F473305

General Info

Members Datasets Scaffolds Average Seq Length
660 253 660 92

Family's Representative Sequence

Representative Sequence 3300003349|JGI26129J50193_1003458|JGI26129J50193_10034582
Length 87
Sequence VSSRNGVSTEKIGALDDYPESALFSDAEKVALEYADAITDTQREVDDDLFLRMQRTIAELTMIIAWENASSRFNRAFRIPSQGFWKP

Samples

Sample ID Description Type Environment
1 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
83 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
173 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
174 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
177 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
178 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
179 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
180 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
181 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
182 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
193 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
198 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.64
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26129J50193_1003458 3300003349 Bacteria 1108
2 JGI26141J51220_1000278 3300003503 Bacteria 2714
3 JGI26138J51218_105747 3300003504 Bacteria 566
4 JGI25405J52794_10015529 3300003911 Unclassified 1497
5 Ga0065712_10672658 3300005290 Unclassified 552
6 Ga0065715_10915989 3300005293 Unclassified 548
7 Ga0065707_10133129 3300005295 Bacteria 1887
8 Ga0065707_10314576 3300005295 Bacteria 978
9 Ga0065707_10435573 3300005295 Unclassified 815
10 Ga0070676_10007875 3300005328 Bacteria 5728
11 Ga0070676_10490035 3300005328 Unclassified 871
12 Ga0070676_11461048 3300005328 Unclassified 526
13 Ga0070670_101326929 3300005331 Bacteria 659
14 Ga0070666_10711601 3300005335 Unclassified 737
15 Ga0070680_100621480 3300005336 Bacteria 928
16 Ga0070680_101181836 3300005336 Unclassified 661
17 Ga0070691_10016112 3300005341 Bacteria 3435
18 Ga0070691_10040574 3300005341 Bacteria 2200
19 Ga0070692_10026594 3300005345 Bacteria 2861
20 Ga0070692_10886956 3300005345 Bacteria 616
21 Ga0070668_100900433 3300005347 Unclassified 791
22 Ga0070669_100020786 3300005353 Bacteria 4689
23 Ga0070669_100097139 3300005353 Bacteria 2217
24 Ga0070669_100132540 3300005353 Bacteria 1914
25 Ga0070675_101141424 3300005354 Bacteria 717
26 Ga0070673_100683018 3300005364 Bacteria 942
27 Ga0070688_101363968 3300005365 Bacteria 574
28 Ga0070659_101692723 3300005366 Unclassified 566
29 Ga0070659_101832345 3300005366 Bacteria 544
30 Ga0070703_10367008 3300005406 Unclassified 619
31 Ga0070709_10026193 3300005434 Unclassified 3453
32 Ga0070701_10007754 3300005438 Unclassified 4607
33 Ga0070701_10068119 3300005438 Bacteria 1895
34 Ga0070701_10223835 3300005438 Bacteria 1123
35 Ga0070701_10646323 3300005438 Unclassified 706
36 Ga0070701_10889051 3300005438 Bacteria 614
37 Ga0070711_100186508 3300005439 Unclassified 1591
38 Ga0070711_101413413 3300005439 Bacteria 606
39 Ga0070705_100027728 3300005440 Bacteria 3094
40 Ga0070705_100035624 3300005440 Unclassified 2791
41 Ga0070705_100052493 3300005440 Unclassified 2382
42 Ga0070705_100158890 3300005440 Bacteria 1509
43 Ga0070705_100807732 3300005440 Unclassified 747
44 Ga0070700_100088429 3300005441 Bacteria 2016
45 Ga0070700_100207928 3300005441 Bacteria 1379
46 Ga0070700_100775524 3300005441 Unclassified 770
47 Ga0070700_101081616 3300005441 Bacteria 664
48 Ga0070694_100002522 3300005444 Bacteria 10813
49 Ga0070694_100031883 3300005444 Bacteria 3457
50 Ga0070694_100114485 3300005444 Bacteria 1926
51 Ga0070694_100175261 3300005444 Bacteria 1582
52 Ga0070694_100302578 3300005444 Bacteria 1226
53 Ga0070694_100397948 3300005444 Bacteria 1078
54 Ga0070694_100528536 3300005444 Bacteria 942
55 Ga0070694_100771412 3300005444 Bacteria 786
56 Ga0070694_101051179 3300005444 Bacteria 678
57 Ga0070708_100003922 3300005445 Bacteria 11683
58 Ga0070708_100011989 3300005445 Bacteria 7065
59 Ga0070708_100301991 3300005445 Bacteria 1507
60 Ga0070708_102151669 3300005445 Unclassified 516
61 Ga0070662_100369841 3300005457 Unclassified 1178
62 Ga0070681_10439440 3300005458 Bacteria 1217
63 Ga0070681_11221038 3300005458 Bacteria 674
64 Ga0070681_11370048 3300005458 Unclassified 631
65 Ga0068867_100222877 3300005459 Unclassified 1521
66 Ga0068867_100236738 3300005459 Unclassified 1478
67 Ga0068867_102363630 3300005459 Unclassified 506
68 Ga0070706_100013480 3300005467 Bacteria 7561
69 Ga0070706_100024916 3300005467 Bacteria 5507
70 Ga0070706_100070067 3300005467 Bacteria 3243
71 Ga0070706_100236298 3300005467 Bacteria 1706
72 Ga0070706_100831091 3300005467 Unclassified 854
73 Ga0070706_101291459 3300005467 Bacteria 669
74 Ga0070706_101721391 3300005467 Bacteria 571
75 Ga0070707_100032141 3300005468 Bacteria 4999
76 Ga0070707_100175985 3300005468 Bacteria 2085
77 Ga0070707_100382878 3300005468 Bacteria 1366
78 Ga0070707_100803405 3300005468 Bacteria 904
79 Ga0070707_100965187 3300005468 Bacteria 817
80 Ga0070707_101103321 3300005468 Unclassified 759
81 Ga0070707_101889253 3300005468 Bacteria 564
82 Ga0070698_100006338 3300005471 Bacteria 12850
83 Ga0070698_100044103 3300005471 Bacteria 4568
84 Ga0070698_100053990 3300005471 Unclassified 4081
85 Ga0070698_100123458 3300005471 Bacteria 2547
86 Ga0070698_100480445 3300005471 Bacteria 1179
87 Ga0070698_100879143 3300005471 Unclassified 841
88 Ga0070698_100884998 3300005471 Unclassified 838
89 Ga0070698_101201324 3300005471 Unclassified 707
90 Ga0070698_101425683 3300005471 Unclassified 644
91 Ga0070699_100004933 3300005518 Bacteria 11768
92 Ga0070699_100009776 3300005518 Bacteria 8299
93 Ga0070699_100020315 3300005518 Bacteria 5727
94 Ga0070699_100126507 3300005518 Bacteria 2250
95 Ga0070699_100133711 3300005518 Bacteria 2187
96 Ga0070699_100135831 3300005518 Bacteria 2169
97 Ga0070699_100259057 3300005518 Unclassified 1555
98 Ga0070699_100841691 3300005518 Bacteria 840
99 Ga0070699_101211710 3300005518 Bacteria 692
100 Ga0070697_100001536 3300005536 Bacteria 17584
101 Ga0070697_100051495 3300005536 Bacteria 3345
102 Ga0070697_100052695 3300005536 Unclassified 3306
103 Ga0070697_100164357 3300005536 Bacteria 1876
104 Ga0070697_100355096 3300005536 Bacteria 1266
105 Ga0070697_101209413 3300005536 Unclassified 673
106 Ga0070697_101443981 3300005536 Unclassified 614
107 Ga0070697_102126430 3300005536 Unclassified 502
108 Ga0068853_101995624 3300005539 Unclassified 563
109 Ga0070686_101303291 3300005544 Unclassified 607
110 Ga0070695_100005646 3300005545 Bacteria 7374
111 Ga0070695_100012549 3300005545 Bacteria 5087
112 Ga0070695_100020170 3300005545 Bacteria 4068
113 Ga0070695_100079033 3300005545 Bacteria 2170
114 Ga0070695_101088522 3300005545 Unclassified 653
115 Ga0070696_100133166 3300005546 Unclassified 1811
116 Ga0070696_100199642 3300005546 Bacteria 1492
117 Ga0070696_100322202 3300005546 Unclassified 1190
118 Ga0070696_100601458 3300005546 Bacteria 887
119 Ga0070696_100650342 3300005546 Unclassified 855
120 Ga0070693_100016884 3300005547 Bacteria 3785
121 Ga0070693_100032920 3300005547 Bacteria 2856
122 Ga0070693_100502139 3300005547 Bacteria 861
123 Ga0070704_100109650 3300005549 Bacteria 2098
124 Ga0070704_100138210 3300005549 Bacteria 1898
125 Ga0070704_100465172 3300005549 Unclassified 1092
126 Ga0070664_100975922 3300005564 Unclassified 796
127 Ga0068857_100009592 3300005577 Bacteria 8410
128 Ga0068857_100604659 3300005577 Unclassified 1037
129 Ga0070702_101385061 3300005615 Bacteria 574
130 Ga0068859_100027949 3300005617 Bacteria 5655
131 Ga0068859_100346349 3300005617 Unclassified 1580
132 Ga0068859_100534271 3300005617 Bacteria 1267
133 Ga0068859_101899094 3300005617 Unclassified 658
134 Ga0068861_100489981 3300005719 Bacteria 1109
135 Ga0068870_11177313 3300005840 Bacteria 554
136 Ga0068863_100337951 3300005841 Bacteria 1465
137 Ga0068863_100409537 3300005841 Unclassified 1327
138 Ga0068858_101278635 3300005842 Bacteria 722
139 Ga0068860_100042259 3300005843 Bacteria 4354
140 Ga0068860_100060085 3300005843 Unclassified 3613
141 Ga0068860_100232513 3300005843 Bacteria 1791
142 Ga0068860_100621578 3300005843 Bacteria 1087
143 Ga0068860_100702404 3300005843 Bacteria 1021
144 Ga0068862_100017713 3300005844 Bacteria 5929
145 Ga0068862_100188798 3300005844 Bacteria 1853
146 Ga0068862_100291444 3300005844 Bacteria 1499
147 Ga0068862_100495654 3300005844 Bacteria 1159
148 Ga0068862_101036925 3300005844 Unclassified 813
149 Ga0068862_101399376 3300005844 Bacteria 703
150 Ga0068862_101969603 3300005844 Bacteria 595
151 Ga0068862_102600477 3300005844 Bacteria 518
152 Ga0081455_10000251 3300005937 Bacteria 70227
153 Ga0081455_10000881 3300005937 Bacteria 38864
154 Ga0081455_10068257 3300005937 Bacteria 2960
155 Ga0081455_10646532 3300005937 Unclassified 682
156 Ga0081538_10158670 3300005981 Bacteria 1009
157 Ga0081540_1011255 3300005983 Bacteria 5994
158 Ga0070717_10010876 3300006028 Bacteria 6889
159 Ga0075432_10025244 3300006058 Unclassified 2039
160 Ga0070716_101643825 3300006173 Unclassified 529
161 Ga0070712_100011653 3300006175 Bacteria 5584
162 Ga0075428_100003287 3300006844 Bacteria 17671
163 Ga0075428_100068699 3300006844 Bacteria 3876
164 Ga0075428_100072391 3300006844 Bacteria 3765
165 Ga0075428_100077379 3300006844 Bacteria 3631
