262 | Ga0065165_1000005 | Ga0065165_100000551 | 373 |
| 17 | 3300025284 | Ga0209130_1000046 | Ga0209130_1000046101 | 373 |
| 18 | 3300031344 | Ga0265316_10067041 | Ga0265316_100670412 | 373 |
| 19 | 3300005331 | Ga0070670_100000026 | Ga0070670_100000026163 | 374 |
| 20 | 3300005335 | Ga0070666_10021429 | Ga0070666_100214291 | 374 |
| 21 | 3300005353 | Ga0070669_100008527 | Ga0070669_1000085272 | 374 |
| 22 | 3300005355 | Ga0070671_100010526 | Ga0070671_1000105263 | 374 |
| 23 | 3300005367 | Ga0070667_100000002 | Ga0070667_100000002311 | 374 |
| 24 | 3300005466 | Ga0070685_10000017 | Ga0070685_1000001770 | 374 |
| 25 | 3300005548 | Ga0070665_100026780 | Ga0070665_1000267802 | 374 |
| 26 | 3300005617 | Ga0068859_100019271 | Ga0068859_1000192712 | 374 |
| 27 | 3300005618 | Ga0068864_100000002 | Ga0068864_100000002163 | 374 |
| 28 | 3300005842 | Ga0068858_100084944 | Ga0068858_1000849442 | 374 |
| 29 | 3300005843 | Ga0068860_100036508 | Ga0068860_1000365082 | 374 |
| 30 | 3300005844 | Ga0068862_100017468 | Ga0068862_1000174682 | 374 |
| 31 | 3300006931 | Ga0097620_100019273 | Ga0097620_1000192732 | 374 |
| 32 | 3300009177 | Ga0105248_10479878 | Ga0105248_104798781 | 374 |
| 33 | 3300009553 | Ga0105249_10030234 | Ga0105249_100302342 | 374 |
| 34 | 3300014325 | Ga0163163_10000264 | Ga0163163_1000026446 | 374 |
| 35 | 3300025900 | Ga0207710_10005579 | Ga0207710_100055793 | 374 |
| 36 | 3300025903 | Ga0207680_10023718 | Ga0207680_100237182 | 374 |
| 37 | 3300025923 | Ga0207681_10002680 | Ga0207681_100026805 | 374 |
| 38 | 3300025925 | Ga0207650_10000002 | Ga0207650_10000002160 | 374 |
| 39 | 3300025931 | Ga0207644_10002895 | Ga0207644_100028957 | 374 |
| 40 | 3300025941 | Ga0207711_10000061 | Ga0207711_10000061111 | 374 |
| 41 | 3300025961 | Ga0207712_10020847 | Ga0207712_100208472 | 374 |
| 42 | 3300025986 | Ga0207658_10000001 | Ga0207658_100000011194 | 374 |
| 43 | 3300026035 | Ga0207703_10135430 | Ga0207703_101354302 | 374 |
| 44 | 3300026095 | Ga0207676_10000001 | Ga0207676_10000001160 | 374 |
| 45 | 3300028379 | Ga0268266_10026993 | Ga0268266_100269932 | 374 |
| 46 | 3300028380 | Ga0268265_10000930 | Ga0268265_100009307 | 374 |
| 47 | 3300028381 | Ga0268264_10000004 | Ga0268264_10000004150 | 374 |
| 48 | 3300049581 | Ga0501047_0088927 | Ga0501047_0088927_622_1752 | 374 |
| 49 | 3300053098 | Ga0500650_0000072 | Ga0500650_0000072_13739_14869 | 374 |
| 50 | 3300003323 | rootH1_10145992 | rootH1_101459922 | 375 |
| 51 | 3300006358 | Ga0068871_100281303 | Ga0068871_1002813031 | 375 |
| 52 | 3300026116 | Ga0207674_10134064 | Ga0207674_101340642 | 375 |
| 53 | 3300031665 | Ga0316575_10021388 | Ga0316575_100213882 | 375 |
| 54 | 3300039110 | Ga0400487_45262 | Ga0400487_45262_235_1374 | 375 |
| 55 | 3300042129 | Ga0450891_001517 | Ga0450891_001517_147_1355 | 375 |
| 56 | iso_pu_bacteria | 2738541276 | 2738716193 | 375 |
| 57 | 3300031548 | Ga0307408_100000192 | Ga0307408_1000001922 | 376 |
| 58 | 3300031548 | Ga0307408_100002500 | Ga0307408_1000025002 | 376 |
| 59 | 3300031901 | Ga0307406_10133435 | Ga0307406_101334351 | 376 |
| 60 | 3300032168 | Ga0316593_10002315 | Ga0316593_100023151 | 376 |
| 61 | 3300049571 | Ga0501034_0069076 | Ga0501034_0069076_151_1362 | 376 |
| 62 | 3300049822 | Ga0501035_0021077 | Ga0501035_0021077_4579_5715 | 376 |
| 63 | 3300032168 | Ga0316593_10015239 | Ga0316593_100152391 | 377 |
| 64 | 3300033541 | Ga0316596_1020823 | Ga0316596_10208232 | 378 |
| 65 | 3300003316 | rootH1_10023252 | rootH1_100232524 | 379 |
| 66 | 3300005617 | Ga0068859_100000874 | Ga0068859_10000087422 | 379 |
| 67 | 3300005841 | Ga0068863_100012364 | Ga0068863_1000123644 | 379 |
| 68 | 3300005842 | Ga0068858_100001638 | Ga0068858_10000163814 | 379 |
| 69 | 3300005843 | Ga0068860_100004745 | Ga0068860_1000047458 | 379 |
| 70 | 3300006931 | Ga0097620_100000873 | Ga0097620_10000087322 | 379 |
| 71 | 3300009093 | Ga0105240_10299647 | Ga0105240_102996472 | 379 |
| 72 | 3300009101 | Ga0105247_10000812 | Ga0105247_1000081213 | 379 |
| 73 | 3300009177 | Ga0105248_10022613 | Ga0105248_100226132 | 379 |
| 74 | 3300009177 | Ga0105248_10134845 | Ga0105248_101348452 | 379 |
| 75 | 3300009545 | Ga0105237_10222904 | Ga0105237_102229042 | 379 |
| 76 | 3300009553 | Ga0105249_10021727 | Ga0105249_100217274 | 379 |
| 77 | 3300009553 | Ga0105249_10130073 | Ga0105249_101300732 | 379 |
| 78 | 3300010375 | Ga0105239_10521620 | Ga0105239_105216201 | 379 |
| 79 | 3300013306 | Ga0163162_10063692 | Ga0163162_100636922 | 379 |
| 80 | 3300014968 | Ga0157379_10001382 | Ga0157379_1000138218 | 379 |
| 81 | 3300014968 | Ga0157379_10118190 | Ga0157379_101181901 | 379 |
| 82 | 3300025900 | Ga0207710_10000200 | Ga0207710_1000020024 | 379 |
| 83 | 3300025903 | Ga0207680_10021698 | Ga0207680_100216983 | 379 |
| 84 | 3300025931 | Ga0207644_10055538 | Ga0207644_100555382 | 379 |
| 85 | 3300025941 | Ga0207711_10024939 | Ga0207711_100249394 | 379 |
| 86 | 3300025961 | Ga0207712_10015524 | Ga0207712_100155244 | 379 |
| 87 | 3300025986 | Ga0207658_10010618 | Ga0207658_100106182 | 379 |
| 88 | 3300026035 | Ga0207703_10000919 | Ga0207703_1000091916 | 379 |
| 89 | 3300026088 | Ga0207641_10054966 | Ga0207641_100549663 | 379 |
| 90 | 3300028379 | Ga0268266_10066429 | Ga0268266_100664292 | 379 |
| 91 | 3300033541 | Ga0316596_1018131 | Ga0316596_10181312 | 379 |
| 92 | 3300035113 | Ga0373936_0012478 | Ga0373936_0012478_1114_2259 | 379 |
| 93 | 3300046519 | Ga0495632_0025188 | Ga0495632_0025188_526_1671 | 379 |
| 94 | 3300048920 | Ga0496117_0000341 | Ga0496117_0000341_79203_80348 | 379 |
| 95 | 3300048921 | Ga0496118_0000040 | Ga0496118_0000040_121090_122235 | 379 |
| 96 | 3300048922 | Ga0496119_0014113 | Ga0496119_0014113_2309_3454 | 379 |
| 97 | 3300048922 | Ga0496119_0017618 | Ga0496119_0017618_3946_5091 | 379 |
| 98 | 3300048923 | Ga0496120_0000997 | Ga0496120_0000997_7145_8290 | 379 |
| 99 | 3300048923 | Ga0496120_0023246 | Ga0496120_0023246_2457_3602 | 379 |
| 100 | 3300048924 | Ga0496121_0000461 | Ga0496121_0000461_2814_3959 | 379 |
| 101 | 3300048924 | Ga0496121_0030237 | Ga0496121_0030237_2136_3281 | 379 |
| 102 | 3300048924 | Ga0496121_0059247 | Ga0496121_0059247_1810_2955 | 379 |