166 Ga0075428_100132833 3300006844 Bacteria 2707
167 Ga0075428_100172392 3300006844 Bacteria 2345
168 Ga0075428_100357287 3300006844 Bacteria 1568
169 Ga0075428_101297803 3300006844 Bacteria 766
170 Ga0075430_100000340 3300006846 Bacteria 33760
171 Ga0075430_100001159 3300006846 Bacteria 21058
172 Ga0075430_100178995 3300006846 Unclassified 1764
173 Ga0075431_100000302 3300006847 Bacteria 38882
174 Ga0075431_100000605 3300006847 Bacteria 30302
175 Ga0075431_100014303 3300006847 Bacteria 8026
176 Ga0075431_100443888 3300006847 Unclassified 1294
177 Ga0075431_100936862 3300006847 Unclassified 835
178 Ga0075431_101554249 3300006847 Unclassified 620
179 Ga0075433_10006592 3300006852 Bacteria 9192
180 Ga0075433_10022805 3300006852 Bacteria 5260
181 Ga0075433_10260429 3300006852 Bacteria 1538
182 Ga0075433_10348695 3300006852 Bacteria 1308
183 Ga0075433_10503759 3300006852 Unclassified 1066
184 Ga0075433_10506157 3300006852 Unclassified 1063
185 Ga0075434_100052971 3300006871 Bacteria 4032
186 Ga0075434_100073398 3300006871 Unclassified 3414
187 Ga0075434_100074997 3300006871 Bacteria 3376
188 Ga0075434_100090084 3300006871 Bacteria 3069
189 Ga0075434_100091915 3300006871 Bacteria 3036
190 Ga0075434_100108430 3300006871 Bacteria 2787
191 Ga0075434_100208755 3300006871 Unclassified 1973
192 Ga0075434_100260390 3300006871 Bacteria 1753
193 Ga0075434_100285391 3300006871 Unclassified 1670
194 Ga0075434_100328229 3300006871 Bacteria 1550
195 Ga0075434_100381778 3300006871 Bacteria 1430
196 Ga0075434_100384337 3300006871 Bacteria 1425
197 Ga0075434_100596790 3300006871 Bacteria 1123
198 Ga0075434_101236108 3300006871 Bacteria 758
199 Ga0075429_100000645 3300006880 Bacteria 26957
200 Ga0075429_100029263 3300006880 Bacteria 4784
201 Ga0075429_100050907 3300006880 Unclassified 3604
202 Ga0075429_100205911 3300006880 Bacteria 1724
203 Ga0075429_100350935 3300006880 Bacteria 1292
204 Ga0075429_100373867 3300006880 Unclassified 1248
205 Ga0075429_101316934 3300006880 Unclassified 630
206 Ga0068865_100488419 3300006881 Unclassified 1025
207 Ga0068865_100536251 3300006881 Unclassified 981
208 Ga0075436_100015886 3300006914 Bacteria 5152
209 Ga0075436_100137811 3300006914 Bacteria 1714
210 Ga0075436_100311525 3300006914 Bacteria 1130
211 Ga0075436_100382639 3300006914 Unclassified 1018
212 Ga0097620_100027949 3300006931 Bacteria 5655
213 Ga0097620_100346364 3300006931 Unclassified 1580
214 Ga0097620_100534276 3300006931 Bacteria 1267
215 Ga0097620_101899128 3300006931 Unclassified 658
216 Ga0075435_100002338 3300007076 Bacteria 12562
217 Ga0075435_100028501 3300007076 Bacteria 4380
218 Ga0075435_100050368 3300007076 Plasmid 3351
219 Ga0075435_100141655 3300007076 Unclassified 2017
220 Ga0075435_100220146 3300007076 Bacteria 1612
221 Ga0075435_100257684 3300007076 Unclassified 1486
222 Ga0075435_100596740 3300007076 Unclassified 957
223 Ga0099794_10006778 3300007265 Bacteria 4662
224 Ga0099794_10029973 3300007265 Bacteria 2537
225 Ga0099794_10351277 3300007265 Bacteria 767
226 Ga0111539_10000568 3300009094 Bacteria 47344
227 Ga0111539_10002409 3300009094 Bacteria 24878
228 Ga0111539_10050985 3300009094 Bacteria 4930
229 Ga0111539_10626720 3300009094 Bacteria 1252
230 Ga0111539_10967757 3300009094 Bacteria 990
231 Ga0111539_11506614 3300009094 Unclassified 780
232 Ga0111539_12741391 3300009094 Bacteria 571
233 Ga0105245_10252645 3300009098 Bacteria 1713
234 Ga0105245_10787618 3300009098 Bacteria 988
235 Ga0105247_10152351 3300009101 Bacteria 1524
236 Ga0105247_10395019 3300009101 Bacteria 984
237 Ga0114129_10005048 3300009147 Bacteria 18573
238 Ga0114129_10005703 3300009147 Bacteria 17639
239 Ga0114129_10013988 3300009147 Bacteria 11431
240 Ga0114129_10019721 3300009147 Bacteria 9597
241 Ga0114129_10104231 3300009147 Bacteria 3919
242 Ga0114129_10148805 3300009147 Bacteria 3205
243 Ga0114129_10546376 3300009147 Bacteria 1507
244 Ga0114129_10687713 3300009147 Unclassified 1316
245 Ga0114129_10716564 3300009147 Bacteria 1284
246 Ga0114129_11718716 3300009147 Bacteria 765
247 Ga0114129_11787146 3300009147 Bacteria 748
248 Ga0114129_12013090 3300009147 Unclassified 698
249 Ga0105243_10031768 3300009148 Bacteria 4073
250 Ga0105243_10131855 3300009148 Unclassified 2121
251 Ga0105243_10581966 3300009148 Bacteria 1075
252 Ga0105243_10953993 3300009148 Unclassified 857
253 Ga0105243_12010832 3300009148 Bacteria 612
254 Ga0105243_12295414 3300009148 Unclassified 577
255 Ga0105241_10008574 3300009174 Bacteria 7510
256 Ga0105241_11091203 3300009174 Unclassified 751
257 Ga0105241_11367934 3300009174 Unclassified 677
258 Ga0105242_10128943 3300009176 Bacteria 2181
259 Ga0105242_10385821 3300009176 Bacteria 1303
260 Ga0105242_10590527 3300009176 Unclassified 1071
261 Ga0105242_10682067 3300009176 Unclassified 1003
262 Ga0105242_10837892 3300009176 Bacteria 914
263 Ga0105242_12235012 3300009176 Bacteria 593
264 Ga0105248_10025584 3300009177 Bacteria 6563
265 Ga0105248_10160164 3300009177 Bacteria 2539
266 Ga0105248_10676711 3300009177 Bacteria 1164
267 Ga0105248_11208790 3300009177 Unclassified 855
268 Ga0105248_12120260 3300009177 Unclassified 639
269 Ga0105237_12062418 3300009545 Bacteria 579
270 Ga0105237_12306187 3300009545 Unclassified 548
271 Ga0105249_10023045 3300009553 Bacteria 5582
272 Ga0105249_10083688 3300009553 Bacteria 2970
273 Ga0105249_10093755 3300009553 Bacteria 2813
274 Ga0105249_10152403 3300009553 Bacteria 2227
275 Ga0105249_10181314 3300009553 Bacteria 2049
276 Ga0105249_11000765 3300009553 Bacteria 905
277 Ga0105239_12168092 3300010375 Bacteria 646
278 Ga0105239_12715785 3300010375 Bacteria 578
279 Ga0105246_10551977 3300011119 Unclassified 987
280 Ga0105246_11328913 3300011119 Unclassified 667
281 Ga0105246_12231457 3300011119 Unclassified 533
282 Ga0157335_1041995 3300012492 Unclassified 519
283 Ga0157315_1065890 3300012508 Unclassified 521
284 Ga0157373_11225478 3300013100 Bacteria 566
285 Ga0157371_10551103 3300013102 Unclassified 855
286 Ga0157378_10094081 3300013297 Bacteria 2729
287 Ga0157378_10418208 3300013297 Bacteria 1324
288 Ga0163162_10022355 3300013306 Bacteria 6233
289 Ga0163162_10368274 3300013306 Bacteria 1570
290 Ga0163162_10403929 3300013306 Unclassified 1499
291 Ga0157372_10891092 3300013307 Bacteria 1032
292 Ga0157375_10159730 3300013308 Bacteria 2395
293 Ga0157375_12371610 3300013308 Unclassified 633
294 Ga0157375_12546638 3300013308 Unclassified 611
295 Ga0163163_11743687 3300014325 Unclassified 683
296 Ga0157380_10021651 3300014326 Bacteria 4825
297 Ga0157380_10949992 3300014326 Bacteria 889
298 Ga0157380_12554285 3300014326 Unclassified 577
299 Ga0157377_11622724 3300014745 Bacteria 519
300 Ga0157379_10676976 3300014968 Unclassified 967
301 Ga0157376_12311460 3300014969 Unclassified 577
302 Ga0163161_10233355 3300017792 Bacteria 1428
303 Ga0163161_10754132 3300017792 Viruses 814
304 Ga0163161_11141486 3300017792 Unclassified 671
305 Ga0207710_10738063 3300025900 Bacteria 517
306 Ga0207680_10353086 3300025903 Bacteria 1033
307 Ga0207685_10211199 3300025905 Unclassified 918
308 Ga0207699_10144096 3300025906 Unclassified 1569
309 Ga0207645_10020334 3300025907 Unclassified 4346
310 Ga0207645_10235899 3300025907 Unclassified 1208
311 Ga0207645_11075922 3300025907 Unclassified 543
312 Ga0207684_10005855 3300025910 Bacteria 11256
313 Ga0207684_10008684 3300025910 Bacteria 9019
314 Ga0207684_10010304 3300025910 Bacteria 8231
315 Ga0207684_10275555 3300025910 Bacteria 1451
316 Ga0207684_10276130 3300025910 Unclassified 1449
317 Ga0207684_10532999 3300025910 Unclassified 1005
318 Ga0207684_11133902 3300025910 Unclassified 650
319 Ga0207684_11495319 3300025910 Unclassified 550
320 Ga0207654_10005421 3300025911 Bacteria 6452
321 Ga0207707_10222483 3300025912 Bacteria 1643
322 Ga0207707_10250695 3300025912 Bacteria 1538
323 Ga0207693_10020982 3300025915 Bacteria 5193
324 Ga0207693_11180142 3300025915 Unclassified 578
325 Ga0207663_10042373 3300025916 Bacteria 2781
326 Ga0207660_10201487 3300025917 Unclassified 1555
327 Ga0207660_10254706 3300025917 Bacteria 1386
328 Ga0207660_11542419 3300025917 Unclassified 536
329 Ga0207662_10530460 3300025918 Unclassified 813
330 Ga0207652_10694263 3300025921 Unclassified 908
331 Ga0207646_10013468 3300025922 Bacteria 7820
332 Ga0207646_10035333 3300025922 Bacteria 4513
333 Ga0207646_10040190 3300025922 Bacteria 4207
334 Ga0207646_10200141 3300025922 Bacteria 1804
335 Ga0207646_10418139 3300025922 Bacteria 1210
336 Ga0207681_10046929 3300025923 Bacteria 2907
337 Ga0207681_10128253 3300025923 Bacteria 1872
338 Ga0207681_10155083 3300025923 Bacteria 1720
339 Ga0207681_10577404 3300025923 Unclassified 927
340 Ga0207681_11851464 3300025923 Unclassified 503
341 Ga0207650_11033709 3300025925 Bacteria 699
342 Ga0207650_11514691 3300025925 Unclassified 570
343 Ga0207659_10748188 3300025926 Bacteria 838
344 Ga0207687_10925492 3300025927 Bacteria 746
345 Ga0207700_10436397 3300025928 Bacteria 1152
346 Ga0207690_11353863 3300025932 Unclassified 595
347 Ga0207706_10208039 3300025933 Unclassified 1715
348 Ga0207686_10013957 3300025934 Bacteria 4459
349 Ga0207686_10224378 3300025934 Bacteria 1359
350 Ga0207686_10280994 3300025934 Bacteria 1229
351 Ga0207709_10108167 3300025935 Bacteria 1853
352 Ga0207709_10228746 3300025935 Unclassified 1346