| 103 | 3300048924 | Ga0496121_0089353 | Ga0496121_0089353_960_2105 | 379 |
| 104 | 3300048928 | Ga0496125_0007403 | Ga0496125_0007403_6810_7955 | 379 |
| 105 | 3300048928 | Ga0496125_0013466 | Ga0496125_0013466_6224_7369 | 379 |
| 106 | 3300048928 | Ga0496125_0086176 | Ga0496125_0086176_291_1436 | 379 |
| 107 | 3300048928 | Ga0496125_0185861 | Ga0496125_0185861_51_1196 | 379 |
| 108 | 3300048929 | Ga0496126_0040128 | Ga0496126_0040128_2645_3790 | 379 |
| 109 | 3300053178 | Ga0500637_0001518 | Ga0500637_0001518_191_1336 | 379 |
| 110 | 3300005330 | Ga0070690_100038508 | Ga0070690_1000385081 | 380 |
| 111 | 3300005334 | Ga0068869_100049289 | Ga0068869_1000492892 | 380 |
| 112 | 3300005335 | Ga0070666_10063371 | Ga0070666_100633712 | 380 |
| 113 | 3300005336 | Ga0070680_100124261 | Ga0070680_1001242612 | 380 |
| 114 | 3300005337 | Ga0070682_100016908 | Ga0070682_1000169082 | 380 |
| 115 | 3300005338 | Ga0068868_100003997 | Ga0068868_1000039976 | 380 |
| 116 | 3300005343 | Ga0070687_100111430 | Ga0070687_1001114302 | 380 |
| 117 | 3300005344 | Ga0070661_100102142 | Ga0070661_1001021421 | 380 |
| 118 | 3300005355 | Ga0070671_100008250 | Ga0070671_1000082504 | 380 |
| 119 | 3300005444 | Ga0070694_100099900 | Ga0070694_1000999001 | 380 |
| 120 | 3300005535 | Ga0070684_100179436 | Ga0070684_1001794362 | 380 |
| 121 | 3300005564 | Ga0070664_100004667 | Ga0070664_1000046675 | 380 |
| 122 | 3300005618 | Ga0068864_100005830 | Ga0068864_1000058303 | 380 |
| 123 | 3300005841 | Ga0068863_100006917 | Ga0068863_10000691711 | 380 |
| 124 | 3300005843 | Ga0068860_100019554 | Ga0068860_1000195545 | 380 |
| 125 | 3300006237 | Ga0097621_100009176 | Ga0097621_1000091765 | 380 |
| 126 | 3300006844 | Ga0075428_100003215 | Ga0075428_10000321512 | 380 |
| 127 | 3300006852 | Ga0075433_10133273 | Ga0075433_101332732 | 380 |
| 128 | 3300006880 | Ga0075429_100020882 | Ga0075429_1000208824 | 380 |
| 129 | 3300009094 | Ga0111539_10015226 | Ga0111539_100152268 | 380 |
| 130 | 3300009094 | Ga0111539_10617544 | Ga0111539_106175441 | 380 |
| 131 | 3300009098 | Ga0105245_10003531 | Ga0105245_100035318 | 380 |
| 132 | 3300009101 | Ga0105247_10023669 | Ga0105247_100236693 | 380 |
| 133 | 3300009148 | Ga0105243_10177901 | Ga0105243_101779012 | 380 |
| 134 | 3300009177 | Ga0105248_10010033 | Ga0105248_100100335 | 380 |
| 135 | 3300009551 | Ga0105238_10182229 | Ga0105238_101822292 | 380 |
| 136 | 3300010375 | Ga0105239_10090904 | Ga0105239_100909043 | 380 |
| 137 | 3300011119 | Ga0105246_10003632 | Ga0105246_100036328 | 380 |
| 138 | 3300013296 | Ga0157374_10002676 | Ga0157374_100026764 | 380 |
| 139 | 3300013297 | Ga0157378_10264533 | Ga0157378_102645331 | 380 |
| 140 | 3300013306 | Ga0163162_10041271 | Ga0163162_100412712 | 380 |
| 141 | 3300013308 | Ga0157375_10033274 | Ga0157375_100332742 | 380 |
| 142 | 3300014326 | Ga0157380_10024535 | Ga0157380_100245354 | 380 |
| 143 | 3300014745 | Ga0157377_10109972 | Ga0157377_101099722 | 380 |
| 144 | 3300025927 | Ga0207687_10138625 | Ga0207687_101386252 | 380 |
| 145 | 3300025937 | Ga0207669_10120589 | Ga0207669_101205892 | 380 |
| 146 | 3300025941 | Ga0207711_10007410 | Ga0207711_100074102 | 380 |
| 147 | 3300025942 | Ga0207689_10153252 | Ga0207689_101532522 | 380 |
| 148 | 3300026023 | Ga0207677_10106082 | Ga0207677_101060822 | 380 |
| 149 | 3300026035 | Ga0207703_10010064 | Ga0207703_100100647 | 380 |
| 150 | 3300026089 | Ga0207648_10091879 | Ga0207648_100918792 | 380 |
| 151 | 3300026116 | Ga0207674_10132419 | Ga0207674_101324192 | 380 |
| 152 | 3300028380 | Ga0268265_10272645 | Ga0268265_102726451 | 380 |
| 153 | 3300028381 | Ga0268264_10177075 | Ga0268264_101770752 | 380 |
| 154 | 3300031824 | Ga0307413_10062879 | Ga0307413_100628792 | 380 |
| 155 | 3300035172 | Ga0373955_0020267 | Ga0373955_0020267_750_1898 | 380 |
| 156 | 3300035691 | Ga0373931_0049223 | Ga0373931_0049223_832_1980 | 380 |
| 157 | 3300036401 | Ga0373937_0038055 | Ga0373937_0038055_1115_2263 | 380 |
| 158 | 3300048915 | Ga0496112_0144713 | Ga0496112_0144713_45_1193 | 380 |
| 159 | 3300049580 | Ga0501046_0128993 | Ga0501046_0128993_418_1566 | 380 |
| 160 | 3300049591 | Ga0501075_0035574 | Ga0501075_0035574_194_1342 | 380 |
| 161 | 3300050508 | nmdc:mga09592_26686_c1 | nmdc:mga09592_26686_c1_1851_2999 | 380 |
| 162 | 3300050511 | nmdc:mga08y16_41852_c1 | nmdc:mga08y16_41852_c1_1832_2980 | 380 |
| 163 | 3300050511 | nmdc:mga08y16_94224_c1 | nmdc:mga08y16_94224_c1_235_1383 | 380 |
| 164 | 3300053077 | Ga0495601_0149162 | Ga0495601_0149162_44_1195 | 380 |
| 165 | 3300053096 | Ga0500641_0000635 | Ga0500641_0000635_7767_8915 | 380 |
| 166 | 3300031691 | Ga0316579_10010462 | Ga0316579_100104622 | 381 |
| 167 | 3300031727 | Ga0316576_10049712 | Ga0316576_100497122 | 381 |
| 168 | 3300031728 | Ga0316578_10033770 | Ga0316578_100337702 | 381 |
| 169 | 3300031733 | Ga0316577_10005918 | Ga0316577_100059182 | 381 |
| 170 | 3300032137 | Ga0316585_10016578 | Ga0316585_100165783 | 381 |
| 171 | 3300032139 | Ga0316580_10000911 | Ga0316580_100009114 | 381 |
| 172 | 3300033524 | Ga0316592_1005784 | Ga0316592_10057842 | 381 |
| 173 | 3300033528 | Ga0316588_1010733 | Ga0316588_10107332 | 381 |
| 174 | 3300033541 | Ga0316596_1000949 | Ga0316596_10009493 | 381 |
| 175 | 3300035398 | Ga0316574_0024582 | Ga0316574_0024582_924_2075 | 381 |
| 176 | 3300036647 | Ga0316582_0010036 | Ga0316582_0010036_2323_3474 | 381 |
| 177 | 3300036712 | Ga0316584_0032094 | Ga0316584_0032094_912_2063 | 381 |
| 178 | 3300053178 | Ga0500637_0024615 | Ga0500637_0024615_2019_3173 | 382 |
| 179 | 3300035695 | Ga0373927_0000003 | Ga0373927_0000003_364077_365234 | 383 |
| 180 | 3300005335 | Ga0070666_10080748 | Ga0070666_100807482 | 384 |
| 181 | 3300005355 | Ga0070671_100005822 | Ga0070671_1000058224 | 384 |
| 182 | 3300005367 | Ga0070667_100000720 | Ga0070667_1000007207 | 384 |
| 183 | 3300005455 | Ga0070663_100093389 | Ga0070663_1000933892 | 384 |
| 184 | 3300005539 | Ga0068853_100093337 | Ga0068853_1000933372 | 384 |
| 185 | 3300005548 | Ga0070665_100114571 | Ga0070665_1001145712 | 384 |
| 186 | 3300005563 | Ga0068855_100172081 | Ga0068855_1001720811 | 384 |