353 Ga0207709_10389543 3300025935 Unclassified 1062
354 Ga0207709_10506541 3300025935 Unclassified 943
355 Ga0207670_10563130 3300025936 Bacteria 932
356 Ga0207704_11047615 3300025938 Bacteria 692
357 Ga0207691_10153052 3300025940 Unclassified 2027
358 Ga0207711_11141630 3300025941 Unclassified 720
359 Ga0207711_11440490 3300025941 Bacteria 632
360 Ga0207689_10005788 3300025942 Bacteria 10975
361 Ga0207689_11659775 3300025942 Bacteria 530
362 Ga0207712_10053557 3300025961 Bacteria 2831
363 Ga0207712_10140879 3300025961 Unclassified 1850
364 Ga0207712_10159670 3300025961 Bacteria 1750
365 Ga0207712_10279151 3300025961 Bacteria 1363
366 Ga0207712_10645150 3300025961 Unclassified 920
367 Ga0207668_10346449 3300025972 Bacteria 1241
368 Ga0207668_10798823 3300025972 Bacteria 835
369 Ga0207668_11502809 3300025972 Bacteria 608
370 Ga0207640_10345781 3300025981 Bacteria 1193
371 Ga0207658_10839850 3300025986 Bacteria 835
372 Ga0207703_11978594 3300026035 Bacteria 559
373 Ga0207708_10182375 3300026075 Unclassified 1667
374 Ga0207708_10278963 3300026075 Bacteria 1354
375 Ga0207641_10339479 3300026088 Unclassified 1429
376 Ga0207641_10346946 3300026088 Bacteria 1414
377 Ga0207648_10111581 3300026089 Bacteria 2401
378 Ga0207648_10168444 3300026089 Bacteria 1936
379 Ga0207676_10277828 3300026095 Bacteria 1519
380 Ga0207676_10491658 3300026095 Bacteria 1164
381 Ga0207676_11675290 3300026095 Bacteria 634
382 Ga0207674_10003985 3300026116 Bacteria 17948
383 Ga0207675_100079057 3300026118 Bacteria 3082
384 Ga0209967_1003369 3300027364 Bacteria 2104
385 Ga0209996_1004082 3300027395 Bacteria 1852
386 Ga0209984_1004131 3300027424 Unclassified 1697
387 Ga0210000_1016756 3300027462 Bacteria 1108
388 Ga0209995_1004292 3300027471 Bacteria 2279
389 Ga0209999_1018189 3300027543 Bacteria 1286
390 Ga0209970_1009498 3300027614 Bacteria 1590
391 Ga0209970_1029527 3300027614 Bacteria 950
392 Ga0210002_1003910 3300027617 Bacteria 2211
393 Ga0209983_1008624 3300027665 Bacteria 2083
394 Ga0209588_1009063 3300027671 Bacteria 2964
395 Ga0209588_1034418 3300027671 Bacteria 1627
396 Ga0209971_1000022 3300027682 Bacteria 56932
397 Ga0209966_1000381 3300027695 Bacteria 13473
398 Ga0209998_10000417 3300027717 Bacteria 12096
399 Ga0209974_10032570 3300027876 Unclassified 1727
400 Ga0209974_10091669 3300027876 Unclassified 1054
401 Ga0207428_10000334 3300027907 Bacteria 61205
402 Ga0207428_10003707 3300027907 Bacteria 14674
403 Ga0207428_10252268 3300027907 Unclassified 1315
404 Ga0207428_10258876 3300027907 Bacteria 1296
405 Ga0207428_11197071 3300027907 Bacteria 529
406 Ga0268265_10011627 3300028380 Bacteria 5952
407 Ga0268265_10014251 3300028380 Bacteria 5416
408 Ga0268265_10110636 3300028380 Bacteria 2242
409 Ga0268265_10336381 3300028380 Bacteria 1373
410 Ga0268265_10375266 3300028380 Bacteria 1306
411 Ga0268265_10960067 3300028380 Unclassified 842
412 Ga0268265_11314468 3300028380 Bacteria 723
413 Ga0268264_10092170 3300028381 Bacteria 2615
414 Ga0268264_10726675 3300028381 Bacteria 988
415 Ga0268264_11366259 3300028381 Bacteria 719
416 Ga0268264_11984516 3300028381 Unclassified 591
417 Ga0268264_12623935 3300028381 Unclassified 508
418 Ga0307405_11740411 3300031731 Unclassified 553
419 Ga0307416_100099173 3300032002 Bacteria 2529
420 Ga0307416_101369295 3300032002 Unclassified 813
421 Ga0373930_0199245 3300034816 Unclassified 521
422 Ga0373950_0058689 3300034818 Unclassified 769
423 Ga0373959_0101273 3300034820 Unclassified 686
424 Ga0373928_0103881 3300035084 Unclassified 744
425 Ga0373928_0138349 3300035084 Unclassified 666
426 Ga0373940_0046552 3300035088 Unclassified 1207
427 Ga0373949_0014274 3300035090 Bacteria 1768
428 Ga0373951_0114267 3300035091 Unclassified 729
429 Ga0373932_0254567 3300035112 Unclassified 642
430 Ga0373939_0367206 3300035114 Unclassified 589
431 Ga0373941_0077058 3300035115 Unclassified 1119
432 Ga0373941_0180823 3300035115 Unclassified 791
433 Ga0373960_0157346 3300035121 Unclassified 780
434 Ga0373960_0396750 3300035121 Unclassified 531
435 Ga0373943_0473675 3300035170 Bacteria 730
436 Ga0373942_0106305 3300035207 Bacteria 863
437 Ga0373942_0276711 3300035207 Unclassified 577
438 Ga0373962_0153474 3300035242 Unclassified 755
439 Ga0373962_0401966 3300035242 Unclassified 504
440 Ga0373931_0022578 3300035691 Bacteria 3168
441 Ga0373931_0064110 3300035691 Bacteria 1988
442 Ga0395900_0856104 3300037418 Unclassified 834
443 Ga0395905_1155018 3300037471 Bacteria 678
444 Ga0395901_0983925 3300038443 Bacteria 820
445 Ga0242420_162716 3300038996 Unclassified 506
446 Ga0439437_033186 3300042000 Unclassified 654
447 Ga0439441_006015 3300042001 Bacteria 1907
448 Ga0439441_023539 3300042001 Bacteria 1151
449 Ga0439448_0032902 3300042005 Unclassified 1652
450 Ga0439451_057951 3300042009 Unclassified 775
451 Ga0439454_073068 3300042011 Unclassified 612
452 Ga0439455_0041275 3300042012 Unclassified 1182
453 Ga0439463_046485 3300042016 Unclassified 1105
454 Ga0439444_0093387 3300042437 Unclassified 674
455 Ga0439444_0140604 3300042437 Unclassified 577
456 Ga0439459_0105695 3300042438 Unclassified 694
457 Ga0439464_0001934 3300042439 Bacteria 5007
458 Ga0439460_0086567 3300042461 Bacteria 990
459 Ga0451577_0112095 3300042876 Bacteria 2441
460 Ga0451577_0240130 3300042876 Bacteria 1639
461 Ga0451577_0283756 3300042876 Bacteria 1500
462 Ga0451577_0393628 3300042876 Unclassified 1257
463 Ga0439440_0061278 3300042993 Unclassified 961
464 Ga0453683_0008282 3300044673 Bacteria 6990
465 Ga0453683_0022698 3300044673 Bacteria 4001
466 Ga0453683_0042973 3300044673 Bacteria 2837
467 Ga0453683_0078976 3300044673 Bacteria 2060
468 Ga0453683_0882714 3300044673 Unclassified 591
469 Ga0453683_0995951 3300044673 Unclassified 556
470 Ga0466963_0656732 3300044694 Bacteria 740
471 Ga0453684_0009737 3300044712 Bacteria 16692
472 Ga0453684_0119843 3300044712 Bacteria 3180
473 Ga0453684_0743060 3300044712 Bacteria 1063
474 Ga0466957_1126489 3300044842 Unclassified 566
475 Ga0451576_0007782 3300045051 Bacteria 12714
476 Ga0451576_0013106 3300045051 Bacteria 9283
477 Ga0451576_0067557 3300045051 Bacteria 3721
478 Ga0451576_0133277 3300045051 Bacteria 2590
479 Ga0451576_0205796 3300045051 Bacteria 2055
480 Ga0451576_0234322 3300045051 Bacteria 1917
481 Ga0451576_0780427 3300045051 Bacteria 1004
482 Ga0451576_0938537 3300045051 Unclassified 907
483 Ga0451576_1519706 3300045051 Unclassified 695
484 Ga0495580_0030599 3300046472 Bacteria 3896
485 Ga0495580_0329194 3300046472 Unclassified 1037
486 Ga0495644_0100332 3300046523 Unclassified 1095
487 Ga0495663_0243705 3300046525 Unclassified 637
488 Ga0495642_0553879 3300046528 Unclassified 510
489 Ga0495609_0206011 3300046538 Unclassified 820
490 Ga0495621_0235066 3300046539 Unclassified 745
491 Ga0495597_0412538 3300046542 Unclassified 513
492 Ga0495633_0090773 3300046558 Bacteria 1420
493 Ga0495659_0458365 3300046664 Bacteria 555
494 Ga0495588_0289274 3300046674 Bacteria 863
495 Ga0495669_0022644 3300046684 Bacteria 2730
496 Ga0495624_0677594 3300046690 Unclassified 613
497 Ga0495671_0636806 3300046692 Unclassified 507
498 Ga0495636_0673050 3300047318 Unclassified 509
499 Ga0495685_283549 3300047447 Unclassified 522
500 Ga0496101_0986054 3300048904 Bacteria 663
501 Ga0496102_0328587 3300048905 Bacteria 1440
502 Ga0496103_0277948 3300048906 Bacteria 1077
503 Ga0496106_1058957 3300048909 Unclassified 636
504 Ga0496106_1089505 3300048909 Bacteria 626
505 Ga0496106_1588671 3300048909 Unclassified 501
506 Ga0496107_0569213 3300048910 Bacteria 838
507 Ga0496108_1533356 3300048911 Unclassified 553
508 Ga0496109_1266454 3300048912 Bacteria 674
509 Ga0501033_0536988 3300049570 Bacteria 806
510 Ga0501033_0780543 3300049570 Unclassified 647
511 Ga0501036_0074087 3300049572 Bacteria 2879
512 Ga0501036_1024617 3300049572 Bacteria 675
513 Ga0501037_0191881 3300049573 Bacteria 1446
514 Ga0501038_0111301 3300049574 Bacteria 2268
515 Ga0501038_0186799 3300049574 Unclassified 1670
516 Ga0501038_0540582 3300049574 Bacteria 887
517 Ga0501039_0006892 3300049575 Bacteria 8645
518 Ga0501039_0368911 3300049575 Bacteria 1128
519 Ga0501039_0675424 3300049575 Bacteria 808
520 Ga0501040_0006661 3300049576 Bacteria 7500
521 Ga0501040_0013081 3300049576 Bacteria 5457
522 Ga0501040_0379173 3300049576 Bacteria 1015
523 Ga0501040_0498768 3300049576 Bacteria 877
524 Ga0501040_1129413 3300049576 Unclassified 568
525 Ga0501041_0001231 3300049577 Bacteria 14031
526 Ga0501041_0195192 3300049577 Bacteria 1268
527 Ga0501042_0028361 3300049578 Bacteria 3943
528 Ga0501042_0202762 3300049578 Unclassified 1430
529 Ga0501043_0179237 3300049579 Bacteria 1651
530 Ga0501046_0000315 3300049580 Bacteria 48757
531 Ga0501046_0386642 3300049580 Bacteria 1012
532 Ga0501047_0045532 3300049581 Bacteria 4243
533 Ga0501048_0006979 3300049582 Bacteria 8582
534 Ga0501048_0600344 3300049582 Unclassified 790
535 Ga0501067_0070326 3300049583 Bacteria 1938
536 Ga0501067_0274233 3300049583 Unclassified 939
537 Ga0501068_0051132 3300049584 Bacteria 2500
538 Ga0501068_0076500 3300049584 Bacteria 2049
539 Ga0501068_0375465 3300049584 Unclassified 915
540 Ga0501068_0394061 3300049584 Unclassified 892
541 Ga0501069_0060285 3300049585 Unclassified 2118
542 Ga0501069_0730457 3300049585 Unclassified 598