| 187 | 3300005578 | Ga0068854_100056225 | Ga0068854_1000562253 | 384 |
| 188 | 3300005614 | Ga0068856_100121331 | Ga0068856_1001213312 | 384 |
| 189 | 3300005616 | Ga0068852_100171413 | Ga0068852_1001714132 | 384 |
| 190 | 3300005617 | Ga0068859_100026348 | Ga0068859_1000263483 | 384 |
| 191 | 3300005841 | Ga0068863_100020718 | Ga0068863_1000207185 | 384 |
| 192 | 3300005842 | Ga0068858_100004005 | Ga0068858_1000040058 | 384 |
| 193 | 3300005843 | Ga0068860_100035152 | Ga0068860_1000351524 | 384 |
| 194 | 3300005937 | Ga0081455_10215988 | Ga0081455_102159881 | 384 |
| 195 | 3300006931 | Ga0097620_100026348 | Ga0097620_1000263483 | 384 |
| 196 | 3300025904 | Ga0207647_10053465 | Ga0207647_100534652 | 384 |
| 197 | 3300025912 | Ga0207707_10007017 | Ga0207707_100070176 | 384 |
| 198 | 3300025913 | Ga0207695_10216300 | Ga0207695_102163002 | 384 |
| 199 | 3300025944 | Ga0207661_10042350 | Ga0207661_100423501 | 384 |
| 200 | 3300025981 | Ga0207640_10074899 | Ga0207640_100748992 | 384 |
| 201 | 3300026035 | Ga0207703_10001227 | Ga0207703_1000122713 | 384 |
| 202 | 3300026067 | Ga0207678_10023231 | Ga0207678_100232312 | 384 |
| 203 | 3300026088 | Ga0207641_10001010 | Ga0207641_100010104 | 384 |
| 204 | 3300028379 | Ga0268266_10003850 | Ga0268266_100038508 | 384 |
| 205 | 3300028379 | Ga0268266_10280050 | Ga0268266_102800501 | 384 |
| 206 | 3300028381 | Ga0268264_10000142 | Ga0268264_10000142136 | 384 |
| 207 | 3300028794 | Ga0307515_10028337 | Ga0307515_100283378 | 384 |
| 208 | 3300030521 | Ga0307511_10001048 | Ga0307511_1000104814 | 384 |
| 209 | 3300030521 | Ga0307511_10013658 | Ga0307511_100136585 | 384 |
| 210 | 3300031456 | Ga0307513_10063665 | Ga0307513_100636651 | 384 |
| 211 | 3300031507 | Ga0307509_10000003 | Ga0307509_10000003111 | 384 |
| 212 | 3300033180 | Ga0307510_10000001 | Ga0307510_10000001935 | 384 |
| 213 | 3300033180 | Ga0307510_10074915 | Ga0307510_100749152 | 384 |
| 214 | 3300044656 | Ga0466969_0005761 | Ga0466969_0005761_687_1850 | 384 |
| 215 | 3300044684 | Ga0466966_0000529 | Ga0466966_0000529_12285_13448 | 384 |
| 216 | 3300044693 | Ga0466961_0001258 | Ga0466961_0001258_5432_6595 | 384 |
| 217 | 3300044706 | Ga0466964_0000154 | Ga0466964_0000154_9090_10253 | 384 |
| 218 | 3300044765 | Ga0466970_0001657 | Ga0466970_0001657_2099_3262 | 384 |
| 219 | 3300044842 | Ga0466957_0003326 | Ga0466957_0003326_4139_5302 | 384 |
| 220 | 3300045049 | Ga0466959_0005054 | Ga0466959_0005054_7274_8437 | 384 |
| 221 | 3300053139 | Ga0500568_0008989 | Ga0500568_0008989_2860_4020 | 384 |
| 222 | 3300053153 | Ga0500616_0045509 | Ga0500616_0045509_903_2120 | 384 |
| 223 | 3300061719 | Ga0466962_0001143 | Ga0466962_0001143_8469_9632 | 384 |
| 224 | 3300005435 | Ga0070714_100195152 | Ga0070714_1001951522 | 385 |
| 225 | 3300025929 | Ga0207664_10000585 | Ga0207664_1000058513 | 385 |
| 226 | 3300025929 | Ga0207664_10171775 | Ga0207664_101717752 | 385 |
| 227 | 3300035118 | Ga0373954_0007684 | Ga0373954_0007684_3165_4328 | 385 |
| 228 | 3300039437 | Ga0436365_0469301 | Ga0436365_0469301_153_1319 | 385 |
| 229 | 3300039450 | Ga0436363_0084971 | Ga0436363_0084971_2396_3562 | 385 |
| 230 | 3300041456 | Ga0451795_1218549 | Ga0451795_1218549_101_1294 | 385 |
| 231 | 3300041486 | Ga0451807_2231092 | Ga0451807_2231092_198_1367 | 385 |
| 232 | 3300046455 | Ga0495603_0136751 | Ga0495603_0136751_26_1195 | 385 |
| 233 | 3300053092 | Ga0500583_0041758 | Ga0500583_0041758_242_1486 | 385 |
| 234 | 3300053093 | Ga0500651_0142652 | Ga0500651_0142652_167_1411 | 385 |
| 235 | 3300053124 | Ga0500617_028087 | Ga0500617_028087_1149_2393 | 385 |
| 236 | 3300053130 | Ga0500642_0023828 | Ga0500642_0023828_14_1258 | 385 |
| 237 | 3300053134 | Ga0500658_0044035 | Ga0500658_0044035_184_1428 | 385 |
| 238 | 3300005615 | Ga0070702_100178487 | Ga0070702_1001784871 | 386 |
| 239 | 3300006237 | Ga0097621_100034118 | Ga0097621_1000341182 | 386 |
| 240 | 3300006358 | Ga0068871_100063106 | Ga0068871_1000631062 | 386 |
| 241 | 3300013296 | Ga0157374_10062863 | Ga0157374_100628632 | 386 |
| 242 | 3300014969 | Ga0157376_10037640 | Ga0157376_100376403 | 386 |
| 243 | 3300014969 | Ga0157376_10047753 | Ga0157376_100477533 | 386 |
| 244 | 3300025906 | Ga0207699_10010612 | Ga0207699_100106124 | 386 |
| 245 | 3300028573 | Ga0265334_10000009 | Ga0265334_10000009108 | 386 |
| 246 | 3300031595 | Ga0265313_10000628 | Ga0265313_100006287 | 386 |
| 247 | 3300041491 | Ga0451833_0386923 | Ga0451833_0386923_600_1778 | 386 |
| 248 | 3300046472 | Ga0495580_0083956 | Ga0495580_0083956_230_1399 | 386 |
| 249 | 3300046523 | Ga0495644_0014067 | Ga0495644_0014067_1676_2854 | 386 |
| 250 | 3300046539 | Ga0495621_0001194 | Ga0495621_0001194_3854_5032 | 386 |
| 251 | 3300046681 | Ga0495647_0023721 | Ga0495647_0023721_967_2142 | 386 |
| 252 | 3300046692 | Ga0495671_0017611 | Ga0495671_0017611_499_1677 | 386 |
| 253 | 3300047470 | Ga0495681_0007310 | Ga0495681_0007310_661_1839 | 386 |
| 254 | 3300047472 | Ga0495686_0110967 | Ga0495686_0110967_300_1478 | 386 |
| 255 | 3300048905 | Ga0496102_0076297 | Ga0496102_0076297_296_1465 | 386 |
| 256 | 3300048913 | Ga0496110_0130103 | Ga0496110_0130103_926_2092 | 386 |
| 257 | 3300053153 | Ga0500616_0000569 | Ga0500616_0000569_34759_35970 | 386 |
| 258 | 3300005337 | Ga0070682_100085373 | Ga0070682_1000853732 | 387 |
| 259 | 3300005548 | Ga0070665_100003917 | Ga0070665_1000039172 | 387 |
| 260 | 3300005548 | Ga0070665_100084241 | Ga0070665_1000842412 | 387 |
| 261 | 3300005937 | Ga0081455_10000043 | Ga0081455_10000043124 | 387 |
| 262 | 3300005985 | Ga0081539_10000046 | Ga0081539_1000004683 | 387 |
| 263 | 3300009093 | Ga0105240_10010435 | Ga0105240_100104352 | 387 |
| 264 | 3300009093 | Ga0105240_10070901 | Ga0105240_100709014 | 387 |
| 265 | 3300009545 | Ga0105237_10250118 | Ga0105237_102501182 | 387 |
| 266 | 3300013105 | Ga0157369_10020260 | Ga0157369_100202602 | 387 |
| 267 | 3300013307 | Ga0157372_10172491 | Ga0157372_101724912 | 387 |
| 268 | 3300028379 | Ga0268266_10019683 | Ga0268266_100196832 | 387 |
| 269 | 3300028794 | Ga0307515_10196046 | Ga0307515_101960462 | 387 |