543 Ga0501070_1134793 3300049586 Bacteria 602
544 Ga0501071_0014655 3300049587 Bacteria 5365
545 Ga0501071_0745631 3300049587 Unclassified 754
546 Ga0501071_0922488 3300049587 Unclassified 674
547 Ga0501072_0155167 3300049588 Bacteria 1826
548 Ga0501072_0207652 3300049588 Bacteria 1561
549 Ga0501072_0258953 3300049588 Unclassified 1385
550 Ga0501072_0411346 3300049588 Bacteria 1073
551 Ga0501072_0974974 3300049588 Bacteria 661
552 Ga0501073_0342491 3300049589 Bacteria 1032
553 Ga0501074_0057129 3300049590 Bacteria 2811
554 Ga0501075_0251719 3300049591 Bacteria 1346
555 Ga0501075_0318901 3300049591 Bacteria 1184
556 Ga0501075_0624792 3300049591 Bacteria 821
557 Ga0501075_0645056 3300049591 Unclassified 807
558 Ga0501076_0027978 3300049592 Bacteria 4374
559 Ga0501076_0219394 3300049592 Bacteria 1554
560 Ga0501076_0654284 3300049592 Archaea 867
561 Ga0501076_0698331 3300049592 Bacteria 837
562 Ga0501077_0039242 3300049593 Bacteria 3016
563 Ga0501077_0138180 3300049593 Bacteria 1545
564 Ga0501077_0416262 3300049593 Bacteria 859
565 Ga0501077_1062387 3300049593 Bacteria 521
566 Ga0501079_0001543 3300049741 Bacteria 16309
567 Ga0501079_0030906 3300049741 Unclassified 4115
568 Ga0501079_1113726 3300049741 Unclassified 622
569 Ga0501080_0106682 3300049742 Bacteria 2596
570 Ga0501081_0001911 3300049743 Bacteria 12927
571 Ga0501081_0002104 3300049743 Bacteria 12442
572 Ga0501081_0044034 3300049743 Bacteria 3063
573 Ga0501081_0349942 3300049743 Bacteria 1089
574 Ga0501081_0497878 3300049743 Bacteria 908
575 Ga0501083_0010452 3300049744 Bacteria 6535
576 Ga0501083_0189269 3300049744 Bacteria 1343
577 Ga0501044_0958192 3300049823 Bacteria 729
578 Ga0501045_0005719 3300049824 Bacteria 8608
579 Ga0501045_0146245 3300049824 Unclassified 1758
580 Ga0501045_0316033 3300049824 Bacteria 1162
581 Ga0501045_0604244 3300049824 Unclassified 812
582 nmdc:mga05p37_100146_c1 3300050507 Bacteria 3569
583 nmdc:mga05p37_209963_c1 3300050507 Bacteria 2354
584 nmdc:mga05p37_254518_c1 3300050507 Bacteria 2105
585 nmdc:mga05p37_26712_c1 3300050507 Bacteria 7021
586 nmdc:mga05p37_29317_c1 3300050507 Bacteria 6716
587 nmdc:mga05p37_3399_c1 3300050507 Bacteria 18573
588 nmdc:mga05p37_466979_c1 3300050507 Bacteria 1457
589 nmdc:mga05p37_573743_c1 3300050507 Unclassified 1279
590 nmdc:mga05p37_655259_c1 3300050507 Bacteria 1175
591 nmdc:mga05p37_68544_c1 3300050507 Bacteria 4362
592 nmdc:mga05p37_68816_c1 3300050507 Bacteria 4353
593 nmdc:mga05p37_915019_c1 3300050507 Bacteria 944
594 nmdc:mga05p37_923310_c1 3300050507 Unclassified 938
595 nmdc:mga09592_153404_c1 3300050508 Unclassified 1988
596 nmdc:mga09592_386611_c1 3300050508 Bacteria 1210
597 nmdc:mga09592_64362_c1 3300050508 Unclassified 3104
598 nmdc:mga09592_647013_c1 3300050508 Bacteria 903
599 nmdc:mga09592_656455_c1 3300050508 Unclassified 895
600 nmdc:mga09592_7508_c1 3300050508 Bacteria 8871
601 nmdc:mga0qj67_226816_c1 3300050509 Bacteria 1516
602 nmdc:mga0qj67_23209_c1 3300050509 Bacteria 4770
603 nmdc:mga0qj67_6442_c1 3300050509 Bacteria 8627
604 nmdc:mga06r32_1157_c1 3300050510 Bacteria 23719
605 nmdc:mga06r32_1745_c1 3300050510 Bacteria 19542
606 nmdc:mga06r32_177389_c1 3300050510 Unclassified 2115
607 nmdc:mga06r32_34138_c1 3300050510 Bacteria 4796
608 nmdc:mga06r32_976019_c1 3300050510 Unclassified 801
609 nmdc:mga08y16_14265_c1 3300050511 Bacteria 8363
610 nmdc:mga08y16_1507587_c1 3300050511 Unclassified 633
611 nmdc:mga08y16_238373_c1 3300050511 Bacteria 1881
612 nmdc:mga08y16_58481_c1 3300050511 Bacteria 4028
613 nmdc:mga08y16_61282_c1 3300050511 Bacteria 3929
614 nmdc:mga0n895_1067894_c1 3300050512 Bacteria 786
615 nmdc:mga0n895_109198_c1 3300050512 Bacteria 2782
616 nmdc:mga0n895_1497331_c1 3300050512 Bacteria 641
617 nmdc:mga0n895_17794_c1 3300050512 Bacteria 6561
618 nmdc:mga0n895_187547_c1 3300050512 Unclassified 2099
619 nmdc:mga0n895_1986478_c1 3300050512 Bacteria 539
620 nmdc:mga0n895_2290_c1 3300050512 Bacteria 14864
621 nmdc:mga0n895_24428_c1 3300050512 Bacteria 5696
622 nmdc:mga0n895_32142_c1 3300050512 Bacteria 5034
623 nmdc:mga0n895_385999_c1 3300050512 Bacteria 1417
624 nmdc:mga0n895_440846_c1 3300050512 Bacteria 1316
625 nmdc:mga0n895_446121_c1 3300050512 Bacteria 1307
626 nmdc:mga0n895_459778_c1 3300050512 Unclassified 1285
627 nmdc:mga0n895_49599_c1 3300050512 Unclassified 4114
628 nmdc:mga0n895_633742_c1 3300050512 Unclassified 1069
629 nmdc:mga0rr50_125813_c1 3300050513 Bacteria 2047
630 nmdc:mga0rr50_265167_c1 3300050513 Unclassified 1430
631 nmdc:mga0rr50_295210_c1 3300050513 Bacteria 1355
632 nmdc:mga0rr50_38577_c1 3300050513 Bacteria 3459
633 nmdc:mga0rr50_40420_c1 3300050513 Plasmid 3391
634 nmdc:mga08x19_14374_c1 3300050514 Bacteria 4801
635 nmdc:mga08x19_150308_c1 3300050514 Bacteria 1577
636 nmdc:mga08x19_3022_c1 3300050514 Bacteria 10113
637 nmdc:mga08x19_493295_c1 3300050514 Bacteria 864
638 nmdc:mga08x19_775094_c1 3300050514 Bacteria 681
639 nmdc:mga0a205_158882_c1 3300050515 Bacteria 2158
640 nmdc:mga0a205_17488_c1 3300050515 Bacteria 6724
641 nmdc:mga0a205_239834_c1 3300050515 Bacteria 1694
642 nmdc:mga0a205_24323_c1 3300050515 Bacteria 5758
643 nmdc:mga0a205_321362_c1 3300050515 Bacteria 1419
644 nmdc:mga0a205_372662_c1 3300050515 Bacteria 1293
645 nmdc:mga0a205_3996_c1 3300050515 Bacteria 6463
646 nmdc:mga0a205_598922_c1 3300050515 Unclassified 955
647 nmdc:mga0a205_71418_c1 3300050515 Bacteria 3353
648 nmdc:mga0a205_773_c1 3300050515 Bacteria 25870
649 nmdc:mga0a205_970494_c1 3300050515 Unclassified 697
650 Ga0501084_0001076 3300054114 Bacteria 21245
651 Ga0501084_0019092 3300054114 Bacteria 5709
652 Ga0501084_0242192 3300054114 Bacteria 1522
653 Ga0501084_0326232 3300054114 Bacteria 1297
654 Ga0501084_0357538 3300054114 Unclassified 1234
655 Ga0501084_1760972 3300054114 Unclassified 517
656 Ga0501082_0000482 3300060353 Bacteria 35220
657 Ga0501082_0305459 3300060353 Bacteria 1385
658 Ga0501082_0319427 3300060353 Bacteria 1353
659 Ga0501082_1390574 3300060353 Unclassified 613
660 Ga0530510_0028243 3300061734 Bacteria 4022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10000251 Ga0081455_1000025152 79
2 3300042005 Ga0439448_0032902 Ga0439448_0032902_811_1089 79
3 3300042012 Ga0439455_0041275 Ga0439455_0041275_361_639 79
4 3300042016 Ga0439463_046485 Ga0439463_046485_108_386 79
5 3300042439 Ga0439464_0001934 Ga0439464_0001934_1021_1299 79
6 3300005295 Ga0065707_10314576 Ga0065707_103145762 81
7 3300005295 Ga0065707_10435573 Ga0065707_104355731 81
8 3300005345 Ga0070692_10886956 Ga0070692_108869562 81
9 3300005434 Ga0070709_10026193 Ga0070709_100261934 81
10 3300005439 Ga0070711_100186508 Ga0070711_1001865082 81
11 3300005444 Ga0070694_101051179 Ga0070694_1010511792 81
12 3300005843 Ga0068860_100232513 Ga0068860_1002325131 81
13 3300006175 Ga0070712_100011653 Ga0070712_1000116532 81
14 3300006844 Ga0075428_100357287 Ga0075428_1003572872 81
15 3300009176 Ga0105242_10837892 Ga0105242_108378922 81
16 3300009177 Ga0105248_10160164 Ga0105248_101601642 81
17 3300012492 Ga0157335_1041995 Ga0157335_10419952 81
18 3300012508 Ga0157315_1065890 Ga0157315_10658901 81
19 3300025906 Ga0207699_10144096 Ga0207699_101440961 81
20 3300025915 Ga0207693_10020982 Ga0207693_100209827 81
21 3300025916 Ga0207663_10042373 Ga0207663_100423734 81
22 3300044673 Ga0453683_0022698 Ga0453683_0022698_1905_2165 81
23 3300045051 Ga0451576_0205796 Ga0451576_0205796_1617_1877 81
24 3300003349 JGI26129J50193_1003458 JGI26129J50193_10034582 87
25 3300003503 JGI26141J51220_1000278 JGI26141J51220_10002784 87
26 3300003504 JGI26138J51218_105747 JGI26138J51218_1057472 87
27 3300003911 JGI25405J52794_10015529 JGI25405J52794_100155292 87
28 3300005290 Ga0065712_10672658 Ga0065712_106726582 87
29 3300005293 Ga0065715_10915989 Ga0065715_109159891 87
30 3300005295 Ga0065707_10133129 Ga0065707_101331292 87
31 3300005328 Ga0070676_10007875 Ga0070676_100078751 87
32 3300005328 Ga0070676_10490035 Ga0070676_104900353 87
33 3300005328 Ga0070676_11461048 Ga0070676_114610481 87
34 3300005331 Ga0070670_101326929 Ga0070670_1013269292 87
35 3300005335 Ga0070666_10711601 Ga0070666_107116012 87
36 3300005336 Ga0070680_100621480 Ga0070680_1006214802 87
37 3300005336 Ga0070680_101181836 Ga0070680_1011818362 87
38 3300005341 Ga0070691_10016112 Ga0070691_100161124 87
39 3300005341 Ga0070691_10040574 Ga0070691_100405742 87
40 3300005345 Ga0070692_10026594 Ga0070692_100265943 87
41 3300005347 Ga0070668_100900433 Ga0070668_1009004331 87
42 3300005353 Ga0070669_100020786 Ga0070669_1000207862 87
43 3300005353 Ga0070669_100097139 Ga0070669_1000971394 87
44 3300005353 Ga0070669_100132540 Ga0070669_1001325402 87
45 3300005354 Ga0070675_101141424 Ga0070675_1011414241 87
46 3300005364 Ga0070673_100683018 Ga0070673_1006830181 87
47 3300005365 Ga0070688_101363968 Ga0070688_1013639682 87
48 3300005366 Ga0070659_101692723 Ga0070659_1016927232 87
49 3300005366 Ga0070659_101832345 Ga0070659_1018323451 87
50 3300005406 Ga0070703_10367008 Ga0070703_103670082 87
51 3300005438 Ga0070701_10007754 Ga0070701_100077545 87
52 3300005438 Ga0070701_10068119 Ga0070701_100681193 87
53 3300005438 Ga0070701_10223835 Ga0070701_102238352 87
54 3300005438 Ga0070701_10646323 Ga0070701_106463232 87
55 3300005438 Ga0070701_10889051 Ga0070701_108890512 87
56 3300005439 Ga0070711_101413413 Ga0070711_1014134131 87
57 3300005440 Ga0070705_100027728 Ga0070705_1000277285 87
58 3300005440 Ga0070705_100035624 Ga0070705_1000356246 87
59 3300005440 Ga0070705_100052493 Ga0070705_1000524932 87
60 3300005440 Ga0070705_100158890 Ga0070705_1001588904 87
61 3300005440 Ga0070705_100807732 Ga0070705_1008077322 87
62 3300005441 Ga0070700_100088429 Ga0070700_1000884292 87
63 3300005441 Ga0070700_100207928 Ga0070700_1002079283 87
64 3300005441 Ga0070700_100775524 Ga0070700_1007755242 87
65 3300005441 Ga0070700_101081616 Ga0070700_1010816162 87
66 3300005444 Ga0070694_100002522 Ga0070694_1000025229 87
67 3300005444 Ga0070694_100031883 Ga0070694_1000318834 87
68 3300005444 Ga0070694_100114485 Ga0070694_1001144853 87
69 3300005444 Ga0070694_100175261 Ga0070694_1001752613 87
70 3300005444 Ga0070694_100302578 Ga0070694_1003025782 87
71 3300005444 Ga0070694_100397948 Ga0070694_1003979483 87
72 3300005444 Ga0070694_100528536 Ga0070694_1005285361 87
73 3300005444 Ga0070694_100771412 Ga0070694_1007714121 87
74 3300005445 Ga0070708_100003922 Ga0070708_10000392210 87
75 3300005445 Ga0070708_100011989 Ga0070708_1000119897 87
76 3300005445 Ga0070708_100301991 Ga0070708_1003019912 87
77 3300005445 Ga0070708_102151669 Ga0070708_1021516691 87
78 3300005457 Ga0070662_100369841 Ga0070662_1003698412 87
79 3300005458 Ga0070681_10439440 Ga0070681_104394404 87
80 3300005458 Ga0070681_11221038 Ga0070681_112210382 87
81 3300005458 Ga0070681_11370048 Ga0070681_113700482 87
82 3300005459 Ga0068867_100222877 Ga0068867_1002228773 87
83 3300005459 Ga0068867_100236738 Ga0068867_1002367383 87
84 3300005459 Ga0068867_102363630 Ga0068867_1023636301 87
85 3300005467 Ga0070706_100013480 Ga0070706_1000134807 87
86 3300005467 Ga0070706_100024916 Ga0070706_1000249167 87
87 3300005467 Ga0070706_100070067 Ga0070706_1000700673 87
88 3300005467 Ga0070706_100236298 Ga0070706_1002362982 87
89 3300005467 Ga0070706_100831091 Ga0070706_1008310913 87
90 3300005467 Ga0070706_101291459 Ga0070706_1012914591 87
91 3300005467 Ga0070706_101721391 Ga0070706_1017213912 87
92 3300005468 Ga0070707_100032141 Ga0070707_1000321417 87
93 3300005468 Ga0070707_100175985 Ga0070707_1001759853 87
94 3300005468 Ga0070707_100382878 Ga0070707_1003828782 87
95 3300005468 Ga0070707_100803405 Ga0070707_1008034051 87
96 3300005468 Ga0070707_100965187 Ga0070707_1009651871 87
97 3300005468 Ga0070707_101103321 Ga0070707_1011033212 87
98 3300005468 Ga0070707_101889253 Ga0070707_1018892531 87
99 3300005471 Ga0070698_100006338 Ga0070698_1000063388 87
100 3300005471 Ga0070698_100044103 Ga0070698_1000441031 87
101 3300005471 Ga0070698_100053990 Ga0070698_1000539903 87
102 3300005471 Ga0070698_100123458 Ga0070698_1001234585 87
103 3300005471 Ga0070698_100480445 Ga0070698_1004804451 87
104 3300005471 Ga0070698_100879143 Ga0070698_1008791432 87
105 3300005471 Ga0070698_100884998 Ga0070698_1008849982 87
106 3300005471 Ga0070698_101201324 Ga0070698_1012013241 87
107 3300005471 Ga0070698_101425683 Ga0070698_1014256831 87
108 3300005518 Ga0070699_100004933 Ga0070699_1000049338 87
109 3300005518 Ga0070699_100009776 Ga0070699_1000097765 87
110 3300005518 Ga0070699_100020315 Ga0070699_1000203157 87
111 3300005518 Ga0070699_100126507 Ga0070699_1001265074 87
112 3300005518 Ga0070699_100133711 Ga0070699_1001337112 87
113 3300005518 Ga0070699_100135831 Ga0070699_1001358314 87
114 3300005518 Ga0070699_100259057 Ga0070699_1002590573 87
115 3300005518 Ga0070699_100841691 Ga0070699_1008416912 87
116 3300005518 Ga0070699_101211710 Ga0070699_1012117101 87
117 3300005536 Ga0070697_100001536 Ga0070697_10000153613 87
118 3300005536 Ga0070697_100051495 Ga0070697_1000514954 87
119 3300005536 Ga0070697_100052695 Ga0070697_1000526955 87
120 3300005536 Ga0070697_100164357 Ga0070697_1001643573 87
121 3300005536 Ga0070697_100355096 Ga0070697_1003550963 87
122 3300005536 Ga0070697_101209413 Ga0070697_1012094131 87
123 3300005536 Ga0070697_101443981 Ga0070697_1014439811 87
124 3300005536 Ga0070697_102126430 Ga0070697_1021264301 87
125 3300005539 Ga0068853_101995624 Ga0068853_1019956241 87
126 3300005544 Ga0070686_101303291 Ga0070686_1013032912 87
127 3300005545 Ga0070695_100005646 Ga0070695_1000056467 87
128 3300005545 Ga0070695_100012549 Ga0070695_1000125496 87
129 3300005545 Ga0070695_100020170 Ga0070695_1000201707 87
130 3300005545 Ga0070695_100079033 Ga0070695_1000790333 87
131 3300005545 Ga0070695_101088522 Ga0070695_1010885222 87
132 3300005546 Ga0070696_100133166 Ga0070696_1001331663 87
133 3300005546 Ga0070696_100199642 Ga0070696_1001996422 87
134 3300005546 Ga0070696_100322202 Ga0070696_1003222021 87
135 3300005546 Ga0070696_100601458 Ga0070696_1006014583 87
136 3300005546 Ga0070696_100650342 Ga0070696_1006503421 87
137 3300005547 Ga0070693_100016884 Ga0070693_1000168842 87
138 3300005547 Ga0070693_100032920 Ga0070693_1000329204 87
139 3300005547 Ga0070693_100502139 Ga0070693_1005021392 87
140 3300005549 Ga0070704_100109650 Ga0070704_1001096503 87
141 3300005549 Ga0070704_100138210 Ga0070704_1001382102 87
142 3300005549 Ga0070704_100465172 Ga0070704_1004651722 87
143 3300005564 Ga0070664_100975922 Ga0070664_1009759223 87
144 3300005577 Ga0068857_100009592 Ga0068857_1000095927 87
145 3300005577 Ga0068857_100604659 Ga0068857_1006046592 87
146 3300005615 Ga0070702_101385061 Ga0070702_1013850612 87
147 3300005617 Ga0068859_100027949 Ga0068859_1000279495 87
148 3300005617 Ga0068859_100346349 Ga0068859_1003463493 87
149 3300005617 Ga0068859_100534271 Ga0068859_1005342713 87
150 3300005617 Ga0068859_101899094 Ga0068859_1018990941 87
151 3300005719 Ga0068861_100489981 Ga0068861_1004899812 87
152 3300005840 Ga0068870_11177313 Ga0068870_111773132 87
153 3300005841 Ga0068863_100337951 Ga0068863_1003379512 87
154 3300005841 Ga0068863_100409537 Ga0068863_1004095373 87
155 3300005842 Ga0068858_101278635 Ga0068858_1012786352 87
156 3300005843 Ga0068860_100042259 Ga0068860_1000422594 87
157 3300005843 Ga0068860_100060085 Ga0068860_1000600858 87
158 3300005843 Ga0068860_100621578 Ga0068860_1006215782 87
159 3300005843 Ga0068860_100702404 Ga0068860_1007024042 87
160 3300005844 Ga0068862_100017713 Ga0068862_1000177137 87
161 3300005844 Ga0068862_100188798 Ga0068862_1001887983 87
162 3300005844 Ga0068862_100291444 Ga0068862_1002914443 87
163 3300005844 Ga0068862_100495654 Ga0068862_1004956542 87
164 3300005844 Ga0068862_101036925 Ga0068862_1010369251 87
165 3300005844 Ga0068862_101399376 Ga0068862_1013993762 87
166 3300005844 Ga0068862_101969603 Ga0068862_1019696032 87
167 3300005844 Ga0068862_102600477 Ga0068862_1026004771 87
168 3300005937 Ga0081455_10000881 Ga0081455_1000088115 87
169 3300005937 Ga0081455_10068257 Ga0081455_100682573 87
170 3300005937 Ga0081455_10646532 Ga0081455_106465322 87
171 3300005981 Ga0081538_10158670 Ga0081538_101586702 87
172 3300005983 Ga0081540_1011255 Ga0081540_10112559 87
173 3300006028 Ga0070717_10010876 Ga0070717_100108763 87
174 3300006058 Ga0075432_10025244 Ga0075432_100252443 87
175 3300006173 Ga0070716_101643825 Ga0070716_1016438251 87
176 3300006844 Ga0075428_100003287 Ga0075428_10000328714 87
177 3300006844 Ga0075428_100068699 Ga0075428_1000686992 87
178 3300006844 Ga0075428_100072391 Ga0075428_1000723912 87
179 3300006844 Ga0075428_100077379 Ga0075428_1000773793 87
180 3300006844 Ga0075428_100132833 Ga0075428_1001328332 87
181 3300006844 Ga0075428_100172392 Ga0075428_1001723922 87
182 3300006844 Ga0075428_101297803 Ga0075428_1012978032 87
183 3300006846 Ga0075430_100000340 Ga0075430_10000034028 87
184 3300006846 Ga0075430_100001159 Ga0075430_10000115919 87
185 3300006846 Ga0075430_100178995 Ga0075430_1001789952 87
186 3300006847 Ga0075431_100000302 Ga0075431_1000003028 87
187 3300006847 Ga0075431_100000605 Ga0075431_10000060528 87
188 3300006847 Ga0075431_100014303 Ga0075431_1000143033 87
189 3300006847 Ga0075431_100443888 Ga0075431_1004438883 87
190 3300006847 Ga0075431_100936862 Ga0075431_1009368622 87
191 3300006847 Ga0075431_101554249 Ga0075431_1015542492 87
192 3300006852 Ga0075433_10006592 Ga0075433_100065927 87
193 3300006852 Ga0075433_10022805 Ga0075433_100228057 87
194 3300006852 Ga0075433_10260429 Ga0075433_102604291 87
195 3300006852 Ga0075433_10348695 Ga0075433_103486952 87
196 3300006852 Ga0075433_10503759 Ga0075433_105037592 87
197 3300006852 Ga0075433_10506157 Ga0075433_105061572 87
198 3300006871 Ga0075434_100052971 Ga0075434_1000529712 87
199 3300006871 Ga0075434_100073398 Ga0075434_1000733982 87
200 3300006871 Ga0075434_100074997 Ga0075434_1000749974 87
201 3300006871 Ga0075434_100090084 Ga0075434_1000900843 87
202 3300006871 Ga0075434_100091915 Ga0075434_1000919152 87
203 3300006871 Ga0075434_100108430 Ga0075434_1001084307 87
204 3300006871 Ga0075434_100208755 Ga0075434_1002087554 87
205 3300006871 Ga0075434_100260390 Ga0075434_1002603903 87
206 3300006871 Ga0075434_100285391 Ga0075434_1002853913 87
207 3300006871 Ga0075434_100328229 Ga0075434_1003282292 87
208 3300006871 Ga0075434_100381778 Ga0075434_1003817782 87
209 3300006871 Ga0075434_100384337 Ga0075434_1003843372 87
210 3300006871 Ga0075434_100596790 Ga0075434_1005967902 87
211 3300006871 Ga0075434_101236108 Ga0075434_1012361081 87
212 3300006880 Ga0075429_100000645 Ga0075429_1000006455 87
213 3300006880 Ga0075429_100029263 Ga0075429_1000292632 87