| 270 | 3300031507 | Ga0307509_10000641 | Ga0307509_1000064124 | 387 |
| 271 | 3300032002 | Ga0307416_100222502 | Ga0307416_1002225022 | 387 |
| 272 | 3300039438 | Ga0436360_0279954 | Ga0436360_0279954_1428_2600 | 387 |
| 273 | 3300039438 | Ga0436360_0698059 | Ga0436360_0698059_287_1459 | 387 |
| 274 | 3300039447 | Ga0436361_0721987 | Ga0436361_0721987_80_1252 | 387 |
| 275 | 3300048929 | Ga0496126_0004176 | Ga0496126_0004176_13820_14989 | 387 |
| 276 | 3300049574 | Ga0501038_0193593 | Ga0501038_0193593_187_1359 | 387 |
| 277 | 3300049575 | Ga0501039_0027539 | Ga0501039_0027539_977_2149 | 387 |
| 278 | 3300049576 | Ga0501040_0001093 | Ga0501040_0001093_15169_16341 | 387 |
| 279 | 3300049577 | Ga0501041_0020561 | Ga0501041_0020561_670_1842 | 387 |
| 280 | 3300049578 | Ga0501042_0023138 | Ga0501042_0023138_2515_3687 | 387 |
| 281 | 3300049582 | Ga0501048_0014976 | Ga0501048_0014976_794_1966 | 387 |
| 282 | 3300049588 | Ga0501072_0057490 | Ga0501072_0057490_98_1270 | 387 |
| 283 | 3300049590 | Ga0501074_0068606 | Ga0501074_0068606_663_1835 | 387 |
| 284 | 3300049592 | Ga0501076_0026948 | Ga0501076_0026948_950_2122 | 387 |
| 285 | 3300049741 | Ga0501079_0041383 | Ga0501079_0041383_901_2073 | 387 |
| 286 | 3300049742 | Ga0501080_0008047 | Ga0501080_0008047_292_1464 | 387 |
| 287 | 3300049743 | Ga0501081_0003686 | Ga0501081_0003686_6561_7733 | 387 |
| 288 | 3300049824 | Ga0501045_0069879 | Ga0501045_0069879_982_2154 | 387 |
| 289 | 3300053078 | Ga0495612_0032606 | Ga0495612_0032606_850_2022 | 387 |
| 290 | 3300054114 | Ga0501084_0029847 | Ga0501084_0029847_2222_3394 | 387 |
| 291 | 3300060353 | Ga0501082_0051119 | Ga0501082_0051119_1304_2476 | 387 |
| 292 | 3300005295 | Ga0065707_10083371 | Ga0065707_100833718 | 388 |
| 293 | 3300005340 | Ga0070689_100008129 | Ga0070689_1000081294 | 388 |
| 294 | 3300005345 | Ga0070692_10066758 | Ga0070692_100667581 | 388 |
| 295 | 3300005354 | Ga0070675_100021713 | Ga0070675_1000217135 | 388 |
| 296 | 3300005356 | Ga0070674_100241757 | Ga0070674_1002417571 | 388 |
| 297 | 3300005440 | Ga0070705_100027352 | Ga0070705_1000273522 | 388 |
| 298 | 3300005441 | Ga0070700_100011270 | Ga0070700_1000112704 | 388 |
| 299 | 3300005444 | Ga0070694_100245692 | Ga0070694_1002456921 | 388 |
| 300 | 3300005457 | Ga0070662_100091203 | Ga0070662_1000912032 | 388 |
| 301 | 3300005466 | Ga0070685_10024484 | Ga0070685_100244842 | 388 |
| 302 | 3300005543 | Ga0070672_100069104 | Ga0070672_1000691042 | 388 |
| 303 | 3300005543 | Ga0070672_100077217 | Ga0070672_1000772172 | 388 |
| 304 | 3300005548 | Ga0070665_100006479 | Ga0070665_1000064797 | 388 |
| 305 | 3300005563 | Ga0068855_100004233 | Ga0068855_1000042334 | 388 |
| 306 | 3300005564 | Ga0070664_100123586 | Ga0070664_1001235862 | 388 |
| 307 | 3300005614 | Ga0068856_100004637 | Ga0068856_1000046372 | 388 |
| 308 | 3300005615 | Ga0070702_100000859 | Ga0070702_10000085911 | 388 |
| 309 | 3300005617 | Ga0068859_100130588 | Ga0068859_1001305882 | 388 |
| 310 | 3300005719 | Ga0068861_100104874 | Ga0068861_1001048742 | 388 |
| 311 | 3300005840 | Ga0068870_10002121 | Ga0068870_100021211 | 388 |
| 312 | 3300005843 | Ga0068860_100105850 | Ga0068860_1001058503 | 388 |
| 313 | 3300005937 | Ga0081455_10041380 | Ga0081455_100413804 | 388 |
| 314 | 3300006237 | Ga0097621_100119956 | Ga0097621_1001199561 | 388 |
| 315 | 3300006881 | Ga0068865_100065293 | Ga0068865_1000652932 | 388 |
| 316 | 3300006931 | Ga0097620_100130574 | Ga0097620_1001305742 | 388 |
| 317 | 3300009092 | Ga0105250_10000023 | Ga0105250_1000002394 | 388 |
| 318 | 3300009093 | Ga0105240_10115396 | Ga0105240_101153962 | 388 |
| 319 | 3300009094 | Ga0111539_10180942 | Ga0111539_101809422 | 388 |
| 320 | 3300009551 | Ga0105238_10112485 | Ga0105238_101124852 | 388 |
| 321 | 3300013306 | Ga0163162_10139635 | Ga0163162_101396352 | 388 |
| 322 | 3300013308 | Ga0157375_10023229 | Ga0157375_100232292 | 388 |
| 323 | 3300013308 | Ga0157375_10058031 | Ga0157375_100580312 | 388 |
| 324 | 3300014325 | Ga0163163_10023635 | Ga0163163_100236355 | 388 |
| 325 | 3300014326 | Ga0157380_10010360 | Ga0157380_100103607 | 388 |
| 326 | 3300014968 | Ga0157379_10000613 | Ga0157379_1000061319 | 388 |
| 327 | 3300025711 | Ga0207696_1000098 | Ga0207696_100009865 | 388 |
| 328 | 3300025893 | Ga0207682_10075214 | Ga0207682_100752142 | 388 |
| 329 | 3300025908 | Ga0207643_10121589 | Ga0207643_101215892 | 388 |
| 330 | 3300025913 | Ga0207695_10170960 | Ga0207695_101709601 | 388 |
| 331 | 3300025920 | Ga0207649_10039433 | Ga0207649_100394333 | 388 |
| 332 | 3300025923 | Ga0207681_10020588 | Ga0207681_100205884 | 388 |
| 333 | 3300025925 | Ga0207650_10075060 | Ga0207650_100750601 | 388 |
| 334 | 3300025936 | Ga0207670_10015580 | Ga0207670_100155802 | 388 |
| 335 | 3300025938 | Ga0207704_10074205 | Ga0207704_100742052 | 388 |
| 336 | 3300025940 | Ga0207691_10029366 | Ga0207691_100293663 | 388 |
| 337 | 3300025942 | Ga0207689_10212450 | Ga0207689_102124502 | 388 |
| 338 | 3300025942 | Ga0207689_10225858 | Ga0207689_102258582 | 388 |
| 339 | 3300025945 | Ga0207679_10030141 | Ga0207679_100301413 | 388 |
| 340 | 3300025949 | Ga0207667_10001163 | Ga0207667_1000116321 | 388 |
| 341 | 3300026088 | Ga0207641_10147808 | Ga0207641_101478082 | 388 |
| 342 | 3300026118 | Ga0207675_100045106 | Ga0207675_1000451062 | 388 |
| 343 | 3300026118 | Ga0207675_100323301 | Ga0207675_1003233012 | 388 |
| 344 | 3300027907 | Ga0207428_10049106 | Ga0207428_100491061 | 388 |
| 345 | 3300028379 | Ga0268266_10007403 | Ga0268266_100074035 | 388 |
| 346 | 3300028381 | Ga0268264_10022832 | Ga0268264_100228322 | 388 |
| 347 | 3300031456 | Ga0307513_10023567 | Ga0307513_100235675 | 388 |
| 348 | 3300031456 | Ga0307513_10058647 | Ga0307513_100586472 | 388 |
| 349 | 3300031507 | Ga0307509_10009871 | Ga0307509_100098712 | 388 |
| 350 | 3300031824 | Ga0307413_10005102 | Ga0307413_100051023 | 388 |
| 351 | 3300031824 | Ga0307413_10015221 | Ga0307413_100152212 | 388 |
| 352 | 3300031852 | Ga0307410_10015239 | Ga0307410_100152392 | 388 |
| 353 | 3300031995 | Ga0307409_100003031 | Ga0307409_1000030317 | 388 |
| 354 | 3300031995 | Ga0307409_100012128 | Ga0307409_1000121282 | 388 |