214 3300006880 Ga0075429_100050907 Ga0075429_1000509072 87
215 3300006880 Ga0075429_100205911 Ga0075429_1002059113 87
216 3300006880 Ga0075429_100350935 Ga0075429_1003509352 87
217 3300006880 Ga0075429_100373867 Ga0075429_1003738672 87
218 3300006880 Ga0075429_101316934 Ga0075429_1013169342 87
219 3300006881 Ga0068865_100488419 Ga0068865_1004884193 87
220 3300006881 Ga0068865_100536251 Ga0068865_1005362512 87
221 3300006914 Ga0075436_100015886 Ga0075436_1000158864 87
222 3300006914 Ga0075436_100137811 Ga0075436_1001378111 87
223 3300006914 Ga0075436_100311525 Ga0075436_1003115252 87
224 3300006914 Ga0075436_100382639 Ga0075436_1003826392 87
225 3300006931 Ga0097620_100027949 Ga0097620_1000279495 87
226 3300006931 Ga0097620_100346364 Ga0097620_1003463643 87
227 3300006931 Ga0097620_100534276 Ga0097620_1005342762 87
228 3300006931 Ga0097620_101899128 Ga0097620_1018991281 87
229 3300007076 Ga0075435_100002338 Ga0075435_1000023388 87
230 3300007076 Ga0075435_100028501 Ga0075435_1000285015 87
231 3300007076 Ga0075435_100050368 Ga0075435_1000503681 87
232 3300007076 Ga0075435_100141655 Ga0075435_1001416552 87
233 3300007076 Ga0075435_100220146 Ga0075435_1002201463 87
234 3300007076 Ga0075435_100257684 Ga0075435_1002576841 87
235 3300007076 Ga0075435_100596740 Ga0075435_1005967403 87
236 3300007265 Ga0099794_10006778 Ga0099794_100067786 87
237 3300007265 Ga0099794_10029973 Ga0099794_100299733 87
238 3300007265 Ga0099794_10351277 Ga0099794_103512771 87
239 3300009094 Ga0111539_10000568 Ga0111539_1000056842 87
240 3300009094 Ga0111539_10002409 Ga0111539_1000240913 87
241 3300009094 Ga0111539_10050985 Ga0111539_100509855 87
242 3300009094 Ga0111539_10626720 Ga0111539_106267203 87
243 3300009094 Ga0111539_10967757 Ga0111539_109677572 87
244 3300009094 Ga0111539_11506614 Ga0111539_115066142 87
245 3300009094 Ga0111539_12741391 Ga0111539_127413911 87
246 3300009098 Ga0105245_10252645 Ga0105245_102526453 87
247 3300009098 Ga0105245_10787618 Ga0105245_107876182 87
248 3300009101 Ga0105247_10152351 Ga0105247_101523511 87
249 3300009101 Ga0105247_10395019 Ga0105247_103950193 87
250 3300009147 Ga0114129_10005048 Ga0114129_100050485 87
251 3300009147 Ga0114129_10005703 Ga0114129_1000570317 87
252 3300009147 Ga0114129_10013988 Ga0114129_1001398813 87
253 3300009147 Ga0114129_10019721 Ga0114129_100197216 87
254 3300009147 Ga0114129_10104231 Ga0114129_101042315 87
255 3300009147 Ga0114129_10148805 Ga0114129_101488054 87
256 3300009147 Ga0114129_10546376 Ga0114129_105463765 87
257 3300009147 Ga0114129_10687713 Ga0114129_106877133 87
258 3300009147 Ga0114129_10716564 Ga0114129_107165642 87
259 3300009147 Ga0114129_11718716 Ga0114129_117187161 87
260 3300009147 Ga0114129_11787146 Ga0114129_117871462 87
261 3300009147 Ga0114129_12013090 Ga0114129_120130902 87
262 3300009148 Ga0105243_10031768 Ga0105243_100317682 87
263 3300009148 Ga0105243_10131855 Ga0105243_101318554 87
264 3300009148 Ga0105243_10581966 Ga0105243_105819663 87
265 3300009148 Ga0105243_10953993 Ga0105243_109539932 87
266 3300009148 Ga0105243_12010832 Ga0105243_120108322 87
267 3300009148 Ga0105243_12295414 Ga0105243_122954141 87
268 3300009174 Ga0105241_10008574 Ga0105241_100085744 87
269 3300009174 Ga0105241_11091203 Ga0105241_110912032 87
270 3300009174 Ga0105241_11367934 Ga0105241_113679342 87
271 3300009176 Ga0105242_10128943 Ga0105242_101289432 87
272 3300009176 Ga0105242_10385821 Ga0105242_103858213 87
273 3300009176 Ga0105242_10590527 Ga0105242_105905271 87
274 3300009176 Ga0105242_10682067 Ga0105242_106820672 87
275 3300009176 Ga0105242_12235012 Ga0105242_122350122 87
276 3300009177 Ga0105248_10025584 Ga0105248_100255846 87
277 3300009177 Ga0105248_10676711 Ga0105248_106767112 87
278 3300009177 Ga0105248_11208790 Ga0105248_112087902 87
279 3300009177 Ga0105248_12120260 Ga0105248_121202602 87
280 3300009545 Ga0105237_12062418 Ga0105237_120624182 87
281 3300009545 Ga0105237_12306187 Ga0105237_123061871 87
282 3300009553 Ga0105249_10023045 Ga0105249_100230454 87
283 3300009553 Ga0105249_10083688 Ga0105249_100836885 87
284 3300009553 Ga0105249_10093755 Ga0105249_100937554 87
285 3300009553 Ga0105249_10152403 Ga0105249_101524034 87
286 3300009553 Ga0105249_10181314 Ga0105249_101813144 87
287 3300009553 Ga0105249_11000765 Ga0105249_110007651 87
288 3300010375 Ga0105239_12168092 Ga0105239_121680922 87
289 3300010375 Ga0105239_12715785 Ga0105239_127157851 87
290 3300011119 Ga0105246_10551977 Ga0105246_105519773 87
291 3300011119 Ga0105246_11328913 Ga0105246_113289131 87
292 3300011119 Ga0105246_12231457 Ga0105246_122314572 87
293 3300013100 Ga0157373_11225478 Ga0157373_112254782 87
294 3300013102 Ga0157371_10551103 Ga0157371_105511032 87
295 3300013297 Ga0157378_10094081 Ga0157378_100940815 87
296 3300013297 Ga0157378_10418208 Ga0157378_104182081 87
297 3300013306 Ga0163162_10022355 Ga0163162_100223555 87
298 3300013306 Ga0163162_10368274 Ga0163162_103682742 87
299 3300013306 Ga0163162_10403929 Ga0163162_104039291 87
300 3300013307 Ga0157372_10891092 Ga0157372_108910923 87
301 3300013308 Ga0157375_10159730 Ga0157375_101597302 87
302 3300013308 Ga0157375_12371610 Ga0157375_123716102 87
303 3300013308 Ga0157375_12546638 Ga0157375_125466381 87
304 3300014325 Ga0163163_11743687 Ga0163163_117436872 87
305 3300014326 Ga0157380_10021651 Ga0157380_100216514 87
306 3300014326 Ga0157380_10949992 Ga0157380_109499923 87
307 3300014326 Ga0157380_12554285 Ga0157380_125542852 87
308 3300014745 Ga0157377_11622724 Ga0157377_116227241 87
309 3300014968 Ga0157379_10676976 Ga0157379_106769763 87
310 3300014969 Ga0157376_12311460 Ga0157376_123114601 87
311 3300017792 Ga0163161_10233355 Ga0163161_102333552 87
312 3300017792 Ga0163161_10754132 Ga0163161_107541322 87
313 3300017792 Ga0163161_11141486 Ga0163161_111414862 87
314 3300025900 Ga0207710_10738063 Ga0207710_107380631 87
315 3300025903 Ga0207680_10353086 Ga0207680_103530862 87
316 3300025905 Ga0207685_10211199 Ga0207685_102111993 87
317 3300025907 Ga0207645_10020334 Ga0207645_100203346 87
318 3300025907 Ga0207645_10235899 Ga0207645_102358991 87
319 3300025907 Ga0207645_11075922 Ga0207645_110759221 87
320 3300025910 Ga0207684_10005855 Ga0207684_100058553 87
321 3300025910 Ga0207684_10008684 Ga0207684_100086849 87
322 3300025910 Ga0207684_10010304 Ga0207684_100103048 87
323 3300025910 Ga0207684_10275555 Ga0207684_102755552 87
324 3300025910 Ga0207684_10276130 Ga0207684_102761303 87
325 3300025910 Ga0207684_10532999 Ga0207684_105329992 87
326 3300025910 Ga0207684_11133902 Ga0207684_111339022 87
327 3300025910 Ga0207684_11495319 Ga0207684_114953191 87
328 3300025911 Ga0207654_10005421 Ga0207654_100054216 87
329 3300025912 Ga0207707_10222483 Ga0207707_102224832 87
330 3300025912 Ga0207707_10250695 Ga0207707_102506953 87
331 3300025915 Ga0207693_11180142 Ga0207693_111801421 87
332 3300025917 Ga0207660_10201487 Ga0207660_102014872 87
333 3300025917 Ga0207660_10254706 Ga0207660_102547063 87
334 3300025917 Ga0207660_11542419 Ga0207660_115424191 87
335 3300025918 Ga0207662_10530460 Ga0207662_105304602 87
336 3300025921 Ga0207652_10694263 Ga0207652_106942632 87
337 3300025922 Ga0207646_10013468 Ga0207646_100134682 87
338 3300025922 Ga0207646_10035333 Ga0207646_100353339 87
339 3300025922 Ga0207646_10040190 Ga0207646_100401906 87
340 3300025922 Ga0207646_10200141 Ga0207646_102001413 87
341 3300025922 Ga0207646_10418139 Ga0207646_104181393 87
342 3300025923 Ga0207681_10046929 Ga0207681_100469294 87
343 3300025923 Ga0207681_10128253 Ga0207681_101282532 87
344 3300025923 Ga0207681_10155083 Ga0207681_101550833 87
345 3300025923 Ga0207681_10577404 Ga0207681_105774043 87
346 3300025923 Ga0207681_11851464 Ga0207681_118514642 87
347 3300025925 Ga0207650_11033709 Ga0207650_110337092 87
348 3300025925 Ga0207650_11514691 Ga0207650_115146911 87
349 3300025926 Ga0207659_10748188 Ga0207659_107481882 87
350 3300025927 Ga0207687_10925492 Ga0207687_109254922 87
351 3300025928 Ga0207700_10436397 Ga0207700_104363972 87
352 3300025932 Ga0207690_11353863 Ga0207690_113538631 87
353 3300025933 Ga0207706_10208039 Ga0207706_102080392 87
354 3300025934 Ga0207686_10013957 Ga0207686_100139576 87
355 3300025934 Ga0207686_10224378 Ga0207686_102243783 87
356 3300025934 Ga0207686_10280994 Ga0207686_102809943 87
357 3300025935 Ga0207709_10108167 Ga0207709_101081674 87
358 3300025935 Ga0207709_10228746 Ga0207709_102287463 87
359 3300025935 Ga0207709_10389543 Ga0207709_103895433 87
360 3300025935 Ga0207709_10506541 Ga0207709_105065412 87
361 3300025936 Ga0207670_10563130 Ga0207670_105631301 87
362 3300025938 Ga0207704_11047615 Ga0207704_110476152 87
363 3300025940 Ga0207691_10153052 Ga0207691_101530524 87
364 3300025941 Ga0207711_11141630 Ga0207711_111416302 87
365 3300025941 Ga0207711_11440490 Ga0207711_114404902 87
366 3300025942 Ga0207689_10005788 Ga0207689_1000578812 87
367 3300025942 Ga0207689_11659775 Ga0207689_116597751 87
368 3300025961 Ga0207712_10053557 Ga0207712_100535575 87
369 3300025961 Ga0207712_10140879 Ga0207712_101408792 87
370 3300025961 Ga0207712_10159670 Ga0207712_101596702 87
371 3300025961 Ga0207712_10279151 Ga0207712_102791513 87
372 3300025961 Ga0207712_10645150 Ga0207712_106451502 87
373 3300025972 Ga0207668_10346449 Ga0207668_103464493 87
374 3300025972 Ga0207668_10798823 Ga0207668_107988232 87
375 3300025972 Ga0207668_11502809 Ga0207668_115028092 87
376 3300025981 Ga0207640_10345781 Ga0207640_103457812 87
377 3300025986 Ga0207658_10839850 Ga0207658_108398502 87
378 3300026035 Ga0207703_11978594 Ga0207703_119785942 87
379 3300026075 Ga0207708_10182375 Ga0207708_101823752 87
380 3300026075 Ga0207708_10278963 Ga0207708_102789632 87
381 3300026088 Ga0207641_10339479 Ga0207641_103394793 87
382 3300026088 Ga0207641_10346946 Ga0207641_103469462 87
383 3300026089 Ga0207648_10111581 Ga0207648_101115812 87
384 3300026089 Ga0207648_10168444 Ga0207648_101684442 87
385 3300026095 Ga0207676_10277828 Ga0207676_102778283 87
386 3300026095 Ga0207676_10491658 Ga0207676_104916583 87
387 3300026095 Ga0207676_11675290 Ga0207676_116752902 87
388 3300026116 Ga0207674_10003985 Ga0207674_100039855 87
389 3300026118 Ga0207675_100079057 Ga0207675_1000790572 87
390 3300027364 Ga0209967_1003369 Ga0209967_10033692 87
391 3300027395 Ga0209996_1004082 Ga0209996_10040823 87
392 3300027424 Ga0209984_1004131 Ga0209984_10041312 87
393 3300027462 Ga0210000_1016756 Ga0210000_10167562 87
394 3300027471 Ga0209995_1004292 Ga0209995_10042923 87
395 3300027543 Ga0209999_1018189 Ga0209999_10181893 87
396 3300027614 Ga0209970_1009498 Ga0209970_10094982 87
397 3300027614 Ga0209970_1029527 Ga0209970_10295272 87
398 3300027617 Ga0210002_1003910 Ga0210002_10039102 87
399 3300027665 Ga0209983_1008624 Ga0209983_10086243 87
400 3300027671 Ga0209588_1009063 Ga0209588_10090632 87
401 3300027671 Ga0209588_1034418 Ga0209588_10344182 87
402 3300027682 Ga0209971_1000022 Ga0209971_100002263 87
403 3300027695 Ga0209966_1000381 Ga0209966_100038112 87
404 3300027717 Ga0209998_10000417 Ga0209998_100004175 87
405 3300027876 Ga0209974_10032570 Ga0209974_100325703 87
406 3300027876 Ga0209974_10091669 Ga0209974_100916693 87
407 3300027907 Ga0207428_10000334 Ga0207428_1000033440 87
408 3300027907 Ga0207428_10003707 Ga0207428_1000370710 87
409 3300027907 Ga0207428_10252268 Ga0207428_102522682 87
410 3300027907 Ga0207428_10258876 Ga0207428_102588762 87
411 3300027907 Ga0207428_11197071 Ga0207428_111970711 87
412 3300028380 Ga0268265_10011627 Ga0268265_100116274 87
413 3300028380 Ga0268265_10014251 Ga0268265_100142514 87
414 3300028380 Ga0268265_10110636 Ga0268265_101106364 87
415 3300028380 Ga0268265_10336381 Ga0268265_103363813 87
416 3300028380 Ga0268265_10375266 Ga0268265_103752663 87
417 3300028380 Ga0268265_10960067 Ga0268265_109600672 87
418 3300028380 Ga0268265_11314468 Ga0268265_113144682 87
419 3300028381 Ga0268264_10092170 Ga0268264_100921702 87
420 3300028381 Ga0268264_10726675 Ga0268264_107266752 87
421 3300028381 Ga0268264_11366259 Ga0268264_113662592 87
422 3300028381 Ga0268264_11984516 Ga0268264_119845161 87
423 3300028381 Ga0268264_12623935 Ga0268264_126239351 87
424 3300031731 Ga0307405_11740411 Ga0307405_117404111 87
425 3300032002 Ga0307416_100099173 Ga0307416_1000991732 87
426 3300032002 Ga0307416_101369295 Ga0307416_1013692952 87
427 3300034816 Ga0373930_0199245 Ga0373930_0199245_70_348 87
428 3300034818 Ga0373950_0058689 Ga0373950_0058689_14_292 87
429 3300034820 Ga0373959_0101273 Ga0373959_0101273_134_415 87
430 3300035084 Ga0373928_0103881 Ga0373928_0103881_312_590 87
431 3300035084 Ga0373928_0138349 Ga0373928_0138349_206_484 87
432 3300035088 Ga0373940_0046552 Ga0373940_0046552_182_460 87
433 3300035090 Ga0373949_0014274 Ga0373949_0014274_1431_1712 87
434 3300035091 Ga0373951_0114267 Ga0373951_0114267_245_523 87
435 3300035112 Ga0373932_0254567 Ga0373932_0254567_209_490 87
436 3300035114 Ga0373939_0367206 Ga0373939_0367206_48_326 87
437 3300035115 Ga0373941_0077058 Ga0373941_0077058_818_1099 87
438 3300035115 Ga0373941_0180823 Ga0373941_0180823_417_695 87
439 3300035121 Ga0373960_0157346 Ga0373960_0157346_84_362 87
440 3300035121 Ga0373960_0396750 Ga0373960_0396750_25_306 87
441 3300035170 Ga0373943_0473675 Ga0373943_0473675_415_693 87
442 3300035207 Ga0373942_0106305 Ga0373942_0106305_202_483 87
443 3300035207 Ga0373942_0276711 Ga0373942_0276711_134_412 87
444 3300035242 Ga0373962_0153474 Ga0373962_0153474_315_596 87
445 3300035242 Ga0373962_0401966 Ga0373962_0401966_197_487 87
446 3300035691 Ga0373931_0022578 Ga0373931_0022578_933_1214 87
447 3300035691 Ga0373931_0064110 Ga0373931_0064110_1600_1878 87
448 3300037418 Ga0395900_0856104 Ga0395900_0856104_380_658 87
449 3300037471 Ga0395905_1155018 Ga0395905_1155018_37_315 87
450 3300038443 Ga0395901_0983925 Ga0395901_0983925_14_292 87
451 3300038996 Ga0242420_162716 Ga0242420_162716_43_324 87
452 3300042000 Ga0439437_033186 Ga0439437_033186_329_607 87
453 3300042001 Ga0439441_006015 Ga0439441_006015_58_348 87
454 3300042001 Ga0439441_023539 Ga0439441_023539_786_1064 87
455 3300042009 Ga0439451_057951 Ga0439451_057951_85_363 87
456 3300042011 Ga0439454_073068 Ga0439454_073068_281_559 87
457 3300042437 Ga0439444_0093387 Ga0439444_0093387_379_657 87
458 3300042437 Ga0439444_0140604 Ga0439444_0140604_17_295 87
459 3300042438 Ga0439459_0105695 Ga0439459_0105695_158_436 87
460 3300042461 Ga0439460_0086567 Ga0439460_0086567_566_844 87
461 3300042876 Ga0451577_0112095 Ga0451577_0112095_1050_1373 87
462 3300042876 Ga0451577_0240130 Ga0451577_0240130_1250_1531 87
463 3300042876 Ga0451577_0283756 Ga0451577_0283756_385_663 87
464 3300042876 Ga0451577_0393628 Ga0451577_0393628_675_953 87
465 3300042993 Ga0439440_0061278 Ga0439440_0061278_454_732 87
466 3300044673 Ga0453683_0008282 Ga0453683_0008282_4406_4699 87
467 3300044673 Ga0453683_0042973 Ga0453683_0042973_1706_1984 87
468 3300044673 Ga0453683_0078976 Ga0453683_0078976_1371_1649 87
469 3300044673 Ga0453683_0882714 Ga0453683_0882714_203_481 87
470 3300044673 Ga0453683_0995951 Ga0453683_0995951_161_439 87
471 3300044694 Ga0466963_0656732 Ga0466963_0656732_352_648 87
472 3300044712 Ga0453684_0009737 Ga0453684_0009737_11428_11721 87
473 3300044712 Ga0453684_0119843 Ga0453684_0119843_1643_1921 87
474 3300044712 Ga0453684_0743060 Ga0453684_0743060_134_412 87
475 3300044842 Ga0466957_1126489 Ga0466957_1126489_194_490 87
476 3300045051 Ga0451576_0007782 Ga0451576_0007782_4932_5225 87
477 3300045051 Ga0451576_0013106 Ga0451576_0013106_3930_4208 87
478 3300045051 Ga0451576_0067557 Ga0451576_0067557_668_946 87
479 3300045051 Ga0451576_0133277 Ga0451576_0133277_836_1114 87
480 3300045051 Ga0451576_0234322 Ga0451576_0234322_516_794 87
481 3300045051 Ga0451576_0780427 Ga0451576_0780427_622_945 87
482 3300045051 Ga0451576_0938537 Ga0451576_0938537_118_396 87
483 3300045051 Ga0451576_1519706 Ga0451576_1519706_348_629 87
484 3300046472 Ga0495580_0030599 Ga0495580_0030599_1467_1748 87
485 3300046472 Ga0495580_0329194 Ga0495580_0329194_659_940 87
486 3300046523 Ga0495644_0100332 Ga0495644_0100332_558_836 87
487 3300046525 Ga0495663_0243705 Ga0495663_0243705_37_315 87
488 3300046528 Ga0495642_0553879 Ga0495642_0553879_209_499 87
489 3300046538 Ga0495609_0206011 Ga0495609_0206011_62_340 87
490 3300046539 Ga0495621_0235066 Ga0495621_0235066_157_435 87
491 3300046542 Ga0495597_0412538 Ga0495597_0412538_70_348 87
492 3300046558 Ga0495633_0090773 Ga0495633_0090773_121_399 87
493 3300046664 Ga0495659_0458365 Ga0495659_0458365_174_455 87
494 3300046674 Ga0495588_0289274 Ga0495588_0289274_340_618 87
495 3300046684 Ga0495669_0022644 Ga0495669_0022644_1725_2003 87
496 3300046690 Ga0495624_0677594 Ga0495624_0677594_201_479 87
497 3300046692 Ga0495671_0636806 Ga0495671_0636806_128_409 87
498 3300047318 Ga0495636_0673050 Ga0495636_0673050_202_480 87
499 3300047447 Ga0495685_283549 Ga0495685_283549_133_414 87
500 3300048904 Ga0496101_0986054 Ga0496101_0986054_169_447 87
501 3300048905 Ga0496102_0328587 Ga0496102_0328587_1151_1429 87
502 3300048906 Ga0496103_0277948 Ga0496103_0277948_500_778 87
503 3300048909 Ga0496106_1058957 Ga0496106_1058957_202_480 87
504 3300048909 Ga0496106_1089505 Ga0496106_1089505_320_598 87
505 3300048909 Ga0496106_1588671 Ga0496106_1588671_184_465 87
506 3300048910 Ga0496107_0569213 Ga0496107_0569213_331_609 87
507 3300048911 Ga0496108_1533356 Ga0496108_1533356_31_309 87
508 3300048912 Ga0496109_1266454 Ga0496109_1266454_41_319 87
509 3300049570 Ga0501033_0536988 Ga0501033_0536988_141_419 87
510 3300049570 Ga0501033_0780543 Ga0501033_0780543_58_336 87
511 3300049572 Ga0501036_0074087 Ga0501036_0074087_1462_1740 87
512 3300049572 Ga0501036_1024617 Ga0501036_1024617_23_301 87
513 3300049573 Ga0501037_0191881 Ga0501037_0191881_1083_1361 87
514 3300049574 Ga0501038_0111301 Ga0501038_0111301_742_1020 87
515 3300049574 Ga0501038_0186799 Ga0501038_0186799_724_1002 87
516 3300049574 Ga0501038_0540582 Ga0501038_0540582_250_528 87
517 3300049575 Ga0501039_0006892 Ga0501039_0006892_7147_7425 87
518 3300049575 Ga0501039_0368911 Ga0501039_0368911_782_1063 87
519 3300049575 Ga0501039_0675424 Ga0501039_0675424_66_344 87
520 3300049576 Ga0501040_0006661 Ga0501040_0006661_6692_6970 87
521 3300049576 Ga0501040_0013081 Ga0501040_0013081_284_562 87
522 3300049576 Ga0501040_0379173 Ga0501040_0379173_290_571 87
523 3300049576 Ga0501040_0498768 Ga0501040_0498768_248_526 87
524 3300049576 Ga0501040_1129413 Ga0501040_1129413_167_445 87
525 3300049577 Ga0501041_0001231 Ga0501041_0001231_8915_9193 87
526 3300049577 Ga0501041_0195192 Ga0501041_0195192_174_452 87
527 3300049578 Ga0501042_0028361 Ga0501042_0028361_1272_1550 87