| 355 | 3300031995 | Ga0307409_100022235 | Ga0307409_1000222352 | 388 |
| 356 | 3300032002 | Ga0307416_100038211 | Ga0307416_1000382112 | 388 |
| 357 | 3300032005 | Ga0307411_10018735 | Ga0307411_100187352 | 388 |
| 358 | 3300041505 | Ga0451849_0709537 | Ga0451849_0709537_677_1849 | 388 |
| 359 | 3300041512 | Ga0451853_3502465 | Ga0451853_3502465_726_1898 | 388 |
| 360 | 3300046460 | Ga0495638_0061646 | Ga0495638_0061646_219_1406 | 388 |
| 361 | 3300046519 | Ga0495632_0039739 | Ga0495632_0039739_41_1207 | 388 |
| 362 | 3300046660 | Ga0495625_0162039 | Ga0495625_0162039_90_1277 | 388 |
| 363 | 3300046694 | Ga0495649_0041952 | Ga0495649_0041952_457_1644 | 388 |
| 364 | 3300047320 | Ga0495672_0043975 | Ga0495672_0043975_138_1313 | 388 |
| 365 | 3300049583 | Ga0501067_0082082 | Ga0501067_0082082_312_1499 | 388 |
| 366 | 3300049584 | Ga0501068_0000333 | Ga0501068_0000333_16920_18107 | 388 |
| 367 | 3300049587 | Ga0501071_0034226 | Ga0501071_0034226_845_2032 | 388 |
| 368 | 3300049589 | Ga0501073_0000202 | Ga0501073_0000202_24903_26090 | 388 |
| 369 | 3300049590 | Ga0501074_0001988 | Ga0501074_0001988_12869_14056 | 388 |
| 370 | 3300049593 | Ga0501077_0004784 | Ga0501077_0004784_3734_4921 | 388 |
| 371 | 3300049741 | Ga0501079_0000662 | Ga0501079_0000662_9792_10979 | 388 |
| 372 | 3300049742 | Ga0501080_0003952 | Ga0501080_0003952_1730_2917 | 388 |
| 373 | 3300049742 | Ga0501080_0312377 | Ga0501080_0312377_37_1224 | 388 |
| 374 | 3300049744 | Ga0501083_0047613 | Ga0501083_0047613_982_2169 | 388 |
| 375 | 3300050511 | nmdc:mga08y16_56183_c1 | nmdc:mga08y16_56183_c1_2272_3459 | 388 |
| 376 | 3300050511 | nmdc:mga08y16_94930_c1 | nmdc:mga08y16_94930_c1_159_1334 | 388 |
| 377 | 3300053156 | Ga0500622_0008719 | Ga0500622_0008719_3814_4980 | 388 |
| 378 | 3300054114 | Ga0501084_0004568 | Ga0501084_0004568_310_1497 | 388 |
| 379 | 3300005295 | Ga0065707_10086319 | Ga0065707_100863193 | 389 |
| 380 | 3300005329 | Ga0070683_100132795 | Ga0070683_1001327952 | 389 |
| 381 | 3300005336 | Ga0070680_100064698 | Ga0070680_1000646982 | 389 |
| 382 | 3300005458 | Ga0070681_10014959 | Ga0070681_100149596 | 389 |
| 383 | 3300005530 | Ga0070679_100006742 | Ga0070679_1000067426 | 389 |
| 384 | 3300005530 | Ga0070679_100012588 | Ga0070679_1000125884 | 389 |
| 385 | 3300005530 | Ga0070679_100081686 | Ga0070679_1000816863 | 389 |
| 386 | 3300005530 | Ga0070679_100189949 | Ga0070679_1001899492 | 389 |
| 387 | 3300005563 | Ga0068855_100002113 | Ga0068855_10000211316 | 389 |
| 388 | 3300005563 | Ga0068855_100008348 | Ga0068855_1000083489 | 389 |
| 389 | 3300006844 | Ga0075428_100009769 | Ga0075428_1000097694 | 389 |
| 390 | 3300006846 | Ga0075430_100088134 | Ga0075430_1000881342 | 389 |
| 391 | 3300006847 | Ga0075431_100001747 | Ga0075431_10000174714 | 389 |
| 392 | 3300009093 | Ga0105240_10022715 | Ga0105240_100227153 | 389 |
| 393 | 3300009094 | Ga0111539_10036722 | Ga0111539_100367224 | 389 |
| 394 | 3300009545 | Ga0105237_10072969 | Ga0105237_100729692 | 389 |
| 395 | 3300009551 | Ga0105238_10012704 | Ga0105238_100127042 | 389 |
| 396 | 3300009551 | Ga0105238_10199339 | Ga0105238_101993391 | 389 |
| 397 | 3300009553 | Ga0105249_10151161 | Ga0105249_101511611 | 389 |
| 398 | 3300013104 | Ga0157370_10358494 | Ga0157370_103584941 | 389 |
| 399 | 3300013105 | Ga0157369_10091026 | Ga0157369_100910262 | 389 |
| 400 | 3300014326 | Ga0157380_10019037 | Ga0157380_100190372 | 389 |
| 401 | 3300025912 | Ga0207707_10000045 | Ga0207707_1000004520 | 389 |
| 402 | 3300025913 | Ga0207695_10047075 | Ga0207695_100470751 | 389 |
| 403 | 3300025913 | Ga0207695_10052514 | Ga0207695_100525141 | 389 |
| 404 | 3300025914 | Ga0207671_10017617 | Ga0207671_100176171 | 389 |
| 405 | 3300025917 | Ga0207660_10000958 | Ga0207660_100009586 | 389 |
| 406 | 3300025921 | Ga0207652_10010022 | Ga0207652_100100226 | 389 |
| 407 | 3300025921 | Ga0207652_10010582 | Ga0207652_100105822 | 389 |
| 408 | 3300025921 | Ga0207652_10036915 | Ga0207652_100369153 | 389 |
| 409 | 3300025921 | Ga0207652_10209774 | Ga0207652_102097742 | 389 |
| 410 | 3300025949 | Ga0207667_10000887 | Ga0207667_100008877 | 389 |
| 411 | 3300025949 | Ga0207667_10010839 | Ga0207667_100108398 | 389 |
| 412 | 3300027907 | Ga0207428_10031138 | Ga0207428_100311382 | 389 |
| 413 | 3300028800 | Ga0265338_10016809 | Ga0265338_100168093 | 389 |
| 414 | 3300031250 | Ga0265331_10014542 | Ga0265331_100145422 | 389 |
| 415 | 3300031995 | Ga0307409_100116267 | Ga0307409_1001162672 | 389 |
| 416 | 3300044656 | Ga0466969_0013042 | Ga0466969_0013042_2772_3947 | 389 |
| 417 | 3300045049 | Ga0466959_0003395 | Ga0466959_0003395_4301_5476 | 389 |
| 418 | 3300046460 | Ga0495638_0001637 | Ga0495638_0001637_6323_7501 | 389 |
| 419 | 3300046660 | Ga0495625_0002943 | Ga0495625_0002943_9730_10908 | 389 |
| 420 | 3300050509 | nmdc:mga0qj67_85963_c1 | nmdc:mga0qj67_85963_c1_579_1760 | 389 |
| 421 | 3300050510 | nmdc:mga06r32_2847_c1 | nmdc:mga06r32_2847_c1_2432_3610 | 389 |
| 422 | 3300050511 | nmdc:mga08y16_3224_c1 | nmdc:mga08y16_3224_c1_13230_14408 | 389 |
| 423 | 3300005290 | Ga0065712_10123532 | Ga0065712_101235322 | 390 |
| 424 | 3300005330 | Ga0070690_100008754 | Ga0070690_1000087542 | 390 |
| 425 | 3300005331 | Ga0070670_100052826 | Ga0070670_1000528263 | 390 |
| 426 | 3300005334 | Ga0068869_100001531 | Ga0068869_10000153114 | 390 |
| 427 | 3300005335 | Ga0070666_10097785 | Ga0070666_100977852 | 390 |
| 428 | 3300005340 | Ga0070689_100000263 | Ga0070689_1000002632 | 390 |
| 429 | 3300005344 | Ga0070661_100090912 | Ga0070661_1000909122 | 390 |
| 430 | 3300005347 | Ga0070668_100004213 | Ga0070668_1000042137 | 390 |
| 431 | 3300005354 | Ga0070675_100001875 | Ga0070675_1000018752 | 390 |
| 432 | 3300005364 | Ga0070673_100135847 | Ga0070673_1001358472 | 390 |
| 433 | 3300005367 | Ga0070667_100072368 | Ga0070667_1000723682 | 390 |
| 434 | 3300005441 | Ga0070700_100080301 | Ga0070700_1000803012 | 390 |
| 435 | 3300005456 | Ga0070678_100070124 | Ga0070678_1000701242 | 390 |
| 436 | 3300005457 | Ga0070662_100042633 | Ga0070662_1000426333 | 390 |
| 437 | 3300005459 | Ga0068867_100017933 | Ga0068867_1000179332 | 390 |