528 3300049578 Ga0501042_0202762 Ga0501042_0202762_396_674 87
529 3300049579 Ga0501043_0179237 Ga0501043_0179237_1075_1353 87
530 3300049580 Ga0501046_0000315 Ga0501046_0000315_24534_24812 87
531 3300049580 Ga0501046_0386642 Ga0501046_0386642_129_407 87
532 3300049581 Ga0501047_0045532 Ga0501047_0045532_2183_2461 87
533 3300049582 Ga0501048_0006979 Ga0501048_0006979_1925_2203 87
534 3300049582 Ga0501048_0600344 Ga0501048_0600344_437_715 87
535 3300049583 Ga0501067_0070326 Ga0501067_0070326_723_1001 87
536 3300049583 Ga0501067_0274233 Ga0501067_0274233_431_712 87
537 3300049584 Ga0501068_0051132 Ga0501068_0051132_553_831 87
538 3300049584 Ga0501068_0076500 Ga0501068_0076500_922_1203 87
539 3300049584 Ga0501068_0375465 Ga0501068_0375465_617_895 87
540 3300049584 Ga0501068_0394061 Ga0501068_0394061_221_502 87
541 3300049585 Ga0501069_0060285 Ga0501069_0060285_895_1176 87
542 3300049585 Ga0501069_0730457 Ga0501069_0730457_69_347 87
543 3300049586 Ga0501070_1134793 Ga0501070_1134793_151_429 87
544 3300049587 Ga0501071_0014655 Ga0501071_0014655_5018_5296 87
545 3300049587 Ga0501071_0745631 Ga0501071_0745631_326_607 87
546 3300049587 Ga0501071_0922488 Ga0501071_0922488_254_532 87
547 3300049588 Ga0501072_0155167 Ga0501072_0155167_71_349 87
548 3300049588 Ga0501072_0207652 Ga0501072_0207652_260_541 87
549 3300049588 Ga0501072_0258953 Ga0501072_0258953_195_476 87
550 3300049588 Ga0501072_0411346 Ga0501072_0411346_108_386 87
551 3300049588 Ga0501072_0974974 Ga0501072_0974974_189_473 87
552 3300049589 Ga0501073_0342491 Ga0501073_0342491_68_346 87
553 3300049590 Ga0501074_0057129 Ga0501074_0057129_622_900 87
554 3300049591 Ga0501075_0251719 Ga0501075_0251719_880_1158 87
555 3300049591 Ga0501075_0318901 Ga0501075_0318901_55_336 87
556 3300049591 Ga0501075_0624792 Ga0501075_0624792_352_630 87
557 3300049591 Ga0501075_0645056 Ga0501075_0645056_476_754 87
558 3300049592 Ga0501076_0027978 Ga0501076_0027978_2662_2940 87
559 3300049592 Ga0501076_0219394 Ga0501076_0219394_1229_1510 87
560 3300049592 Ga0501076_0654284 Ga0501076_0654284_380_661 87
561 3300049592 Ga0501076_0698331 Ga0501076_0698331_418_696 87
562 3300049593 Ga0501077_0039242 Ga0501077_0039242_58_339 87
563 3300049593 Ga0501077_0138180 Ga0501077_0138180_448_726 87
564 3300049593 Ga0501077_0416262 Ga0501077_0416262_461_739 87
565 3300049593 Ga0501077_1062387 Ga0501077_1062387_40_318 87
566 3300049741 Ga0501079_0001543 Ga0501079_0001543_2253_2531 87
567 3300049741 Ga0501079_0030906 Ga0501079_0030906_3567_3845 87
568 3300049741 Ga0501079_1113726 Ga0501079_1113726_205_486 87
569 3300049742 Ga0501080_0106682 Ga0501080_0106682_1702_1980 87
570 3300049743 Ga0501081_0001911 Ga0501081_0001911_491_769 87
571 3300049743 Ga0501081_0002104 Ga0501081_0002104_5860_6138 87
572 3300049743 Ga0501081_0044034 Ga0501081_0044034_2132_2413 87
573 3300049743 Ga0501081_0349942 Ga0501081_0349942_180_458 87
574 3300049743 Ga0501081_0497878 Ga0501081_0497878_26_304 87
575 3300049744 Ga0501083_0010452 Ga0501083_0010452_5210_5488 87
576 3300049744 Ga0501083_0189269 Ga0501083_0189269_58_336 87
577 3300049823 Ga0501044_0958192 Ga0501044_0958192_140_421 87
578 3300049824 Ga0501045_0005719 Ga0501045_0005719_6072_6350 87
579 3300049824 Ga0501045_0146245 Ga0501045_0146245_655_933 87
580 3300049824 Ga0501045_0316033 Ga0501045_0316033_56_334 87
581 3300049824 Ga0501045_0604244 Ga0501045_0604244_439_720 87
582 3300050507 nmdc:mga05p37_100146_c1 nmdc:mga05p37_100146_c1_2892_3170 87
583 3300050507 nmdc:mga05p37_209963_c1 nmdc:mga05p37_209963_c1_1381_1662 87
584 3300050507 nmdc:mga05p37_254518_c1 nmdc:mga05p37_254518_c1_89_370 87
585 3300050507 nmdc:mga05p37_26712_c1 nmdc:mga05p37_26712_c1_4236_4514 87
586 3300050507 nmdc:mga05p37_29317_c1 nmdc:mga05p37_29317_c1_367_645 87
587 3300050507 nmdc:mga05p37_3399_c1 nmdc:mga05p37_3399_c1_3660_3938 87
588 3300050507 nmdc:mga05p37_466979_c1 nmdc:mga05p37_466979_c1_318_596 87
589 3300050507 nmdc:mga05p37_573743_c1 nmdc:mga05p37_573743_c1_615_896 87
590 3300050507 nmdc:mga05p37_655259_c1 nmdc:mga05p37_655259_c1_300_578 87
591 3300050507 nmdc:mga05p37_68544_c1 nmdc:mga05p37_68544_c1_4056_4337 87
592 3300050507 nmdc:mga05p37_68816_c1 nmdc:mga05p37_68816_c1_51_329 87
593 3300050507 nmdc:mga05p37_915019_c1 nmdc:mga05p37_915019_c1_366_644 87
594 3300050507 nmdc:mga05p37_923310_c1 nmdc:mga05p37_923310_c1_304_597 87
595 3300050508 nmdc:mga09592_153404_c1 nmdc:mga09592_153404_c1_1401_1682 87
596 3300050508 nmdc:mga09592_386611_c1 nmdc:mga09592_386611_c1_50_328 87
597 3300050508 nmdc:mga09592_64362_c1 nmdc:mga09592_64362_c1_137_415 87
598 3300050508 nmdc:mga09592_647013_c1 nmdc:mga09592_647013_c1_327_605 87
599 3300050508 nmdc:mga09592_656455_c1 nmdc:mga09592_656455_c1_77_358 87
600 3300050508 nmdc:mga09592_7508_c1 nmdc:mga09592_7508_c1_5329_5607 87
601 3300050509 nmdc:mga0qj67_226816_c1 nmdc:mga0qj67_226816_c1_542_820 87
602 3300050509 nmdc:mga0qj67_23209_c1 nmdc:mga0qj67_23209_c1_1009_1287 87
603 3300050509 nmdc:mga0qj67_6442_c1 nmdc:mga0qj67_6442_c1_5548_5826 87
604 3300050510 nmdc:mga06r32_1157_c1 nmdc:mga06r32_1157_c1_17187_17465 87
605 3300050510 nmdc:mga06r32_1745_c1 nmdc:mga06r32_1745_c1_6212_6496 87
606 3300050510 nmdc:mga06r32_177389_c1 nmdc:mga06r32_177389_c1_1101_1379 87
607 3300050510 nmdc:mga06r32_34138_c1 nmdc:mga06r32_34138_c1_4386_4664 87
608 3300050510 nmdc:mga06r32_976019_c1 nmdc:mga06r32_976019_c1_457_738 87
609 3300050511 nmdc:mga08y16_14265_c1 nmdc:mga08y16_14265_c1_5880_6173 87
610 3300050511 nmdc:mga08y16_1507587_c1 nmdc:mga08y16_1507587_c1_141_419 87
611 3300050511 nmdc:mga08y16_238373_c1 nmdc:mga08y16_238373_c1_430_711 87
612 3300050511 nmdc:mga08y16_58481_c1 nmdc:mga08y16_58481_c1_350_631 87
613 3300050511 nmdc:mga08y16_61282_c1 nmdc:mga08y16_61282_c1_2537_2815 87
614 3300050512 nmdc:mga0n895_1067894_c1 nmdc:mga0n895_1067894_c1_362_643 87
615 3300050512 nmdc:mga0n895_109198_c1 nmdc:mga0n895_109198_c1_574_867 87
616 3300050512 nmdc:mga0n895_1497331_c1 nmdc:mga0n895_1497331_c1_333_611 87
617 3300050512 nmdc:mga0n895_17794_c1 nmdc:mga0n895_17794_c1_1229_1507 87
618 3300050512 nmdc:mga0n895_187547_c1 nmdc:mga0n895_187547_c1_1517_1798 87
619 3300050512 nmdc:mga0n895_1986478_c1 nmdc:mga0n895_1986478_c1_66_347 87
620 3300050512 nmdc:mga0n895_2290_c1 nmdc:mga0n895_2290_c1_1075_1356 87
621 3300050512 nmdc:mga0n895_24428_c1 nmdc:mga0n895_24428_c1_2705_2986 87
622 3300050512 nmdc:mga0n895_32142_c1 nmdc:mga0n895_32142_c1_352_633 87
623 3300050512 nmdc:mga0n895_385999_c1 nmdc:mga0n895_385999_c1_1100_1378 87
624 3300050512 nmdc:mga0n895_440846_c1 nmdc:mga0n895_440846_c1_128_406 87
625 3300050512 nmdc:mga0n895_446121_c1 nmdc:mga0n895_446121_c1_1005_1283 87
626 3300050512 nmdc:mga0n895_459778_c1 nmdc:mga0n895_459778_c1_877_1155 87
627 3300050512 nmdc:mga0n895_49599_c1 nmdc:mga0n895_49599_c1_2387_2665 87
628 3300050512 nmdc:mga0n895_633742_c1 nmdc:mga0n895_633742_c1_626_907 87
629 3300050513 nmdc:mga0rr50_125813_c1 nmdc:mga0rr50_125813_c1_126_404 87
630 3300050513 nmdc:mga0rr50_265167_c1 nmdc:mga0rr50_265167_c1_49_330 87
631 3300050513 nmdc:mga0rr50_295210_c1 nmdc:mga0rr50_295210_c1_896_1174 87
632 3300050513 nmdc:mga0rr50_38577_c1 nmdc:mga0rr50_38577_c1_2619_2897 87
633 3300050513 nmdc:mga0rr50_40420_c1 nmdc:mga0rr50_40420_c1_139_417 87
634 3300050514 nmdc:mga08x19_14374_c1 nmdc:mga08x19_14374_c1_2529_2807 87
635 3300050514 nmdc:mga08x19_150308_c1 nmdc:mga08x19_150308_c1_207_485 87
636 3300050514 nmdc:mga08x19_3022_c1 nmdc:mga08x19_3022_c1_1801_2079 87
637 3300050514 nmdc:mga08x19_493295_c1 nmdc:mga08x19_493295_c1_269_547 87
638 3300050514 nmdc:mga08x19_775094_c1 nmdc:mga08x19_775094_c1_325_603 87
639 3300050515 nmdc:mga0a205_158882_c1 nmdc:mga0a205_158882_c1_1234_1512 87
640 3300050515 nmdc:mga0a205_17488_c1 nmdc:mga0a205_17488_c1_4927_5205 87
641 3300050515 nmdc:mga0a205_239834_c1 nmdc:mga0a205_239834_c1_397_678 87
642 3300050515 nmdc:mga0a205_24323_c1 nmdc:mga0a205_24323_c1_1646_1924 87
643 3300050515 nmdc:mga0a205_321362_c1 nmdc:mga0a205_321362_c1_340_618 87
644 3300050515 nmdc:mga0a205_372662_c1 nmdc:mga0a205_372662_c1_983_1267 87
645 3300050515 nmdc:mga0a205_3996_c1 nmdc:mga0a205_3996_c1_2534_2827 87
646 3300050515 nmdc:mga0a205_598922_c1 nmdc:mga0a205_598922_c1_593_874 87
647 3300050515 nmdc:mga0a205_71418_c1 nmdc:mga0a205_71418_c1_1959_2240 87
648 3300050515 nmdc:mga0a205_773_c1 nmdc:mga0a205_773_c1_1323_1604 87
649 3300050515 nmdc:mga0a205_970494_c1 nmdc:mga0a205_970494_c1_350_631 87
650 3300054114 Ga0501084_0001076 Ga0501084_0001076_2466_2744 87
651 3300054114 Ga0501084_0019092 Ga0501084_0019092_1292_1570 87
652 3300054114 Ga0501084_0242192 Ga0501084_0242192_13_294 87
653 3300054114 Ga0501084_0326232 Ga0501084_0326232_772_1053 87
654 3300054114 Ga0501084_0357538 Ga0501084_0357538_121_402 87
655 3300054114 Ga0501084_1760972 Ga0501084_1760972_21_302 87
656 3300060353 Ga0501082_0000482 Ga0501082_0000482_10387_10665 87
657 3300060353 Ga0501082_0305459 Ga0501082_0305459_390_668 87
658 3300060353 Ga0501082_0319427 Ga0501082_0319427_307_588 87
659 3300060353 Ga0501082_1390574 Ga0501082_1390574_70_351 87
660 3300061734 Ga0530510_0028243 Ga0530510_0028243_2239_2517 87

Feature Viewer

pLDDT pTM Quality
80.37 0.44 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map