| 438 | 3300005466 | Ga0070685_10009087 | Ga0070685_100090872 | 390 |
| 439 | 3300005543 | Ga0070672_100083583 | Ga0070672_1000835832 | 390 |
| 440 | 3300005544 | Ga0070686_100010277 | Ga0070686_1000102772 | 390 |
| 441 | 3300005564 | Ga0070664_100014593 | Ga0070664_1000145934 | 390 |
| 442 | 3300005577 | Ga0068857_100055415 | Ga0068857_1000554152 | 390 |
| 443 | 3300005615 | Ga0070702_100017081 | Ga0070702_1000170813 | 390 |
| 444 | 3300005618 | Ga0068864_100018543 | Ga0068864_1000185432 | 390 |
| 445 | 3300005718 | Ga0068866_10033150 | Ga0068866_100331502 | 390 |
| 446 | 3300005719 | Ga0068861_100014180 | Ga0068861_1000141804 | 390 |
| 447 | 3300005719 | Ga0068861_100015877 | Ga0068861_1000158772 | 390 |
| 448 | 3300005841 | Ga0068863_100013946 | Ga0068863_1000139462 | 390 |
| 449 | 3300005842 | Ga0068858_100013113 | Ga0068858_1000131136 | 390 |
| 450 | 3300005843 | Ga0068860_100202558 | Ga0068860_1002025582 | 390 |
| 451 | 3300005844 | Ga0068862_100011434 | Ga0068862_1000114344 | 390 |
| 452 | 3300006237 | Ga0097621_100102463 | Ga0097621_1001024632 | 390 |
| 453 | 3300006358 | Ga0068871_100127377 | Ga0068871_1001273772 | 390 |
| 454 | 3300006844 | Ga0075428_100058436 | Ga0075428_1000584363 | 390 |
| 455 | 3300006846 | Ga0075430_100005652 | Ga0075430_1000056527 | 390 |
| 456 | 3300006847 | Ga0075431_100009224 | Ga0075431_1000092244 | 390 |
| 457 | 3300006880 | Ga0075429_100010602 | Ga0075429_1000106022 | 390 |
| 458 | 3300009177 | Ga0105248_10122635 | Ga0105248_101226352 | 390 |
| 459 | 3300009553 | Ga0105249_10048911 | Ga0105249_100489112 | 390 |
| 460 | 3300010375 | Ga0105239_10275151 | Ga0105239_102751512 | 390 |
| 461 | 3300013306 | Ga0163162_10042631 | Ga0163162_100426312 | 390 |
| 462 | 3300013308 | Ga0157375_10063704 | Ga0157375_100637043 | 390 |
| 463 | 3300014325 | Ga0163163_10188056 | Ga0163163_101880562 | 390 |
| 464 | 3300014968 | Ga0157379_10113967 | Ga0157379_101139673 | 390 |
| 465 | 3300025899 | Ga0207642_10073020 | Ga0207642_100730202 | 390 |
| 466 | 3300025901 | Ga0207688_10032245 | Ga0207688_100322452 | 390 |
| 467 | 3300025903 | Ga0207680_10005217 | Ga0207680_100052172 | 390 |
| 468 | 3300025917 | Ga0207660_10072962 | Ga0207660_100729622 | 390 |
| 469 | 3300025917 | Ga0207660_10145694 | Ga0207660_101456942 | 390 |
| 470 | 3300025918 | Ga0207662_10022281 | Ga0207662_100222812 | 390 |
| 471 | 3300025920 | Ga0207649_10078078 | Ga0207649_100780782 | 390 |
| 472 | 3300025923 | Ga0207681_10008163 | Ga0207681_100081634 | 390 |
| 473 | 3300025925 | Ga0207650_10048847 | Ga0207650_100488472 | 390 |
| 474 | 3300025926 | Ga0207659_10003977 | Ga0207659_100039776 | 390 |
| 475 | 3300025933 | Ga0207706_10043252 | Ga0207706_100432522 | 390 |
| 476 | 3300025940 | Ga0207691_10015457 | Ga0207691_100154577 | 390 |
| 477 | 3300025941 | Ga0207711_10013097 | Ga0207711_100130973 | 390 |
| 478 | 3300025942 | Ga0207689_10005143 | Ga0207689_100051437 | 390 |
| 479 | 3300025945 | Ga0207679_10001408 | Ga0207679_100014087 | 390 |
| 480 | 3300025960 | Ga0207651_10005853 | Ga0207651_100058532 | 390 |
| 481 | 3300025961 | Ga0207712_10029484 | Ga0207712_100294842 | 390 |
| 482 | 3300026023 | Ga0207677_10020565 | Ga0207677_100205654 | 390 |
| 483 | 3300026035 | Ga0207703_10017376 | Ga0207703_100173764 | 390 |
| 484 | 3300026075 | Ga0207708_10058644 | Ga0207708_100586442 | 390 |
| 485 | 3300026088 | Ga0207641_10076110 | Ga0207641_100761102 | 390 |
| 486 | 3300026089 | Ga0207648_10024776 | Ga0207648_100247764 | 390 |
| 487 | 3300026095 | Ga0207676_10001992 | Ga0207676_100019929 | 390 |
| 488 | 3300026116 | Ga0207674_10055041 | Ga0207674_100550412 | 390 |
| 489 | 3300026118 | Ga0207675_100040897 | Ga0207675_1000408972 | 390 |
| 490 | 3300026118 | Ga0207675_100056867 | Ga0207675_1000568672 | 390 |
| 491 | 3300026121 | Ga0207683_10016715 | Ga0207683_100167154 | 390 |
| 492 | 3300027907 | Ga0207428_10107016 | Ga0207428_101070162 | 390 |
| 493 | 3300028380 | Ga0268265_10000595 | Ga0268265_1000059518 | 390 |
| 494 | 3300028380 | Ga0268265_10006261 | Ga0268265_100062612 | 390 |
| 495 | 3300028381 | Ga0268264_10025467 | Ga0268264_100254674 | 390 |
| 496 | 3300028563 | Ga0265319_1008480 | Ga0265319_10084802 | 390 |
| 497 | 3300028573 | Ga0265334_10008439 | Ga0265334_100084393 | 390 |
| 498 | 3300028577 | Ga0265318_10004000 | Ga0265318_100040004 | 390 |
| 499 | 3300028800 | Ga0265338_10008094 | Ga0265338_100080949 | 390 |
| 500 | 3300031235 | Ga0265330_10011206 | Ga0265330_100112062 | 390 |
| 501 | 3300031240 | Ga0265320_10005381 | Ga0265320_100053817 | 390 |
| 502 | 3300031241 | Ga0265325_10004755 | Ga0265325_100047551 | 390 |
| 503 | 3300031242 | Ga0265329_10002567 | Ga0265329_100025674 | 390 |
| 504 | 3300031250 | Ga0265331_10005814 | Ga0265331_100058144 | 390 |
| 505 | 3300031456 | Ga0307513_10247309 | Ga0307513_102473091 | 390 |
| 506 | 3300031711 | Ga0265314_10008038 | Ga0265314_100080382 | 390 |
| 507 | 3300031712 | Ga0265342_10022142 | Ga0265342_100221422 | 390 |
| 508 | 3300031901 | Ga0307406_10193596 | Ga0307406_101935961 | 390 |
| 509 | 3300032002 | Ga0307416_100330085 | Ga0307416_1003300852 | 390 |
| 510 | 3300032126 | Ga0307415_100061016 | Ga0307415_1000610163 | 390 |
| 511 | 3300045051 | Ga0451576_0115495 | Ga0451576_0115495_904_2088 | 390 |
| 512 | 3300048909 | Ga0496106_0056740 | Ga0496106_0056740_12_1196 | 390 |
| 513 | 3300048911 | Ga0496108_0034106 | Ga0496108_0034106_2777_3961 | 390 |
| 514 | 3300048914 | Ga0496111_0091704 | Ga0496111_0091704_32_1216 | 390 |
| 515 | 3300048915 | Ga0496112_0154868 | Ga0496112_0154868_510_1694 | 390 |
| 516 | 3300050507 | nmdc:mga05p37_18996_c1 | nmdc:mga05p37_18996_c1_135_1316 | 390 |
| 517 | 3300050507 | nmdc:mga05p37_259472_c1 | nmdc:mga05p37_259472_c1_566_1750 | 390 |
| 518 | 3300050509 | nmdc:mga0qj67_7656_c1 | nmdc:mga0qj67_7656_c1_2657_3841 | 390 |
| 519 | 3300050510 | nmdc:mga06r32_21429_c1 | nmdc:mga06r32_21429_c1_3267_4451 | 390 |
| 520 | 3300050511 | nmdc:mga08y16_15614_c1 | nmdc:mga08y16_15614_c1_4540_5724 | 390 |
| 521 | 3300050511 | nmdc:mga08y16_77846_c1 | nmdc:mga08y16_77846_c1_58_1239 | 390 |
| 522 | 3300050512 | nmdc:mga0n895_259835_c1 | nmdc:mga0n895_259835_c1_243_1427 | 390 |
| 523 | 3300053139 | Ga0500568_0035955 | Ga0500568_0035955_576_1781 | 390 |
| 524 | 3300053146 | Ga0500588_0011718 | Ga0500588_0011718_761_1960 | 390 |
| 525 | 3300053156 | Ga0500622_0001101 | Ga0500622_0001101_12385_13590 | 390 |
| 526 | 3300053156 | Ga0500622_0010198 | Ga0500622_0010198_2228_3433 | 390 |
| 527 | 3300005330 | Ga0070690_100006774 | Ga0070690_1000067742 | 391 |
| 528 | 3300005330 | Ga0070690_100069449 | Ga0070690_1000694492 | 391 |
| 529 | 3300005335 | Ga0070666_10004984 | Ga0070666_100049844 | 391 |
| 530 | 3300005335 | Ga0070666_10013909 | Ga0070666_100139094 | 391 |
| 531 | 3300005338 | Ga0068868_100021382 | Ga0068868_1000213823 | 391 |
| 532 | 3300005355 | Ga0070671_100001253 | Ga0070671_10000125321 | 391 |
| 533 | 3300005355 | Ga0070671_100010104 | Ga0070671_1000101044 | 391 |
| 534 | 3300005367 | Ga0070667_100003642 | Ga0070667_1000036424 | 391 |
| 535 | 3300005436 | Ga0070713_100004316 | Ga0070713_1000043164 | 391 |
| 536 | 3300005437 | Ga0070710_10003683 | Ga0070710_100036834 | 391 |
| 537 | 3300005548 | Ga0070665_100005912 | Ga0070665_1000059123 | 391 |
| 538 | 3300005614 | Ga0068856_100039178 | Ga0068856_1000391782 | 391 |
| 539 | 3300005617 | Ga0068859_100230198 | Ga0068859_1002301981 | 391 |
| 540 | 3300005618 | Ga0068864_100061846 | Ga0068864_1000618462 | 391 |
| 541 | 3300005841 | Ga0068863_100007301 | Ga0068863_1000073016 | 391 |
| 542 | 3300005841 | Ga0068863_100130265 | Ga0068863_1001302652 | 391 |
| 543 | 3300005842 | Ga0068858_100017248 | Ga0068858_1000172482 | 391 |
| 544 | 3300005842 | Ga0068858_100031011 | Ga0068858_1000310113 | 391 |
| 545 | 3300005843 | Ga0068860_100017392 | Ga0068860_1000173923 | 391 |
| 546 | 3300005843 | Ga0068860_100040591 | Ga0068860_1000405911 | 391 |
| 547 | 3300006175 | Ga0070712_100002659 | Ga0070712_1000026596 | 391 |
| 548 | 3300006237 | Ga0097621_100029908 | Ga0097621_1000299083 | 391 |
| 549 | 3300006237 | Ga0097621_100221094 | Ga0097621_1002210942 | 391 |
| 550 | 3300006358 | Ga0068871_100137679 | Ga0068871_1001376792 | 391 |
| 551 | 3300006881 | Ga0068865_100011078 | Ga0068865_1000110784 | 391 |
| 552 | 3300006931 | Ga0097620_100230199 | Ga0097620_1002301993 | 391 |
| 553 | 3300009098 | Ga0105245_10003428 | Ga0105245_1000342813 | 391 |
| 554 | 3300009098 | Ga0105245_10024207 | Ga0105245_100242073 | 391 |
| 555 | 3300009176 | Ga0105242_10024499 | Ga0105242_100244994 | 391 |
| 556 | 3300009177 | Ga0105248_10001274 | Ga0105248_1000127415 | 391 |
| 557 | 3300009177 | Ga0105248_10048843 | Ga0105248_100488433 | 391 |
| 558 | 3300010375 | Ga0105239_10045649 | Ga0105239_100456492 | 391 |
| 559 | 3300013296 | Ga0157374_10022975 | Ga0157374_100229753 | 391 |
| 560 | 3300013297 | Ga0157378_10004389 | Ga0157378_100043896 | 391 |
| 561 | 3300013306 | Ga0163162_10028719 | Ga0163162_100287192 | 391 |
| 562 | 3300013306 | Ga0163162_10198055 | Ga0163162_101980552 | 391 |
| 563 | 3300013308 | Ga0157375_10006198 | Ga0157375_100061989 | 391 |
| 564 | 3300013308 | Ga0157375_10129546 | Ga0157375_101295462 | 391 |
| 565 | 3300014325 | Ga0163163_10062810 | Ga0163163_100628102 | 391 |
| 566 | 3300014968 | Ga0157379_10001842 | Ga0157379_1000184213 | 391 |
| 567 | 3300014968 | Ga0157379_10047538 | Ga0157379_100475383 | 391 |
| 568 | 3300025898 | Ga0207692_10019072 | Ga0207692_100190722 | 391 |
| 569 | 3300025903 | Ga0207680_10068797 | Ga0207680_100687972 | 391 |
| 570 | 3300025915 | Ga0207693_10017711 | Ga0207693_100177114 | 391 |
| 571 | 3300025916 | Ga0207663_10106937 | Ga0207663_101069371 | 391 |
| 572 | 3300025927 | Ga0207687_10084153 | Ga0207687_100841532 | 391 |
| 573 | 3300025928 | Ga0207700_10041661 | Ga0207700_100416612 | 391 |
| 574 | 3300025931 | Ga0207644_10069460 | Ga0207644_100694601 | 391 |
| 575 | 3300025934 | Ga0207686_10148430 | Ga0207686_101484302 | 391 |
| 576 | 3300025938 | Ga0207704_10010821 | Ga0207704_100108214 | 391 |
| 577 | 3300025939 | Ga0207665_10025451 | Ga0207665_100254514 | 391 |
| 578 | 3300025941 | Ga0207711_10052359 | Ga0207711_100523592 | 391 |
| 579 | 3300025941 | Ga0207711_10158717 | Ga0207711_101587172 | 391 |
| 580 | 3300025986 | Ga0207658_10019133 | Ga0207658_100191332 | 391 |
| 581 | 3300026023 | Ga0207677_10076897 | Ga0207677_100768973 | 391 |
| 582 | 3300026035 | Ga0207703_10073501 | Ga0207703_100735012 | 391 |
| 583 | 3300026035 | Ga0207703_10117747 | Ga0207703_101177472 | 391 |
| 584 | 3300026078 | Ga0207702_10145648 | Ga0207702_101456482 | 391 |
| 585 | 3300026088 | Ga0207641_10111078 | Ga0207641_101110781 | 391 |
| 586 | 3300028379 | Ga0268266_10289764 | Ga0268266_102897642 | 391 |
| 587 | 3300028381 | Ga0268264_10189831 | Ga0268264_101898312 | 391 |
| 588 | 3300028381 | Ga0268264_10196952 | Ga0268264_101969522 | 391 |
| 589 | 3300031456 | Ga0307513_10224247 | Ga0307513_102242472 | 391 |
| 590 | 3300035171 | Ga0373946_0025346 | Ga0373946_0025346_678_1862 | 391 |
| 591 | 3300036401 | Ga0373937_0281199 | Ga0373937_0281199_14_1198 | 391 |
| 592 | 3300037068 | Ga0373925_0038198 | Ga0373925_0038198_368_1552 | 391 |
| 593 | 3300039437 | Ga0436365_0786183 | Ga0436365_0786183_2907_4091 | 391 |
| 594 | 3300039438 | Ga0436360_0549786 | Ga0436360_0549786_1634_2845 | 391 |
| 595 | 3300039453 | Ga0436362_1046982 | Ga0436362_1046982_496_1680 | 391 |
| 596 | 3300046681 | Ga0495647_0052323 | Ga0495647_0052323_136_1320 | 391 |
| 597 | 3300048903 | Ga0496100_0091479 | Ga0496100_0091479_786_1970 | 391 |
| 598 | 3300048904 | Ga0496101_0029069 | Ga0496101_0029069_916_2100 | 391 |
| 599 | 3300048906 | Ga0496103_0108286 | Ga0496103_0108286_457_1641 | 391 |
| 600 | 3300048908 | Ga0496105_0045611 | Ga0496105_0045611_936_2120 | 391 |
| 601 | 3300048909 | Ga0496106_0085442 | Ga0496106_0085442_32_1216 | 391 |
| 602 | 3300048910 | Ga0496107_0008333 | Ga0496107_0008333_819_2003 | 391 |
| 603 | 3300048911 | Ga0496108_0076127 | Ga0496108_0076127_1539_2723 | 391 |
| 604 | 3300048912 | Ga0496109_0023480 | Ga0496109_0023480_3702_4886 | 391 |
| 605 | 3300048912 | Ga0496109_0248603 | Ga0496109_0248603_354_1535 | 391 |
| 606 | 3300048913 | Ga0496110_0002494 | Ga0496110_0002494_8604_9788 | 391 |
| 607 | 3300048914 | Ga0496111_0009592 | Ga0496111_0009592_495_1679 | 391 |
| 608 | 3300048915 | Ga0496112_0088904 | Ga0496112_0088904_1784_2968 | 391 |
| 609 | 3300048917 | Ga0496114_0017056 | Ga0496114_0017056_182_1366 | 391 |
| 610 | 3300048918 | Ga0496115_0149142 | Ga0496115_0149142_729_1913 | 391 |
| 611 | 3300053085 | Ga0495619_0183072 | Ga0495619_0183072_203_1387 | 391 |
| 612 | 2162886006 | SwRhRL3b_contig_933874 | SwRhRL3b_0100.00000040 | 392 |
| 613 | 3300005295 | Ga0065707_10084245 | Ga0065707_100842454 | 392 |
| 614 | 3300005336 | Ga0070680_100092700 | Ga0070680_1000927002 | 392 |
| 615 | 3300005434 | Ga0070709_10010657 | Ga0070709_100106573 | 392 |
| 616 | 3300005434 | Ga0070709_10012762 | Ga0070709_100127622 | 392 |
| 617 | 3300005436 | Ga0070713_100016072 | Ga0070713_1000160722 | 392 |
| 618 | 3300005545 | Ga0070695_100151994 | Ga0070695_1001519942 | 392 |
| 619 | 3300005563 | Ga0068855_100002310 | Ga0068855_1000023102 | 392 |
| 620 | 3300005614 | Ga0068856_100074697 | Ga0068856_1000746973 | 392 |
| 621 | 3300006028 | Ga0070717_10027349 | Ga0070717_100273492 | 392 |
| 622 | 3300006175 | Ga0070712_100022076 | Ga0070712_1000220764 | 392 |
| 623 | 3300007265 | Ga0099794_10074571 | Ga0099794_100745712 | 392 |
| 624 | 3300007788 | Ga0099795_10000064 | Ga0099795_100000645 | 392 |
| 625 | 3300010159 | Ga0099796_10000064 | Ga0099796_1000006415 | 392 |
| 626 | 3300021377 | Ga0213874_10000731 | Ga0213874_100007313 | 392 |
| 627 | 3300021384 | Ga0213876_10048231 | Ga0213876_100482312 | 392 |
| 628 | 3300025912 | Ga0207707_10012094 | Ga0207707_100120944 | 392 |
| 629 | 3300025913 | Ga0207695_10078512 | Ga0207695_100785122 | 392 |
| 630 | 3300025929 | Ga0207664_10015366 | Ga0207664_100153663 | 392 |
| 631 | 3300025939 | Ga0207665_10040500 | Ga0207665_100405002 | 392 |
| 632 | 3300025949 | Ga0207667_10061826 | Ga0207667_100618262 | 392 |
| 633 | 3300027512 | Ga0209179_1000186 | Ga0209179_10001862 | 392 |
| 634 | 3300037466 | Ga0395898_0004123 | Ga0395898_0004123_6662_7846 | 392 |
| 635 | 3300037466 | Ga0395898_0240714 | Ga0395898_0240714_470_1654 | 392 |
| 636 | 3300039437 | Ga0436365_1435536 | Ga0436365_1435536_8832_10031 | 392 |
| 637 | 3300039450 | Ga0436363_0494892 | Ga0436363_0494892_1153_2340 | 392 |
| 638 | 3300039450 | Ga0436363_1700653 | Ga0436363_1700653_2840_4027 | 392 |
| 639 | 3300044658 | Ga0466972_0044062 | Ga0466972_0044062_176_1423 | 392 |
| 640 | 3300044735 | Ga0466968_0060649 | Ga0466968_0060649_239_1429 | 392 |
| 641 | 3300048905 | Ga0496102_0360558 | Ga0496102_0360558_74_1258 | 392 |
| 642 | 3300048915 | Ga0496112_0298100 | Ga0496112_0298100_324_1514 | 392 |
| 643 | 3300049572 | Ga0501036_0018058 | Ga0501036_0018058_900_2087 | 392 |
| 644 | 3300049574 | Ga0501038_0002611 | Ga0501038_0002611_14290_15477 | 392 |
| 645 | 3300049576 | Ga0501040_0035215 | Ga0501040_0035215_710_1897 | 392 |
| 646 | 3300049578 | Ga0501042_0033413 | Ga0501042_0033413_759_1946 | 392 |
| 647 | 3300049579 | Ga0501043_0055696 | Ga0501043_0055696_1025_2212 | 392 |
| 648 | 3300049580 | Ga0501046_0009023 | Ga0501046_0009023_526_1713 | 392 |
| 649 | 3300049582 | Ga0501048_0021490 | Ga0501048_0021490_829_2016 | 392 |
| 650 | 3300049584 | Ga0501068_0026548 | Ga0501068_0026548_1319_2506 | 392 |
| 651 | 3300049587 | Ga0501071_0005352 | Ga0501071_0005352_634_1821 | 392 |
| 652 | 3300049588 | Ga0501072_0114344 | Ga0501072_0114344_592_1779 | 392 |
| 653 | 3300049590 | Ga0501074_0020850 | Ga0501074_0020850_590_1777 | 392 |
| 654 | 3300049592 | Ga0501076_0002080 | Ga0501076_0002080_10647_11834 | 392 |
| 655 | 3300049593 | Ga0501077_0028768 | Ga0501077_0028768_1618_2805 | 392 |
| 656 | 3300049743 | Ga0501081_0074736 | Ga0501081_0074736_999_2186 | 392 |
| 657 | 3300049824 | Ga0501045_0000225 | Ga0501045_0000225_10880_12067 | 392 |
| 658 | 3300053104 | Ga0500556_0001074 | Ga0500556_0001074_11821_13011 | 392 |
| 659 | 3300054114 | Ga0501084_0007407 | Ga0501084_0007407_708_1895 | 392 |
| 660 | 3300061734 | Ga0530510_0033069 | Ga0530510_0033069_650_1837 | 392 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1c30-assembly1.cif.gz_B | crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s | 0.9647 | 3 | 377 |
| 1jdb-assembly1.cif.gz_F | carbamoyl phosphate synthetase from escherichia coli | 0.9643 | 3 | 374 |
| 1t36-assembly1.cif.gz_B | crystal structure of e. coli carbamoyl phosphate synthetase small subunit mutant c248d complexed with uridine 5'-monophosphate | 0.9614 | 3 | 374 |
| 1a9x-assembly1.cif.gz_B | carbamoyl phosphate synthetase: caught in the act of glutamine hydrolysis | 0.9611 | 3 | 374 |
| 1cs0-assembly4.cif.gz_B | crystal structure of carbamoyl phosphate synthetase complexed at cys269 in the small subunit with the tetrahedral mimic l-glutamate gamma-semialdehyde | 0.961 | 3 | 374 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZ73_174_352_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9641 | 193 | 368 | 3.40.50.880 |
| af_P0A6F1_2_151_3.50.30.20 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain | 0.9625 | 3 | 151 | 3.50.30.20 |
| af_Q58425_140_353_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9555 | 148 | 372 | 3.40.50.880 |
| af_P0A6F1_2_151_3.50.30.20 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Carbamoyl-phosphate synthase small subunit, N-terminal domain | 0.9501 | 3 | 151 | 3.50.30.20 |
| 1a9xD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9462 | 152 | 374 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8A7U4-F1-model_v4 | carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) | 0.9928 | 189 | 341 |
GO:0004088
GO:0005524 |
| AF-A0A377E2M5-F1-model_v4 | carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) | 0.9908 | 209 | 315 |
GO:0004088
GO:0005524 |
| AF-A0A7Z9XQK1-F1-model_v4 | carbamoyl-phosphate synthase (ammonia) (EC 6.3.4.16) | 0.9902 | 190 | 350 |
GO:0004088
GO:0005524 GO:0005737 GO:0006221 GO:0006541 GO:0046872 |
| AF-A0A530QES6-F1-model_v4 | carbamoyl-phosphate synthase (glutamine-hydrolyzing) (EC 6.3.5.5) | 0.9884 | 254 | 344 |
GO:0005524
GO:0016874 |
| AF-A0A258TXK5-F1-model_v4 | deleted | 0.9793 | 207 | 372 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar