F473268
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 659 | 373 | 636 | 136 |
Family's Representative Sequence
| Representative Sequence | 3300042007|Ga0439449_0004030|Ga0439449_0004030_5231_5674 |
| Length | 147 |
| Sequence | MNHAQHLQPDVAVAGMVVGLYVRDQDEAHDFYVGKLGFRVHTDARNGDYRWLTVQHPDQPSLQIGLFAPEQPMIDAATVQALREIVAKGAMPPLVLIVDDCRAAYAQMRARNVEFTQEPVERYGSIDANFRDPSGNGWKMIQSRKAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 2 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 8 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 9 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 10 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 11 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 12 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 13 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 14 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 15 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 16 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 17 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 18 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 19 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 20 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 21 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 22 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 23 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 26 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 27 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 28 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 30 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 36 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 39 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 67 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 81 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 85 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 86 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 87 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 88 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 102 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 130 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 206 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 207 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 208 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 209 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 216 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 217 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 219 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 220 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 224 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 225 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 227 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 241 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 242 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 243 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 244 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 245 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 249 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 252 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 253 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 254 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 255 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 256 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 257 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 258 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 259 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 260 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 261 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 264 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 265 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 319 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 320 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 321 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 322 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 323 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 324 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 325 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 326 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 327 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 328 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 331 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 332 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 343 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 344 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 349 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 350 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 351 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 352 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 353 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 356 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 357 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 359 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 360 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 361 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 362 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 366 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 367 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 368 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 369 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 370 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 371 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 372 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 373 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.51 |
| Metatranscriptomes | 0 |
| Isolates | 3.49 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.75 |
| Nodule | 0.91 |
| Rhizoplane | 1.67 |
| Rhizosphere | 77.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25155J39150_1000039 | 3300002704 | Bacteria | 91670 |
| 2 | JGI25156J39149_1000096 | 3300002705 | Bacteria | 64397 |
| 3 | JGI25154J39366_1000077 | 3300002738 | Bacteria | 90455 |
| 4 | JGI25157J39369_1000065 | 3300002741 | Bacteria | 98536 |
| 5 | JGI25151J46595_10000399 | 3300003187 | Bacteria | 45110 |
| 6 | JGI25151J46595_10001711 | 3300003187 | Bacteria | 14320 |
| 7 | JGI25406J46586_10045925 | 3300003203 | Bacteria | 1500 |
| 8 | JGI25153J46596_10063526 | 3300003215 | Bacteria | 989 |
| 9 | Ga0055532_1000005 | 3300003758 | Bacteria | 458107 |
| 10 | Ga0055535_1002690 | 3300003761 | Bacteria | 5779 |
| 11 | Ga0055529_1014460 | 3300003763 | Bacteria | 999 |
| 12 | Ga0055537_1000416 | 3300003773 | Bacteria | 27832 |
| 13 | Ga0055534_1000008 | 3300003784 | Bacteria | 211098 |
| 14 | Ga0055528_1000831 | 3300003790 | Bacteria | 21133 |
| 15 | Ga0055540_1007192 | 3300003792 | Bacteria | 4257 |
| 16 | Ga0055531_10002125 | 3300003794 | Bacteria | 13587 |
| 17 | Ga0065165_1000241 | 3300005262 | Bacteria | 93644 |
| 18 | Ga0065715_11107217 | 3300005293 | Bacteria | 518 |
| 19 | Ga0070658_10014457 | 3300005327 | Bacteria | 6334 |
| 20 | Ga0070658_10508521 | 3300005327 | Bacteria | 1041 |
| 21 | Ga0070676_10001625 | 3300005328 | Bacteria | 11423 |
| 22 | Ga0070676_10686776 | 3300005328 | Bacteria | 746 |
| 23 | Ga0070683_100033656 | 3300005329 | Bacteria | 4674 |
| 24 | Ga0070690_100073988 | 3300005330 | Bacteria | 2218 |
| 25 | Ga0070677_10104135 | 3300005333 | Bacteria | 1256 |
| 26 | Ga0070677_10447052 | 3300005333 | Bacteria | 691 |
| 27 | Ga0068869_100003838 | 3300005334 | Bacteria | 9265 |
| 28 | Ga0068869_100146296 | 3300005334 | Bacteria | 1829 |
| 29 | Ga0070666_10012977 | 3300005335 | Bacteria | 5274 |
| 30 | Ga0070666_10863369 | 3300005335 | Bacteria | 668 |
| 31 | Ga0070682_101036956 | 3300005337 | Bacteria | 683 |
| 32 | Ga0068868_100058614 | 3300005338 | Bacteria | 3044 |
| 33 | Ga0070689_100359388 | 3300005340 | Bacteria | 1223 |
| 34 | Ga0070687_100116721 | 3300005343 | Bacteria | 1520 |
| 35 | Ga0070661_100039453 | 3300005344 | Bacteria | 3440 |
| 36 | Ga0070668_100001082 | 3300005347 | Bacteria | 19162 |
| 37 | Ga0070668_100109201 | 3300005347 | Bacteria | 2201 |
| 38 | Ga0070669_100063828 | 3300005353 | Bacteria | 2711 |
| 39 | Ga0070675_100031694 | 3300005354 | Bacteria | 4275 |
| 40 | Ga0070671_100107502 | 3300005355 | Bacteria | 2342 |
| 41 | Ga0070671_100598091 | 3300005355 | Bacteria | 953 |
| 42 | Ga0070674_100012872 | 3300005356 | Bacteria | 5151 |
| 43 | Ga0070674_100294347 | 3300005356 | Bacteria | 1292 |
| 44 | Ga0070673_102243076 | 3300005364 | Bacteria | 519 |
| 45 | Ga0070659_100297161 | 3300005366 | Bacteria | 1346 |
| 46 | Ga0070659_100317670 | 3300005366 | Bacteria | 1301 |
| 47 | Ga0070659_101444575 | 3300005366 | Bacteria | 612 |
| 48 | Ga0070667_100007734 | 3300005367 | Bacteria | 8911 |
| 49 | Ga0070667_100008658 | 3300005367 | Bacteria | 8431 |
| 50 | Ga0070667_100114328 | 3300005367 | Bacteria | 2343 |
| 51 | Ga0070667_100751332 | 3300005367 | Bacteria | 904 |
| 52 | Ga0070710_10816837 | 3300005437 | Bacteria | 667 |
| 53 | Ga0070700_100143113 | 3300005441 | Bacteria | 1627 |
| 54 | Ga0070700_100371217 | 3300005441 | Bacteria | 1067 |
| 55 | Ga0070708_100730051 | 3300005445 | Bacteria | 932 |
| 56 | Ga0070708_101587597 | 3300005445 | Bacteria | 609 |
| 57 | Ga0070663_100101137 | 3300005455 | Bacteria | 2151 |
| 58 | Ga0070663_100318697 | 3300005455 | Bacteria | 1249 |
| 59 | Ga0070678_100016063 | 3300005456 | Bacteria | 4776 |
| 60 | Ga0070662_100017280 | 3300005457 | Bacteria | 4860 |
| 61 | Ga0070662_100062351 | 3300005457 | Bacteria | 2724 |
| 62 | Ga0068867_100004243 | 3300005459 | Bacteria | 10087 |
| 63 | Ga0068867_100034370 | 3300005459 | Bacteria | 3674 |
| 64 | Ga0068867_100719589 | 3300005459 | Bacteria | 883 |
| 65 | Ga0070706_101434306 | 3300005467 | Bacteria | 632 |
| 66 | Ga0070698_100396258 | 3300005471 | Bacteria | 1313 |
| 67 | Ga0070679_100904918 | 3300005530 | Bacteria | 826 |
| 68 | Ga0070684_100045385 | 3300005535 | Bacteria | 3806 |
| 69 | Ga0068853_100174084 | 3300005539 | Bacteria | 1948 |
| 70 | Ga0068853_100785640 | 3300005539 | Bacteria | 911 |
| 71 | Ga0068853_101293490 | 3300005539 | Bacteria | 705 |
| 72 | Ga0070672_100005393 | 3300005543 | Bacteria | 8469 |
| 73 | Ga0070693_100072588 | 3300005547 | Bacteria | 2030 |
| 74 | Ga0070665_100000195 | 3300005548 | Bacteria | 106493 |
| 75 | Ga0070665_100001353 | 3300005548 | Bacteria | 29032 |
| 76 | Ga0068855_100007328 | 3300005563 | Bacteria | 13367 |
| 77 | Ga0068855_100111340 | 3300005563 | Bacteria | 3143 |
| 78 | Ga0068855_100322998 | 3300005563 | Bacteria | 1706 |
| 79 | Ga0068855_101204898 | 3300005563 | Bacteria | 787 |
| 80 | Ga0068854_100541365 | 3300005578 | Bacteria | 986 |
| 81 | Ga0068852_100003658 | 3300005616 | Bacteria | 10771 |
| 82 | Ga0068852_100070517 | 3300005616 | Bacteria | 3066 |
| 83 | Ga0068859_100112090 | 3300005617 | Bacteria | 2791 |
| 84 | Ga0068859_100149643 | 3300005617 | Bacteria | 2410 |
| 85 | Ga0068859_100179980 | 3300005617 | Bacteria | 2197 |
| 86 | Ga0068859_100208753 | 3300005617 | Bacteria | 2039 |
| 87 | Ga0068859_100241760 | 3300005617 | Bacteria | 1895 |
| 88 | Ga0068864_100627839 | 3300005618 | Bacteria | 1045 |
| 89 | Ga0068864_100671027 | 3300005618 | Bacteria | 1011 |
| 90 | Ga0068866_10043241 | 3300005718 | Bacteria | 2247 |
| 91 | Ga0068866_10059287 | 3300005718 | Bacteria | 1980 |
| 92 | Ga0068861_100006162 | 3300005719 | Bacteria | 8158 |
| 93 | Ga0068861_100161157 | 3300005719 | Bacteria | 1850 |
| 94 | Ga0068861_100943535 | 3300005719 | Bacteria | 820 |
| 95 | Ga0068851_10023721 | 3300005834 | Bacteria | 3000 |
| 96 | Ga0068863_100004706 | 3300005841 | Bacteria | 13448 |
| 97 | Ga0068863_100019695 | 3300005841 | Bacteria | 6454 |
| 98 | Ga0068863_100250957 | 3300005841 | Bacteria | 1709 |
| 99 | Ga0068863_100924989 | 3300005841 | Bacteria | 873 |
| 100 | Ga0068860_100005570 | 3300005843 | Bacteria | 12734 |
| 101 | Ga0068860_100113682 | 3300005843 | Bacteria | 2588 |
| 102 | Ga0068860_100162228 | 3300005843 | Bacteria | 2155 |
| 103 | Ga0068860_100479607 | 3300005843 | Bacteria | 1240 |
| 104 | Ga0068862_100010381 | 3300005844 | Bacteria | 7685 |
| 105 | Ga0068862_100096765 | 3300005844 | Bacteria | 2577 |
| 106 | Ga0068862_101717683 | 3300005844 | Bacteria | 636 |
| 107 | Ga0081455_10150777 | 3300005937 | Bacteria | 1793 |
| 108 | Ga0081539_10000829 | 3300005985 | Bacteria | 59715 |
| 109 | Ga0070717_10375592 | 3300006028 | Bacteria | 1274 |
| 110 | Ga0075365_10040676 | 3300006038 | Bacteria | 3032 |
| 111 | Ga0075365_10093114 | 3300006038 | Bacteria | 2055 |
| 112 | Ga0075365_10263267 | 3300006038 | Bacteria | 1212 |
| 113 | Ga0075365_10439395 | 3300006038 | Bacteria | 921 |
| 114 | Ga0075368_10182323 | 3300006042 | Bacteria | 885 |
| 115 | Ga0075368_10243839 | 3300006042 | Bacteria | 767 |
| 116 | Ga0075363_100100511 | 3300006048 | Bacteria | 1600 |
| 117 | Ga0075363_100176715 | 3300006048 | Bacteria | 1213 |
| 118 | Ga0075363_100288502 | 3300006048 | Bacteria | 951 |
| 119 | Ga0075363_100601211 | 3300006048 | Bacteria | 659 |
| 120 | Ga0075364_10082145 | 3300006051 | Bacteria | 2131 |
| 121 | Ga0075364_10332621 | 3300006051 | Bacteria | 1035 |
| 122 | Ga0075362_10035047 | 3300006177 | Bacteria | 2190 |
| 123 | Ga0075362_10173451 | 3300006177 | Bacteria | 1043 |
| 124 | Ga0075367_10095592 | 3300006178 | Bacteria | 1812 |
| 125 | Ga0075367_10256315 | 3300006178 | Bacteria | 1097 |
| 126 | Ga0075369_10392010 | 3300006186 | Bacteria | 654 |
| 127 | Ga0075366_10013628 | 3300006195 | Bacteria | 4634 |
| 128 | Ga0075366_10069201 | 3300006195 | Bacteria | 2101 |
| 129 | Ga0075366_10860315 | 3300006195 | Bacteria | 564 |
| 130 | Ga0097621_100376330 | 3300006237 | Bacteria | 1268 |
| 131 | Ga0097621_100588835 | 3300006237 | Bacteria | 1016 |
| 132 | Ga0075370_10004353 | 3300006353 | Bacteria | 6864 |
| 133 | Ga0075370_10066987 | 3300006353 | Bacteria | 2049 |
| 134 | Ga0075370_10084255 | 3300006353 | Bacteria | 1830 |
| 135 | Ga0075370_10232002 | 3300006353 | Bacteria | 1092 |
| 136 | Ga0075370_10366118 | 3300006353 | Bacteria | 862 |
| 137 | Ga0075370_10418804 | 3300006353 | Bacteria | 805 |
| 138 | Ga0068865_100031766 | 3300006881 | Bacteria | 3523 |
| 139 | Ga0068865_100062565 | 3300006881 | Bacteria | 2613 |
| 140 | Ga0068865_100418907 | 3300006881 | Bacteria | 1101 |
| 141 | Ga0097620_100112089 | 3300006931 | Bacteria | 2791 |
| 142 | Ga0097620_100149629 | 3300006931 | Bacteria | 2410 |
| 143 | Ga0097620_100179981 | 3300006931 | Bacteria | 2197 |
| 144 | Ga0097620_100208757 | 3300006931 | Bacteria | 2039 |
| 145 | Ga0097620_100241759 | 3300006931 | Bacteria | 1895 |
| 146 | Ga0079104_1006554 | 3300006946 | Bacteria | 4378 |
| 147 | Ga0099826_10000171 | 3300006948 | Bacteria | 27420 |
| 148 | Ga0099794_10038868 | 3300007265 | Bacteria | 2255 |
| 149 | Ga0099795_10000001 | 3300007788 | Bacteria | 179944 |
| 150 | Ga0105240_11389130 | 3300009093 | Bacteria | 738 |
| 151 | Ga0111539_10726933 | 3300009094 | Bacteria | 1156 |
| 152 | Ga0105245_10097764 | 3300009098 | Bacteria | 2711 |
| 153 | Ga0105247_10003540 | 3300009101 | Bacteria | 10149 |
| 154 | Ga0105247_11645939 | 3300009101 | Bacteria | 529 |
| 155 | Ga0105243_10028062 | 3300009148 | Bacteria | 4318 |
| 156 | Ga0105243_10134712 | 3300009148 | Bacteria | 2100 |
| 157 | Ga0105243_10279803 | 3300009148 | Bacteria | 1502 |
| 158 | Ga0105242_10163965 | 3300009176 | Bacteria | 1948 |
| 159 | Ga0105248_10012920 | 3300009177 | Bacteria | 9205 |
| 160 | Ga0105248_10021265 | 3300009177 | Bacteria | 7189 |
| 161 | Ga0105238_10008209 | 3300009551 | Bacteria | 10445 |
| 162 | Ga0105249_10042383 | 3300009553 | Bacteria | 4139 |
| 163 | Ga0105249_10085916 | 3300009553 | Bacteria | 2933 |
| 164 | Ga0105249_10113763 | 3300009553 | Bacteria | 2561 |
| 165 | Ga0105249_10543612 | 3300009553 | Bacteria | 1211 |
| 166 | Ga0105249_11766092 | 3300009553 | Bacteria | 691 |
| 167 | Ga0099796_10000001 | 3300010159 | Bacteria | 107173 |
| 168 | Ga0105246_10000157 | 3300011119 | Bacteria | 32454 |
| 169 | Ga0105246_11661888 | 3300011119 | Bacteria | 606 |
| 170 | Ga0157371_10637262 | 3300013102 | Bacteria | 795 |
| 171 | Ga0157371_11222765 | 3300013102 | Bacteria | 579 |
| 172 | Ga0157370_10224367 | 3300013104 | Bacteria | 1740 |
| 173 | Ga0157370_10234533 | 3300013104 | Bacteria | 1698 |
| 174 | Ga0157370_10892328 | 3300013104 | Bacteria | 807 |
| 175 | Ga0157369_10119712 | 3300013105 | Bacteria | 2794 |
| 176 | Ga0157369_11075206 | 3300013105 | Bacteria | 823 |
| 177 | Ga0157374_10371446 | 3300013296 | Bacteria | 1423 |
| 178 | Ga0157374_10430566 | 3300013296 | Bacteria | 1319 |
| 179 | Ga0157374_10446667 | 3300013296 | Bacteria | 1294 |
| 180 | Ga0157378_10007853 | 3300013297 | Bacteria | 9312 |
| 181 | Ga0163162_10146196 | 3300013306 | Bacteria | 2480 |
| 182 | Ga0157372_10387163 | 3300013307 | Bacteria | 1629 |
| 183 | Ga0157372_10764561 | 3300013307 | Bacteria | 1123 |
| 184 | Ga0157375_10349763 | 3300013308 | Bacteria | 1644 |
| 185 | Ga0157375_10541888 | 3300013308 | Bacteria | 1326 |
| 186 | Ga0157375_10883614 | 3300013308 | Bacteria | 1039 |
| 187 | Ga0157375_11100103 | 3300013308 | Bacteria | 930 |
| 188 | Ga0163163_10482068 | 3300014325 | Bacteria | 1301 |
| 189 | Ga0157380_10005141 | 3300014326 | Bacteria | 9143 |
| 190 | Ga0157380_10023694 | 3300014326 | Bacteria | 4634 |
| 191 | Ga0157380_10083835 | 3300014326 | Bacteria | 2612 |
| 192 | Ga0157379_10039462 | 3300014968 | Bacteria | 4212 |
| 193 | Ga0157379_11018166 | 3300014968 | Bacteria | 790 |
| 194 | Ga0157376_10224722 | 3300014969 | Bacteria | 1741 |
| 195 | Ga0182006_1000077 | 3300015261 | Bacteria | 127377 |
| 196 | Ga0182007_10112623 | 3300015262 | Bacteria | 906 |
| 197 | Ga0182005_1009286 | 3300015265 | Bacteria | 2865 |
| 198 | Ga0163161_10033690 | 3300017792 | Bacteria | 3660 |
| 199 | Ga0163161_10040299 | 3300017792 | Bacteria | 3354 |
| 200 | Ga0163161_10405563 | 3300017792 | Bacteria | 1094 |
| 201 | Ga0163161_10650262 | 3300017792 | Bacteria | 873 |
| 202 | Ga0209435_100043 | 3300025206 | Bacteria | 102049 |
| 203 | Ga0209435_100050 | 3300025206 | Bacteria | 91356 |
| 204 | Ga0209147_100011 | 3300025229 | Bacteria | 702140 |
| 205 | Ga0209258_100401 | 3300025242 | Bacteria | 54149 |
| 206 | Ga0209646_1000161 | 3300025246 | Bacteria | 91356 |
| 207 | Ga0209026_1000173 | 3300025250 | Bacteria | 98585 |
| 208 | Ga0209759_1000169 | 3300025256 | Bacteria | 110110 |
| 209 | Ga0209565_1000042 | 3300025263 | Bacteria | 239712 |
| 210 | Ga0209455_1002552 | 3300025272 | Bacteria | 6961 |
| 211 | Ga0209673_1000071 | 3300025273 | Bacteria | 239966 |
| 212 | Ga0209673_1011136 | 3300025273 | Bacteria | 3730 |
| 213 | Ga0209130_1003792 | 3300025284 | Bacteria | 6141 |
| 214 | Ga0209675_1000041 | 3300025291 | Bacteria | 239712 |
| 215 | Ga0209675_1000811 | 3300025291 | Bacteria | 20589 |
| 216 | Ga0209676_1006071 | 3300025292 | Bacteria | 6081 |
| 217 | Ga0209025_1000552 | 3300025294 | Bacteria | 69909 |
| 218 | Ga0209564_1045121 | 3300025295 | Bacteria | 1137 |
| 219 | Ga0209758_1002239 | 3300025297 | Bacteria | 20070 |
| 220 | Ga0209050_1000221 | 3300025298 | Bacteria | 126843 |
| 221 | Ga0209050_1057544 | 3300025298 | Bacteria | 939 |
| 222 | Ga0209256_1033506 | 3300025299 | Bacteria | 1381 |
| 223 | Ga0209051_1000059 | 3300025303 | Bacteria | 260307 |
| 224 | Ga0209051_1006159 | 3300025303 | Bacteria | 6815 |
| 225 | Ga0209051_1089366 | 3300025303 | Bacteria | 861 |
| 226 | Ga0209257_1000022 | 3300025304 | Bacteria | 765258 |
| 227 | Ga0209257_1000302 | 3300025304 | Bacteria | 108038 |
| 228 | Ga0209257_1004206 | 3300025304 | Bacteria | 11418 |
| 229 | Ga0207697_10024462 | 3300025315 | Bacteria | 2472 |
| 230 | Ga0207656_10219007 | 3300025321 | Bacteria | 924 |
| 231 | Ga0207682_10359853 | 3300025893 | Bacteria | 686 |
| 232 | Ga0207642_10134585 | 3300025899 | Bacteria | 1294 |
| 233 | Ga0207710_10003190 | 3300025900 | Bacteria | 7337 |
| 234 | Ga0207680_10046357 | 3300025903 | Bacteria | 2569 |
| 235 | Ga0207680_10610101 | 3300025903 | Bacteria | 781 |
| 236 | Ga0207645_10028998 | 3300025907 | Bacteria | 3568 |
| 237 | Ga0207705_10036317 | 3300025909 | Bacteria | 3526 |
| 238 | Ga0207684_11266598 | 3300025910 | Bacteria | 608 |
| 239 | Ga0207662_10020646 | 3300025918 | Bacteria | 3760 |
| 240 | Ga0207657_10708875 | 3300025919 | Bacteria | 781 |
| 241 | Ga0207649_10118467 | 3300025920 | Bacteria | 1781 |
| 242 | Ga0207649_10193851 | 3300025920 | Bacteria | 1431 |
| 243 | Ga0207646_11549483 | 3300025922 | Bacteria | 573 |
| 244 | Ga0207681_10022206 | 3300025923 | Bacteria | 4044 |
| 245 | Ga0207681_10665180 | 3300025923 | Bacteria | 864 |
| 246 | Ga0207694_10004840 | 3300025924 | Bacteria | 10452 |
| 247 | Ga0207650_11500607 | 3300025925 | Bacteria | 573 |
| 248 | Ga0207659_10063895 | 3300025926 | Bacteria | 2662 |
| 249 | Ga0207659_10527232 | 3300025926 | Bacteria | 1002 |
| 250 | Ga0207664_10132789 | 3300025929 | Bacteria | 2097 |
| 251 | Ga0207644_10657057 | 3300025931 | Bacteria | 873 |
| 252 | Ga0207644_10840001 | 3300025931 | Bacteria | 769 |
| 253 | Ga0207644_11596438 | 3300025931 | Bacteria | 547 |
| 254 | Ga0207690_10124602 | 3300025932 | Bacteria | 1877 |
| 255 | Ga0207690_10798893 | 3300025932 | Bacteria | 780 |
| 256 | Ga0207706_10002140 | 3300025933 | Bacteria | 19325 |
| 257 | Ga0207706_10017021 | 3300025933 | Bacteria | 6559 |
| 258 | Ga0207686_10050905 | 3300025934 | Bacteria | 2578 |
| 259 | Ga0207686_10533978 | 3300025934 | Bacteria | 915 |
| 260 | Ga0207709_10019065 | 3300025935 | Bacteria | 3850 |
| 261 | Ga0207709_10119189 | 3300025935 | Bacteria | 1779 |
| 262 | Ga0207709_10149996 | 3300025935 | Bacteria | 1613 |
| 263 | Ga0207670_10568791 | 3300025936 | Bacteria | 928 |
| 264 | Ga0207669_10010674 | 3300025937 | Bacteria | 4431 |
| 265 | Ga0207669_10214708 | 3300025937 | Bacteria | 1407 |
| 266 | Ga0207669_10967535 | 3300025937 | Bacteria | 714 |
| 267 | Ga0207704_10034967 | 3300025938 | Bacteria | 2874 |
| 268 | Ga0207704_10044324 | 3300025938 | Bacteria | 2634 |
| 269 | Ga0207704_10137074 | 3300025938 | Bacteria | 1705 |
| 270 | Ga0207691_10018902 | 3300025940 | Bacteria | 6527 |
| 271 | Ga0207711_10029322 | 3300025941 | Bacteria | 4640 |
| 272 | Ga0207711_10074050 | 3300025941 | Bacteria | 2961 |
| 273 | Ga0207689_10007114 | 3300025942 | Bacteria | 9837 |
| 274 | Ga0207661_10197897 | 3300025944 | Bacteria | 1765 |
| 275 | Ga0207667_10005245 | 3300025949 | Bacteria | 15813 |
| 276 | Ga0207667_10066225 | 3300025949 | Bacteria | 3766 |
| 277 | Ga0207667_10246777 | 3300025949 | Bacteria | 1827 |
| 278 | Ga0207651_10098316 | 3300025960 | Bacteria | 2164 |
| 279 | Ga0207651_10149006 | 3300025960 | Bacteria | 1819 |
| 280 | Ga0207651_10370334 | 3300025960 | Bacteria | 1212 |
| 281 | Ga0207712_10113835 | 3300025961 | Bacteria | 2034 |
| 282 | Ga0207712_10148777 | 3300025961 | Bacteria | 1806 |
| 283 | Ga0207668_10000003 | 3300025972 | Bacteria | 206959 |
| 284 | Ga0207668_10034578 | 3300025972 | Bacteria | 3357 |
| 285 | Ga0207668_10594638 | 3300025972 | Bacteria | 963 |
| 286 | Ga0207658_10005552 | 3300025986 | Bacteria | 8637 |
| 287 | Ga0207658_10011119 | 3300025986 | Bacteria | 6130 |
| 288 | Ga0207658_10019554 | 3300025986 | Bacteria | 4684 |
| 289 | Ga0207658_10662281 | 3300025986 | Bacteria | 941 |
| 290 | Ga0207658_10742530 | 3300025986 | Bacteria | 888 |
| 291 | Ga0207677_12094598 | 3300026023 | Bacteria | 526 |
| 292 | Ga0207703_10094551 | 3300026035 | Bacteria | 2520 |
| 293 | Ga0207703_10565673 | 3300026035 | Bacteria | 1073 |
| 294 | Ga0207639_10099092 | 3300026041 | Bacteria | 2351 |
| 295 | Ga0207639_10877122 | 3300026041 | Bacteria | 838 |
| 296 | Ga0207678_10070271 | 3300026067 | Bacteria | 3002 |
| 297 | Ga0207678_10095432 | 3300026067 | Bacteria | 2542 |
| 298 | Ga0207678_10345080 | 3300026067 | Bacteria | 1283 |
| 299 | Ga0207708_10042217 | 3300026075 | Bacteria | 3477 |
| 300 | Ga0207708_10062994 | 3300026075 | Bacteria | 2833 |
| 301 | Ga0207708_10326352 | 3300026075 | Bacteria | 1254 |
| 302 | Ga0207702_10426720 | 3300026078 | Bacteria | 1283 |
| 303 | Ga0207641_10010784 | 3300026088 | Bacteria | 7491 |
| 304 | Ga0207641_10235352 | 3300026088 | Bacteria | 1704 |
| 305 | Ga0207648_10000393 | 3300026089 | Bacteria | 48485 |
| 306 | Ga0207648_10006515 | 3300026089 | Bacteria | 11592 |
| 307 | Ga0207648_11132503 | 3300026089 | Bacteria | 734 |
| 308 | Ga0207676_10504291 | 3300026095 | Bacteria | 1149 |
| 309 | Ga0207676_11324686 | 3300026095 | Bacteria | 715 |
| 310 | Ga0207674_11035860 | 3300026116 | Bacteria | 790 |
| 311 | Ga0207674_11371259 | 3300026116 | Bacteria | 676 |
| 312 | Ga0207675_100001089 | 3300026118 | Bacteria | 26890 |
| 313 | Ga0207675_100001455 | 3300026118 | Bacteria | 23732 |
| 314 | Ga0207675_100013845 | 3300026118 | Bacteria | 7521 |
| 315 | Ga0207675_100590230 | 3300026118 | Bacteria | 1113 |
| 316 | Ga0207675_101700611 | 3300026118 | Bacteria | 651 |
| 317 | Ga0207683_10378464 | 3300026121 | Bacteria | 1301 |
| 318 | Ga0207683_10427665 | 3300026121 | Bacteria | 1220 |
| 319 | Ga0207683_11209825 | 3300026121 | Bacteria | 700 |
| 320 | Ga0207698_10574167 | 3300026142 | Bacteria | 1108 |
| 321 | Ga0207698_10602228 | 3300026142 | Bacteria | 1083 |
| 322 | Ga0207698_11747171 | 3300026142 | Bacteria | 637 |
| 323 | Ga0209281_1008261 | 3300027111 | Bacteria | 2541 |
| 324 | Ga0209282_1021535 | 3300027666 | Bacteria | 4073 |
| 325 | Ga0265356_1002639 | 3300028017 | Bacteria | 2351 |
| 326 | Ga0268266_10000221 | 3300028379 | Bacteria | 99332 |
| 327 | Ga0268266_10002760 | 3300028379 | Bacteria | 18356 |
| 328 | Ga0268265_10011023 | 3300028380 | Bacteria | 6106 |
| 329 | Ga0268265_10386407 | 3300028380 | Bacteria | 1289 |
| 330 | Ga0268265_10675092 | 3300028380 | Bacteria | 996 |
| 331 | Ga0268264_10022853 | 3300028381 | Bacteria | 5102 |
| 332 | Ga0268264_10072710 | 3300028381 | Bacteria | 2916 |
| 333 | Ga0268264_10306343 | 3300028381 | Bacteria | 1497 |
| 334 | Ga0268264_10384630 | 3300028381 | Bacteria | 1344 |
| 335 | Ga0268264_10905925 | 3300028381 | Bacteria | 885 |
| 336 | Ga0316182_1019103 | 3300030745 | Bacteria | 1722 |
| 337 | Ga0316182_1442232 | 3300030745 | Bacteria | 620 |
| 338 | Ga0307513_10004600 | 3300031456 | Bacteria | 18380 |
| 339 | Ga0307513_10011671 | 3300031456 | Bacteria | 10901 |
| 340 | Ga0307513_10224612 | 3300031456 | Bacteria | 1696 |
| 341 | Ga0307408_100038272 | 3300031548 | Bacteria | 3383 |
| 342 | Ga0307408_100195605 | 3300031548 | Bacteria | 1633 |
| 343 | Ga0307408_100337959 | 3300031548 | Bacteria | 1274 |
| 344 | Ga0307514_10238935 | 3300031649 | Bacteria | 1091 |
| 345 | Ga0316575_10001658 | 3300031665 | Bacteria | 7284 |
| 346 | Ga0265314_10004277 | 3300031711 | Bacteria | 13355 |
| 347 | Ga0307516_10134911 | 3300031730 | Bacteria | 2244 |
| 348 | Ga0307405_10165271 | 3300031731 | Bacteria | 1572 |
| 349 | Ga0307405_10914650 | 3300031731 | Bacteria | 743 |
| 350 | Ga0307413_10429560 | 3300031824 | Bacteria | 1043 |
| 351 | Ga0307410_10269804 | 3300031852 | Bacteria | 1331 |
| 352 | Ga0307410_10620628 | 3300031852 | Bacteria | 904 |
| 353 | Ga0307406_10185801 | 3300031901 | Unclassified | 1517 |
| 354 | Ga0307407_10325510 | 3300031903 | Bacteria | 1080 |
| 355 | Ga0307412_10070535 | 3300031911 | Bacteria | 2382 |
| 356 | Ga0307412_11170510 | 3300031911 | Bacteria | 687 |
| 357 | Ga0307412_11879001 | 3300031911 | Bacteria | 552 |
| 358 | Ga0307409_100038783 | 3300031995 | Bacteria | 3527 |
| 359 | Ga0307416_100318759 | 3300032002 | Bacteria | 1555 |
| 360 | Ga0307416_102718447 | 3300032002 | Bacteria | 591 |
| 361 | Ga0307414_10044936 | 3300032004 | Bacteria | 3021 |
| 362 | Ga0307414_10204644 | 3300032004 | Bacteria | 1608 |
| 363 | Ga0307414_10449744 | 3300032004 | Bacteria | 1129 |
| 364 | Ga0307411_10595240 | 3300032005 | Bacteria | 950 |
| 365 | Ga0307415_100853585 | 3300032126 | Bacteria | 836 |
| 366 | Ga0307415_101436976 | 3300032126 | Bacteria | 658 |
| 367 | Ga0307510_10017376 | 3300033180 | Bacteria | 8484 |
| 368 | Ga0307510_10339915 | 3300033180 | Bacteria | 953 |
| 369 | Ga0373953_0413203 | 3300035117 | Bacteria | 594 |
| 370 | Ga0373943_0088993 | 3300035170 | Bacteria | 1596 |
| 371 | Ga0373943_0455734 | 3300035170 | Bacteria | 744 |
| 372 | Ga0373946_0035536 | 3300035171 | Bacteria | 2017 |
| 373 | Ga0373946_0739299 | 3300035171 | Bacteria | 516 |
| 374 | Ga0373955_0023276 | 3300035172 | Bacteria | 3154 |
| 375 | Ga0373955_0131344 | 3300035172 | Bacteria | 1462 |
| 376 | Ga0373931_0613273 | 3300035691 | Bacteria | 712 |
| 377 | Ga0373935_0263588 | 3300035692 | Bacteria | 1209 |
| 378 | Ga0373935_0486260 | 3300035692 | Bacteria | 895 |
| 379 | Ga0373927_0319339 | 3300035695 | Bacteria | 1023 |
| 380 | Ga0373947_0368014 | 3300035725 | Bacteria | 966 |
| 381 | Ga0373937_0343073 | 3300036401 | Bacteria | 1414 |
| 382 | Ga0373937_0424664 | 3300036401 | Bacteria | 1262 |
| 383 | Ga0373937_1024341 | 3300036401 | Bacteria | 774 |
| 384 | Ga0373937_1161019 | 3300036401 | Bacteria | 721 |
| 385 | Ga0373925_0286654 | 3300037068 | Bacteria | 1327 |
| 386 | Ga0373925_0607310 | 3300037068 | Bacteria | 901 |
| 387 | Ga0373925_1277284 | 3300037068 | Bacteria | 603 |
| 388 | Ga0395899_0003122 | 3300037312 | Bacteria | 13195 |
| 389 | Ga0395899_0226277 | 3300037312 | Bacteria | 1293 |
| 390 | Ga0395900_0000127 | 3300037418 | Bacteria | 127554 |
| 391 | Ga0395900_0172671 | 3300037418 | Bacteria | 2200 |
| 392 | Ga0395900_0192414 | 3300037418 | Bacteria | 2068 |
| 393 | Ga0395900_0328240 | 3300037418 | Bacteria | 1508 |
| 394 | Ga0395900_1079469 | 3300037418 | Bacteria | 720 |
| 395 | Ga0395900_1381856 | 3300037418 | Bacteria | 617 |
| 396 | Ga0395898_0023452 | 3300037466 | Bacteria | 6235 |
| 397 | Ga0395898_0222658 | 3300037466 | Bacteria | 1799 |
| 398 | Ga0395898_1268325 | 3300037466 | Bacteria | 667 |
| 399 | Ga0395905_0003756 | 3300037471 | Bacteria | 16085 |
| 400 | Ga0395905_0004727 | 3300037471 | Bacteria | 14066 |
| 401 | Ga0395905_0035340 | 3300037471 | Bacteria | 4692 |
| 402 | Ga0395905_0485846 | 3300037471 | Bacteria | 1134 |
| 403 | Ga0395905_0492727 | 3300037471 | Bacteria | 1125 |
| 404 | Ga0395905_0607564 | 3300037471 | Bacteria | 995 |
| 405 | Ga0395905_1444287 | 3300037471 | Bacteria | 592 |
| 406 | Ga0395901_0000098 | 3300038443 | Bacteria | 117656 |
| 407 | Ga0395901_0125666 | 3300038443 | Bacteria | 2695 |
| 408 | Ga0395901_0328642 | 3300038443 | Bacteria | 1581 |
| 409 | Ga0395901_1120490 | 3300038443 | Bacteria | 756 |
| 410 | Ga0395901_1668548 | 3300038443 | Bacteria | 589 |
| 411 | Ga0436365_0185961 | 3300039437 | Bacteria | 849 |
| 412 | Ga0436365_0936602 | 3300039437 | Bacteria | 6401 |
| 413 | Ga0436361_0945996 | 3300039447 | Bacteria | 3339 |
| 414 | Ga0436362_0689394 | 3300039453 | Bacteria | 1074 |
| 415 | Ga0439436_0073494 | 3300041404 | Bacteria | 952 |
| 416 | Ga0439453_0006788 | 3300041408 | Bacteria | 1796 |
| 417 | Ga0439465_0182310 | 3300041413 | Bacteria | 760 |
| 418 | Ga0439465_0195669 | 3300041413 | Bacteria | 735 |
| 419 | Ga0439465_0397657 | 3300041413 | Bacteria | 524 |
| 420 | Ga0451793_1783914 | 3300041452 | Bacteria | 924 |
| 421 | Ga0451853_1343388 | 3300041512 | Bacteria | 602 |
| 422 | Ga0439449_0004030 | 3300042007 | Bacteria | 5686 |
| 423 | Ga0439449_0015730 | 3300042007 | Bacteria | 2844 |
| 424 | Ga0439449_0063176 | 3300042007 | Bacteria | 1366 |
| 425 | Ga0439455_0117585 | 3300042012 | Bacteria | 743 |
| 426 | Ga0439457_112169 | 3300042014 | Bacteria | 641 |
| 427 | Ga0439462_0102870 | 3300042015 | Bacteria | 788 |
| 428 | Ga0439434_0063959 | 3300042435 | Bacteria | 1153 |
| 429 | Ga0466969_0030177 | 3300044656 | Bacteria | 2763 |
| 430 | Ga0466969_0032926 | 3300044656 | Bacteria | 2634 |
| 431 | Ga0466969_0051825 | 3300044656 | Bacteria | 2018 |
| 432 | Ga0466966_0002396 | 3300044684 | Bacteria | 12243 |
| 433 | Ga0466966_0003316 | 3300044684 | Bacteria | 10609 |
| 434 | Ga0466966_0147177 | 3300044684 | Bacteria | 1438 |
| 435 | Ga0466961_0031753 | 3300044693 | Bacteria | 3395 |
| 436 | Ga0466961_0033166 | 3300044693 | Bacteria | 3318 |
| 437 | Ga0466961_0080610 | 3300044693 | Bacteria | 2060 |
| 438 | Ga0466963_0016396 | 3300044694 | Bacteria | 4608 |
| 439 | Ga0466963_0149066 | 3300044694 | Bacteria | 1624 |
| 440 | Ga0466964_0012873 | 3300044706 | Bacteria | 3169 |
| 441 | Ga0466964_0303751 | 3300044706 | Bacteria | 805 |
| 442 | Ga0453684_0049083 | 3300044712 | Bacteria | 5570 |
| 443 | Ga0466971_0036994 | 3300044719 | Bacteria | 2188 |
| 444 | Ga0466971_0095916 | 3300044719 | Bacteria | 1360 |
| 445 | Ga0466968_0014677 | 3300044735 | Bacteria | 3098 |
| 446 | Ga0466968_0031665 | 3300044735 | Bacteria | 2195 |
| 447 | Ga0466957_0004514 | 3300044842 | Bacteria | 7768 |
| 448 | Ga0466957_0059800 | 3300044842 | Bacteria | 2336 |
| 449 | Ga0466960_0009898 | 3300044901 | Bacteria | 3944 |
| 450 | Ga0466959_0004778 | 3300045049 | Bacteria | 9136 |
| 451 | Ga0466959_0039343 | 3300045049 | Bacteria | 3494 |
| 452 | Ga0466959_0098199 | 3300045049 | Bacteria | 2098 |
| 453 | Ga0466959_0251953 | 3300045049 | Unclassified | 1217 |
| 454 | Ga0466959_0392765 | 3300045049 | Bacteria | 943 |
| 455 | Ga0466958_0027877 | 3300045836 | Bacteria | 3344 |
| 456 | Ga0466958_0042248 | 3300045836 | Bacteria | 2745 |
| 457 | Ga0466967_0134351 | 3300045976 | Bacteria | 2300 |
| 458 | Ga0466967_0350179 | 3300045976 | Bacteria | 1429 |
| 459 | Ga0466967_0453521 | 3300045976 | Bacteria | 1253 |
| 460 | Ga0466967_1739673 | 3300045976 | Bacteria | 621 |
| 461 | Ga0495617_000337 | 3300046452 | Bacteria | 25904 |
| 462 | Ga0495617_255395 | 3300046452 | Bacteria | 539 |
| 463 | Ga0495627_016747 | 3300046453 | Bacteria | 2504 |
| 464 | Ga0495629_0712689 | 3300046459 | Bacteria | 666 |
| 465 | Ga0495638_0000430 | 3300046460 | Bacteria | 50741 |
| 466 | Ga0495638_0012229 | 3300046460 | Bacteria | 5892 |
| 467 | Ga0495651_0953672 | 3300046462 | Bacteria | 522 |
| 468 | Ga0495585_0000028 | 3300046492 | Bacteria | 146662 |
| 469 | Ga0495607_0000438 | 3300046501 | Bacteria | 42080 |
| 470 | Ga0495607_0025777 | 3300046501 | Bacteria | 3654 |
| 471 | Ga0495583_0025518 | 3300046506 | Bacteria | 2950 |
| 472 | Ga0495606_0049161 | 3300046507 | Bacteria | 2768 |
| 473 | Ga0495608_0094644 | 3300046511 | Bacteria | 1930 |
| 474 | Ga0495608_0489218 | 3300046511 | Bacteria | 746 |
| 475 | Ga0495610_0192976 | 3300046512 | Bacteria | 839 |
| 476 | Ga0495616_0357026 | 3300046513 | Bacteria | 607 |
| 477 | Ga0495620_0323856 | 3300046515 | Unclassified | 585 |
| 478 | Ga0495628_0487134 | 3300046516 | Bacteria | 892 |
| 479 | Ga0495630_0341975 | 3300046517 | Bacteria | 1145 |
| 480 | Ga0495631_0004267 | 3300046518 | Bacteria | 7643 |
| 481 | Ga0495632_0096863 | 3300046519 | Bacteria | 1393 |
| 482 | Ga0495637_0005084 | 3300046520 | Bacteria | 6746 |
| 483 | Ga0495648_0002326 | 3300046524 | Bacteria | 17687 |
| 484 | Ga0495663_0001265 | 3300046525 | Bacteria | 8032 |
| 485 | Ga0495663_0102972 | 3300046525 | Bacteria | 942 |
| 486 | Ga0495640_0477513 | 3300046533 | Bacteria | 760 |
| 487 | Ga0495609_0185436 | 3300046538 | Bacteria | 874 |
| 488 | Ga0495621_0089935 | 3300046539 | Bacteria | 1156 |
| 489 | Ga0495633_0075800 | 3300046558 | Bacteria | 1566 |
| 490 | Ga0495656_0003485 | 3300046615 | Bacteria | 5322 |
| 491 | Ga0495656_0169154 | 3300046615 | Bacteria | 1067 |
| 492 | Ga0495668_0005604 | 3300046616 | Bacteria | 8446 |
| 493 | Ga0495668_0153508 | 3300046616 | Bacteria | 1261 |
| 494 | Ga0495668_0195133 | 3300046616 | Bacteria | 1109 |
| 495 | Ga0495634_0398660 | 3300046642 | Bacteria | 818 |
| 496 | Ga0495611_0017877 | 3300046648 | Bacteria | 3037 |
| 497 | Ga0495625_0263704 | 3300046660 | Bacteria | 1114 |
| 498 | Ga0495659_0040301 | 3300046664 | Bacteria | 1664 |
| 499 | Ga0495661_0010391 | 3300046665 | Bacteria | 6352 |
| 500 | Ga0495661_0448951 | 3300046665 | Bacteria | 621 |
| 501 | Ga0495657_0220672 | 3300046675 | Bacteria | 1149 |
| 502 | Ga0495599_0094041 | 3300046678 | Bacteria | 1870 |
| 503 | Ga0495623_0515199 | 3300046679 | Bacteria | 630 |
| 504 | Ga0495647_0168550 | 3300046681 | Bacteria | 947 |
| 505 | Ga0495658_0040275 | 3300046683 | Bacteria | 2597 |
| 506 | Ga0495669_0005214 | 3300046684 | Bacteria | 5409 |
| 507 | Ga0495670_0002216 | 3300046691 | Bacteria | 9601 |
| 508 | Ga0495670_0172975 | 3300046691 | Bacteria | 1138 |
| 509 | Ga0495671_0003326 | 3300046692 | Bacteria | 9929 |
| 510 | Ga0495671_0137071 | 3300046692 | Bacteria | 1193 |
| 511 | Ga0495671_0409018 | 3300046692 | Bacteria | 649 |
| 512 | Ga0495589_0000523 | 3300046794 | Bacteria | 26993 |
| 513 | Ga0495589_0200348 | 3300046794 | Bacteria | 942 |
| 514 | Ga0495660_0000076 | 3300046810 | Bacteria | 105580 |
| 515 | Ga0495660_0000567 | 3300046810 | Bacteria | 29946 |
| 516 | Ga0495636_0002043 | 3300047318 | Bacteria | 7741 |
| 517 | Ga0495636_0003291 | 3300047318 | Bacteria | 6258 |
| 518 | Ga0495636_0022435 | 3300047318 | Bacteria | 2551 |
| 519 | Ga0495636_0124573 | 3300047318 | Bacteria | 1142 |
| 520 | Ga0495636_0170311 | 3300047318 | Bacteria | 984 |
| 521 | Ga0495636_0349632 | 3300047318 | Bacteria | 698 |
| 522 | Ga0495674_0396836 | 3300047319 | Bacteria | 1114 |
| 523 | Ga0495672_0100769 | 3300047320 | Bacteria | 1567 |
| 524 | Ga0495680_0063976 | 3300047322 | Bacteria | 2823 |
| 525 | Ga0495680_0749047 | 3300047322 | Bacteria | 642 |
| 526 | Ga0495677_0149952 | 3300047445 | Bacteria | 898 |
| 527 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 528 | Ga0495673_0000087 | 3300047469 | Bacteria | 190669 |
| 529 | Ga0495673_0001346 | 3300047469 | Bacteria | 19925 |
| 530 | Ga0495673_0108343 | 3300047469 | Bacteria | 1114 |
| 531 | Ga0495673_0164798 | 3300047469 | Bacteria | 848 |
| 532 | Ga0495681_0004708 | 3300047470 | Bacteria | 9253 |
| 533 | Ga0495684_0222066 | 3300047471 | Bacteria | 1385 |
| 534 | Ga0495684_0293714 | 3300047471 | Unclassified | 1169 |
| 535 | Ga0495686_0138193 | 3300047472 | Bacteria | 1440 |
| 536 | Ga0495686_0182569 | 3300047472 | Bacteria | 1215 |
| 537 | Ga0496100_0011561 | 3300048903 | Bacteria | 5029 |
| 538 | Ga0496101_0005404 | 3300048904 | Bacteria | 8140 |
| 539 | Ga0496101_0287481 | 3300048904 | Bacteria | 1286 |
| 540 | Ga0496104_0198328 | 3300048907 | Bacteria | 1919 |
| 541 | Ga0496107_0797028 | 3300048910 | Bacteria | 692 |
| 542 | Ga0496110_0515628 | 3300048913 | Bacteria | 1088 |
| 543 | Ga0496111_0481930 | 3300048914 | Bacteria | 914 |
| 544 | Ga0496111_0548557 | 3300048914 | Bacteria | 849 |
| 545 | Ga0496115_0288793 | 3300048918 | Bacteria | 1346 |
| 546 | Ga0496115_0575823 | 3300048918 | Bacteria | 897 |
| 547 | Ga0496118_0203476 | 3300048921 | Bacteria | 1170 |
| 548 | Ga0496121_0000735 | 3300048924 | Bacteria | 60384 |
| 549 | Ga0496121_0001673 | 3300048924 | Bacteria | 36526 |
| 550 | Ga0496121_0116786 | 3300048924 | Bacteria | 2023 |
| 551 | Ga0496121_0348763 | 3300048924 | Bacteria | 987 |
| 552 | Ga0496121_0363492 | 3300048924 | Bacteria | 960 |
| 553 | Ga0496122_0012141 | 3300048925 | Bacteria | 8623 |
| 554 | Ga0496122_0041865 | 3300048925 | Bacteria | 3613 |
| 555 | Ga0496122_0145357 | 3300048925 | Bacteria | 1475 |
| 556 | Ga0496122_0192190 | 3300048925 | Bacteria | 1203 |
| 557 | Ga0496123_0003232 | 3300048926 | Bacteria | 18540 |
| 558 | Ga0496123_0040310 | 3300048926 | Bacteria | 3255 |
| 559 | Ga0496123_0152610 | 3300048926 | Bacteria | 1244 |
| 560 | Ga0496123_0321276 | 3300048926 | Bacteria | 730 |
| 561 | Ga0496124_0111309 | 3300048927 | Bacteria | 2203 |
| 562 | Ga0495678_000028 | 3300049459 | Bacteria | 220080 |
| 563 | Ga0495682_0002363 | 3300049460 | Bacteria | 8965 |
| 564 | Ga0495682_0011933 | 3300049460 | Bacteria | 3339 |
| 565 | Ga0501298_033143 | 3300049521 | Bacteria | 1022 |
| 566 | Ga0501300_052506 | 3300049523 | Bacteria | 631 |
| 567 | Ga0501032_0118318 | 3300049569 | Bacteria | 1752 |
| 568 | Ga0501033_0101555 | 3300049570 | Bacteria | 2098 |
| 569 | Ga0501033_0218682 | 3300049570 | Bacteria | 1356 |
| 570 | Ga0501034_0006833 | 3300049571 | Bacteria | 12207 |
| 571 | Ga0501034_0009247 | 3300049571 | Bacteria | 10328 |
| 572 | Ga0501034_0141331 | 3300049571 | Bacteria | 2387 |
| 573 | Ga0501034_0465960 | 3300049571 | Bacteria | 1180 |
| 574 | Ga0501034_0513540 | 3300049571 | Bacteria | 1111 |
| 575 | Ga0501036_1434206 | 3300049572 | Bacteria | 559 |
| 576 | Ga0501037_0033835 | 3300049573 | Bacteria | 3774 |
| 577 | Ga0501037_0042176 | 3300049573 | Bacteria | 3354 |
| 578 | Ga0501042_0757101 | 3300049578 | Bacteria | 707 |
| 579 | Ga0501042_1440047 | 3300049578 | Bacteria | 503 |
| 580 | Ga0501043_0162565 | 3300049579 | Bacteria | 1744 |
| 581 | Ga0501043_0977267 | 3300049579 | Bacteria | 604 |
| 582 | Ga0501047_0001004 | 3300049581 | Bacteria | 28467 |
| 583 | Ga0501047_0098285 | 3300049581 | Bacteria | 2806 |
| 584 | Ga0501047_0677351 | 3300049581 | Bacteria | 849 |
| 585 | Ga0501048_0365626 | 3300049582 | Bacteria | 1029 |
| 586 | Ga0501074_0218471 | 3300049590 | Bacteria | 1357 |
| 587 | Ga0501206_021183 | 3300049653 | Bacteria | 928 |
| 588 | Ga0501223_039419 | 3300049663 | Bacteria | 917 |
| 589 | Ga0501224_021903 | 3300049664 | Bacteria | 953 |
| 590 | Ga0501242_007653 | 3300049674 | Bacteria | 1250 |
| 591 | Ga0501080_0270694 | 3300049742 | Bacteria | 1546 |
| 592 | Ga0501083_0401304 | 3300049744 | Bacteria | 892 |
| 593 | Ga0501265_006029 | 3300049762 | Bacteria | 1406 |
| 594 | Ga0501268_027537 | 3300049765 | Bacteria | 1011 |
| 595 | Ga0501269_002551 | 3300049766 | Bacteria | 2234 |
| 596 | Ga0501275_000999 | 3300049772 | Bacteria | 2949 |
| 597 | Ga0501280_012350 | 3300049776 | Bacteria | 1200 |
| 598 | Ga0501035_0094503 | 3300049822 | Bacteria | 2629 |
| 599 | Ga0501035_0125653 | 3300049822 | Bacteria | 2239 |
| 600 | Ga0501035_0528885 | 3300049822 | Bacteria | 968 |
| 601 | Ga0501044_0026683 | 3300049823 | Bacteria | 6114 |
| 602 | Ga0501044_0051951 | 3300049823 | Bacteria | 4226 |
| 603 | Ga0501044_0159204 | 3300049823 | Bacteria | 2236 |
| 604 | Ga0501044_0588976 | 3300049823 | Bacteria | 1006 |
| 605 | Ga0501044_0698258 | 3300049823 | Bacteria | 900 |
| 606 | Ga0501044_0997468 | 3300049823 | Bacteria | 709 |
| 607 | nmdc:mga03n38_163407_c1 | 3300050490 | Bacteria | 1129 |
| 608 | nmdc:mga03n38_25391_c1 | 3300050490 | Bacteria | 2432 |
| 609 | nmdc:mga03n38_499416_c1 | 3300050490 | Bacteria | 682 |
| 610 | nmdc:mga00v17_953300_c1 | 3300050491 | Bacteria | 541 |
| 611 | nmdc:mga0yw44_14763_c1 | 3300050492 | Bacteria | 4160 |
| 612 | nmdc:mga0yw44_826801_c1 | 3300050492 | Bacteria | 629 |
| 613 | nmdc:mga0k408_44177_c1 | 3300050493 | Bacteria | 2569 |
| 614 | nmdc:mga06z11_122372_c1 | 3300050494 | Bacteria | 1453 |
| 615 | nmdc:mga06z11_203515_c1 | 3300050494 | Bacteria | 1151 |
| 616 | nmdc:mga04h51_260696_c1 | 3300050495 | Bacteria | 697 |
| 617 | nmdc:mga07m45_194545_c1 | 3300050496 | Bacteria | 1179 |
| 618 | nmdc:mga07m45_221047_c1 | 3300050496 | Bacteria | 1102 |
| 619 | nmdc:mga07m45_27606_c1 | 3300050496 | Bacteria | 3128 |
| 620 | nmdc:mga07m45_67367_c1 | 3300050496 | Bacteria | 2034 |
| 621 | nmdc:mga05p37_251174_c1 | 3300050507 | Bacteria | 2121 |
| 622 | nmdc:mga0sz30_143009_c1 | 3300050516 | Bacteria | 1056 |
| 623 | Ga0495601_0260598 | 3300053077 | Bacteria | 1132 |
| 624 | Ga0500643_000152 | 3300053087 | Bacteria | 69800 |
| 625 | Ga0500555_000409 | 3300053103 | Bacteria | 17896 |
| 626 | Ga0500562_090737 | 3300053108 | Bacteria | 829 |
| 627 | Ga0500652_224977 | 3300053131 | Bacteria | 753 |
| 628 | Ga0500573_0028053 | 3300053140 | Bacteria | 3240 |
| 629 | Ga0500573_0165823 | 3300053140 | Bacteria | 1199 |
| 630 | Ga0500634_0047011 | 3300053161 | Bacteria | 2331 |
| 631 | Ga0500637_0453864 | 3300053178 | Bacteria | 649 |
| 632 | Ga0500645_002248 | 3300053730 | Bacteria | 8787 |
| 633 | Ga0466962_0003081 | 3300061719 | Bacteria | 7934 |
| 634 | Ga0466962_0008145 | 3300061719 | Bacteria | 5025 |
| 635 | Ga0466962_0064144 | 3300061719 | Bacteria | 1754 |
| 636 | Ga0466962_0303469 | 3300061719 | Bacteria | 790 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_0613273 | Ga0373931_0613273_10_384 | 124 |
| 2 | 3300042012 | Ga0439455_0117585 | Ga0439455_0117585_342_731 | 126 |
| 3 | 3300049653 | Ga0501206_021183 | Ga0501206_021183_448_831 | 126 |
| 4 | 3300049664 | Ga0501224_021903 | Ga0501224_021903_220_603 | 126 |
| 5 | 3300049674 | Ga0501242_007653 | Ga0501242_007653_511_894 | 126 |
| 6 | 3300049765 | Ga0501268_027537 | Ga0501268_027537_461_844 | 126 |
| 7 | 3300049776 | Ga0501280_012350 | Ga0501280_012350_307_690 | 126 |
| 8 | 3300044694 | Ga0466963_0016396 | Ga0466963_0016396_3895_4281 | 128 |
| 9 | 3300044706 | Ga0466964_0303751 | Ga0466964_0303751_367_753 | 128 |
| 10 | 3300044719 | Ga0466971_0095916 | Ga0466971_0095916_348_734 | 128 |
| 11 | 3300044842 | Ga0466957_0059800 | Ga0466957_0059800_1423_1809 | 128 |
| 12 | 3300045976 | Ga0466967_0453521 | Ga0466967_0453521_822_1208 | 128 |
| 13 | 3300049744 | Ga0501083_0401304 | Ga0501083_0401304_106_492 | 128 |
| 14 | 3300061719 | Ga0466962_0064144 | Ga0466962_0064144_602_988 | 128 |
| 15 | 3300006042 | Ga0075368_10243839 | Ga0075368_102438392 | 129 |
| 16 | 3300013308 | Ga0157375_10349763 | Ga0157375_103497631 | 129 |
| 17 | 3300036401 | Ga0373937_1024341 | Ga0373937_1024341_345_734 | 129 |
| 18 | 3300037418 | Ga0395900_0172671 | Ga0395900_0172671_1309_1710 | 129 |
| 19 | 3300049521 | Ga0501298_033143 | Ga0501298_033143_233_622 | 129 |
| 20 | 3300049663 | Ga0501223_039419 | Ga0501223_039419_476_865 | 129 |
| 21 | 3300053077 | Ga0495601_0260598 | Ga0495601_0260598_728_1117 | 129 |
| 22 | iso_pu_bacteria | 2548876994 | 2550695914 | 131 |
| 23 | iso_pu_bacteria | 2571042365 | 2572254066 | 131 |
| 24 | iso_pu_bacteria | 2576861471 | 2578460172 | 131 |
| 25 | iso_pu_bacteria | 2585428057 | 2587727637 | 131 |
| 26 | iso_pu_bacteria | 2643221592 | 2643969455 | 131 |
| 27 | iso_pu_bacteria | 2643221625 | 2644143755 | 131 |
| 28 | iso_pu_bacteria | 2643221648 | 2644276539 | 131 |
| 29 | iso_pu_bacteria | 2734482264 | 2735836054 | 131 |
| 30 | iso_pu_bacteria | 2738541277 | 2738721170 | 131 |
| 31 | iso_pu_bacteria | 2738543009 | 2739227769 | 131 |
| 32 | iso_pu_bacteria | 2738543013 | 2739251568 | 131 |
| 33 | iso_pu_bacteria | 2738543019 | 2739280369 | 131 |
| 34 | iso_pu_bacteria | 2818991445 | 2819594633 | 131 |
| 35 | iso_pu_bacteria | 2858950400 | 2858950897 | 131 |
| 36 | iso_pu_bacteria | 2884811622 | 2884813453 | 131 |
| 37 | iso_pu_bacteria | 2884811622 | 2884813530 | 131 |
| 38 | iso_pu_bacteria | 2884836552 | 2884838339 | 131 |
| 39 | iso_pu_bacteria | 2884852848 | 2884854631 | 131 |
| 40 | iso_pu_bacteria | 2896154374 | 2896156701 | 131 |
| 41 | iso_pu_bacteria | 2904615490 | 2904621823 | 131 |
| 42 | iso_pu_bacteria | 2919462493 | 2919467049 | 131 |
| 43 | iso_pu_bacteria | 2954767861 | 2954767936 | 131 |
| 44 | iso_pu_bacteria | 2844533157 | 2844533808 | 132 |
| 45 | 3300005834 | Ga0068851_10023721 | Ga0068851_100237215 | 133 |
| 46 | 3300025321 | Ga0207656_10219007 | Ga0207656_102190071 | 133 |
| 47 | 3300044656 | Ga0466969_0030177 | Ga0466969_0030177_385_786 | 133 |
| 48 | 3300044684 | Ga0466966_0147177 | Ga0466966_0147177_159_560 | 133 |
| 49 | 3300044693 | Ga0466961_0033166 | Ga0466961_0033166_1074_1475 | 133 |
| 50 | 3300045049 | Ga0466959_0039343 | Ga0466959_0039343_2003_2404 | 133 |
| 51 | 3300045836 | Ga0466958_0042248 | Ga0466958_0042248_698_1099 | 133 |
| 52 | 3300061719 | Ga0466962_0003081 | Ga0466962_0003081_1078_1479 | 133 |
| 53 | 3300003187 | JGI25151J46595_10000399 | JGI25151J46595_100003992 | 134 |
| 54 | 3300003187 | JGI25151J46595_10001711 | JGI25151J46595_1000171113 | 134 |
| 55 | 3300003215 | JGI25153J46596_10063526 | JGI25153J46596_100635261 | 134 |
| 56 | 3300005327 | Ga0070658_10508521 | Ga0070658_105085211 | 134 |
| 57 | 3300005328 | Ga0070676_10686776 | Ga0070676_106867762 | 134 |
| 58 | 3300005335 | Ga0070666_10863369 | Ga0070666_108633692 | 134 |
| 59 | 3300005356 | Ga0070674_100294347 | Ga0070674_1002943473 | 134 |
| 60 | 3300005441 | Ga0070700_100143113 | Ga0070700_1001431133 | 134 |
| 61 | 3300005539 | Ga0068853_100785640 | Ga0068853_1007856402 | 134 |
| 62 | 3300005548 | Ga0070665_100000195 | Ga0070665_10000019556 | 134 |
| 63 | 3300005563 | Ga0068855_101204898 | Ga0068855_1012048981 | 134 |
| 64 | 3300005718 | Ga0068866_10043241 | Ga0068866_100432412 | 134 |
| 65 | 3300005719 | Ga0068861_100161157 | Ga0068861_1001611571 | 134 |
| 66 | 3300005841 | Ga0068863_100250957 | Ga0068863_1002509572 | 134 |
| 67 | 3300005843 | Ga0068860_100479607 | Ga0068860_1004796072 | 134 |
| 68 | 3300006038 | Ga0075365_10093114 | Ga0075365_100931142 | 134 |
| 69 | 3300006038 | Ga0075365_10263267 | Ga0075365_102632671 | 134 |
| 70 | 3300006038 | Ga0075365_10439395 | Ga0075365_104393951 | 134 |
| 71 | 3300006048 | Ga0075363_100100511 | Ga0075363_1001005112 | 134 |
| 72 | 3300006051 | Ga0075364_10332621 | Ga0075364_103326212 | 134 |
| 73 | 3300006237 | Ga0097621_100588835 | Ga0097621_1005888352 | 134 |
| 74 | 3300006353 | Ga0075370_10084255 | Ga0075370_100842552 | 134 |
| 75 | 3300009148 | Ga0105243_10279803 | Ga0105243_102798032 | 134 |
| 76 | 3300009553 | Ga0105249_11766092 | Ga0105249_117660921 | 134 |
| 77 | 3300013104 | Ga0157370_10234533 | Ga0157370_102345332 | 134 |
| 78 | 3300013296 | Ga0157374_10371446 | Ga0157374_103714462 | 134 |
| 79 | 3300013307 | Ga0157372_10387163 | Ga0157372_103871633 | 134 |
| 80 | 3300014326 | Ga0157380_10083835 | Ga0157380_100838352 | 134 |
| 81 | 3300017792 | Ga0163161_10650262 | Ga0163161_106502622 | 134 |
| 82 | 3300025294 | Ga0209025_1000552 | Ga0209025_100055256 | 134 |
| 83 | 3300025297 | Ga0209758_1002239 | Ga0209758_100223912 | 134 |
| 84 | 3300025903 | Ga0207680_10610101 | Ga0207680_106101012 | 134 |
| 85 | 3300025937 | Ga0207669_10214708 | Ga0207669_102147083 | 134 |
| 86 | 3300026041 | Ga0207639_10877122 | Ga0207639_108771222 | 134 |
| 87 | 3300026075 | Ga0207708_10062994 | Ga0207708_100629943 | 134 |
| 88 | 3300026088 | Ga0207641_10235352 | Ga0207641_102353523 | 134 |
| 89 | 3300026116 | Ga0207674_11035860 | Ga0207674_110358601 | 134 |
| 90 | 3300026118 | Ga0207675_100013845 | Ga0207675_1000138455 | 134 |
| 91 | 3300026142 | Ga0207698_10602228 | Ga0207698_106022282 | 134 |
| 92 | 3300028379 | Ga0268266_10002760 | Ga0268266_1000276013 | 134 |
| 93 | 3300028381 | Ga0268264_10306343 | Ga0268264_103063434 | 134 |
| 94 | 3300031548 | Ga0307408_100337959 | Ga0307408_1003379592 | 134 |
| 95 | 3300031731 | Ga0307405_10914650 | Ga0307405_109146502 | 134 |
| 96 | 3300031852 | Ga0307410_10620628 | Ga0307410_106206281 | 134 |
| 97 | 3300031903 | Ga0307407_10325510 | Ga0307407_103255102 | 134 |
| 98 | 3300031911 | Ga0307412_11170510 | Ga0307412_111705102 | 134 |
| 99 | 3300031911 | Ga0307412_11879001 | Ga0307412_118790011 | 134 |
| 100 | 3300031995 | Ga0307409_100038783 | Ga0307409_1000387835 | 134 |
| 101 | 3300032004 | Ga0307414_10449744 | Ga0307414_104497442 | 134 |
| 102 | 3300032126 | Ga0307415_100853585 | Ga0307415_1008535852 | 134 |
| 103 | 3300035692 | Ga0373935_0486260 | Ga0373935_0486260_383_820 | 134 |
| 104 | 3300036401 | Ga0373937_0424664 | Ga0373937_0424664_639_1049 | 134 |
| 105 | 3300037068 | Ga0373925_0607310 | Ga0373925_0607310_52_462 | 134 |
| 106 | 3300037312 | Ga0395899_0226277 | Ga0395899_0226277_218_622 | 134 |
| 107 | 3300037418 | Ga0395900_0328240 | Ga0395900_0328240_28_432 | 134 |
| 108 | 3300037418 | Ga0395900_1079469 | Ga0395900_1079469_63_467 | 134 |
| 109 | 3300037466 | Ga0395898_0222658 | Ga0395898_0222658_942_1346 | 134 |
| 110 | 3300037466 | Ga0395898_1268325 | Ga0395898_1268325_168_572 | 134 |
| 111 | 3300037471 | Ga0395905_0485846 | Ga0395905_0485846_513_917 | 134 |
| 112 | 3300037471 | Ga0395905_0607564 | Ga0395905_0607564_529_933 | 134 |
| 113 | 3300037471 | Ga0395905_1444287 | Ga0395905_1444287_76_480 | 134 |
| 114 | 3300038443 | Ga0395901_0125666 | Ga0395901_0125666_1456_1860 | 134 |
| 115 | 3300038443 | Ga0395901_1120490 | Ga0395901_1120490_49_453 | 134 |
| 116 | 3300039437 | Ga0436365_0936602 | Ga0436365_0936602_5751_6155 | 134 |
| 117 | 3300039447 | Ga0436361_0945996 | Ga0436361_0945996_503_907 | 134 |
| 118 | 3300039453 | Ga0436362_0689394 | Ga0436362_0689394_567_971 | 134 |
| 119 | 3300041413 | Ga0439465_0195669 | Ga0439465_0195669_310_714 | 134 |
| 120 | 3300042007 | Ga0439449_0004030 | Ga0439449_0004030_5231_5674 | 134 |
| 121 | 3300042007 | Ga0439449_0015730 | Ga0439449_0015730_1768_2181 | 134 |
| 122 | 3300044656 | Ga0466969_0051825 | Ga0466969_0051825_1531_1935 | 134 |
| 123 | 3300044684 | Ga0466966_0003316 | Ga0466966_0003316_9001_9405 | 134 |
| 124 | 3300044693 | Ga0466961_0080610 | Ga0466961_0080610_1579_1983 | 134 |
| 125 | 3300044901 | Ga0466960_0009898 | Ga0466960_0009898_2604_3008 | 134 |
| 126 | 3300045049 | Ga0466959_0251953 | Ga0466959_0251953_672_1076 | 134 |
| 127 | 3300045049 | Ga0466959_0392765 | Ga0466959_0392765_26_448 | 134 |
| 128 | 3300045976 | Ga0466967_1739673 | Ga0466967_1739673_141_563 | 134 |
| 129 | 3300046460 | Ga0495638_0012229 | Ga0495638_0012229_1458_1871 | 134 |
| 130 | 3300046507 | Ga0495606_0049161 | Ga0495606_0049161_1956_2360 | 134 |
| 131 | 3300046511 | Ga0495608_0094644 | Ga0495608_0094644_1219_1656 | 134 |
| 132 | 3300046512 | Ga0495610_0192976 | Ga0495610_0192976_40_444 | 134 |
| 133 | 3300046525 | Ga0495663_0102972 | Ga0495663_0102972_340_744 | 134 |
| 134 | 3300046539 | Ga0495621_0089935 | Ga0495621_0089935_476_880 | 134 |
| 135 | 3300046558 | Ga0495633_0075800 | Ga0495633_0075800_580_984 | 134 |
| 136 | 3300046615 | Ga0495656_0169154 | Ga0495656_0169154_132_536 | 134 |
| 137 | 3300046616 | Ga0495668_0195133 | Ga0495668_0195133_411_821 | 134 |
| 138 | 3300046675 | Ga0495657_0220672 | Ga0495657_0220672_442_879 | 134 |
| 139 | 3300046691 | Ga0495670_0172975 | Ga0495670_0172975_711_1115 | 134 |
| 140 | 3300046692 | Ga0495671_0137071 | Ga0495671_0137071_272_676 | 134 |
| 141 | 3300047318 | Ga0495636_0002043 | Ga0495636_0002043_7327_7731 | 134 |
| 142 | 3300047318 | Ga0495636_0003291 | Ga0495636_0003291_1438_1842 | 134 |
| 143 | 3300047318 | Ga0495636_0124573 | Ga0495636_0124573_573_977 | 134 |
| 144 | 3300047319 | Ga0495674_0396836 | Ga0495674_0396836_283_720 | 134 |
| 145 | 3300047320 | Ga0495672_0100769 | Ga0495672_0100769_112_525 | 134 |
| 146 | 3300047322 | Ga0495680_0063976 | Ga0495680_0063976_452_889 | 134 |
| 147 | 3300047470 | Ga0495681_0004708 | Ga0495681_0004708_8592_8996 | 134 |
| 148 | 3300047471 | Ga0495684_0293714 | Ga0495684_0293714_688_1125 | 134 |
| 149 | 3300048904 | Ga0496101_0287481 | Ga0496101_0287481_463_873 | 134 |
| 150 | 3300048907 | Ga0496104_0198328 | Ga0496104_0198328_478_927 | 134 |
| 151 | 3300048913 | Ga0496110_0515628 | Ga0496110_0515628_419_853 | 134 |
| 152 | 3300048914 | Ga0496111_0548557 | Ga0496111_0548557_199_642 | 134 |
| 153 | 3300048918 | Ga0496115_0575823 | Ga0496115_0575823_420_824 | 134 |
| 154 | 3300048924 | Ga0496121_0000735 | Ga0496121_0000735_29945_30349 | 134 |
| 155 | 3300048924 | Ga0496121_0116786 | Ga0496121_0116786_1587_1991 | 134 |
| 156 | 3300049578 | Ga0501042_0757101 | Ga0501042_0757101_123_527 | 134 |
| 157 | 3300050490 | nmdc:mga03n38_25391_c1 | nmdc:mga03n38_25391_c1_1556_1990 | 134 |
| 158 | 3300050491 | nmdc:mga00v17_953300_c1 | nmdc:mga00v17_953300_c1_33_467 | 134 |
| 159 | 3300050492 | nmdc:mga0yw44_14763_c1 | nmdc:mga0yw44_14763_c1_1043_1477 | 134 |
| 160 | 3300050494 | nmdc:mga06z11_122372_c1 | nmdc:mga06z11_122372_c1_373_807 | 134 |
| 161 | 3300050496 | nmdc:mga07m45_27606_c1 | nmdc:mga07m45_27606_c1_2335_2754 | 134 |
| 162 | 3300050496 | nmdc:mga07m45_67367_c1 | nmdc:mga07m45_67367_c1_988_1422 | 134 |
| 163 | 3300053140 | Ga0500573_0028053 | Ga0500573_0028053_2103_2522 | 134 |
| 164 | 3300053161 | Ga0500634_0047011 | Ga0500634_0047011_1767_2171 | 134 |
| 165 | 3300061719 | Ga0466962_0303469 | Ga0466962_0303469_264_686 | 134 |
| 166 | 3300002704 | JGI25155J39150_1000039 | JGI25155J39150_100003913 | 135 |
| 167 | 3300002705 | JGI25156J39149_1000096 | JGI25156J39149_100009614 | 135 |
| 168 | 3300002738 | JGI25154J39366_1000077 | JGI25154J39366_100007713 | 135 |
| 169 | 3300002741 | JGI25157J39369_1000065 | JGI25157J39369_100006513 | 135 |
| 170 | 3300003203 | JGI25406J46586_10045925 | JGI25406J46586_100459252 | 135 |
| 171 | 3300003758 | Ga0055532_1000005 | Ga0055532_1000005317 | 135 |
| 172 | 3300003761 | Ga0055535_1002690 | Ga0055535_10026907 | 135 |
| 173 | 3300003763 | Ga0055529_1014460 | Ga0055529_10144602 | 135 |
| 174 | 3300003773 | Ga0055537_1000416 | Ga0055537_100041627 | 135 |
| 175 | 3300003784 | Ga0055534_1000008 | Ga0055534_100000827 | 135 |
| 176 | 3300003790 | Ga0055528_1000831 | Ga0055528_100083120 | 135 |
| 177 | 3300003792 | Ga0055540_1007192 | Ga0055540_10071926 | 135 |
| 178 | 3300003794 | Ga0055531_10002125 | Ga0055531_100021254 | 135 |
| 179 | 3300005262 | Ga0065165_1000241 | Ga0065165_100024175 | 135 |
| 180 | 3300005293 | Ga0065715_11107217 | Ga0065715_111072171 | 135 |
| 181 | 3300005327 | Ga0070658_10014457 | Ga0070658_100144579 | 135 |
| 182 | 3300005328 | Ga0070676_10001625 | Ga0070676_100016252 | 135 |
| 183 | 3300005329 | Ga0070683_100033656 | Ga0070683_1000336565 | 135 |
| 184 | 3300005330 | Ga0070690_100073988 | Ga0070690_1000739882 | 135 |
| 185 | 3300005333 | Ga0070677_10104135 | Ga0070677_101041351 | 135 |
| 186 | 3300005333 | Ga0070677_10447052 | Ga0070677_104470521 | 135 |
| 187 | 3300005334 | Ga0068869_100003838 | Ga0068869_10000383810 | 135 |
| 188 | 3300005334 | Ga0068869_100146296 | Ga0068869_1001462963 | 135 |
| 189 | 3300005335 | Ga0070666_10012977 | Ga0070666_100129774 | 135 |
| 190 | 3300005337 | Ga0070682_101036956 | Ga0070682_1010369561 | 135 |
| 191 | 3300005338 | Ga0068868_100058614 | Ga0068868_1000586142 | 135 |
| 192 | 3300005340 | Ga0070689_100359388 | Ga0070689_1003593882 | 135 |
| 193 | 3300005343 | Ga0070687_100116721 | Ga0070687_1001167212 | 135 |
| 194 | 3300005344 | Ga0070661_100039453 | Ga0070661_1000394532 | 135 |
| 195 | 3300005347 | Ga0070668_100001082 | Ga0070668_10000108217 | 135 |
| 196 | 3300005347 | Ga0070668_100109201 | Ga0070668_1001092013 | 135 |
| 197 | 3300005353 | Ga0070669_100063828 | Ga0070669_1000638283 | 135 |
| 198 | 3300005354 | Ga0070675_100031694 | Ga0070675_1000316946 | 135 |
| 199 | 3300005355 | Ga0070671_100107502 | Ga0070671_1001075023 | 135 |
| 200 | 3300005355 | Ga0070671_100598091 | Ga0070671_1005980912 | 135 |
| 201 | 3300005356 | Ga0070674_100012872 | Ga0070674_1000128725 | 135 |
| 202 | 3300005364 | Ga0070673_102243076 | Ga0070673_1022430761 | 135 |
| 203 | 3300005366 | Ga0070659_100297161 | Ga0070659_1002971612 | 135 |
| 204 | 3300005366 | Ga0070659_100317670 | Ga0070659_1003176702 | 135 |
| 205 | 3300005366 | Ga0070659_101444575 | Ga0070659_1014445751 | 135 |
| 206 | 3300005367 | Ga0070667_100007734 | Ga0070667_1000077342 | 135 |
| 207 | 3300005367 | Ga0070667_100008658 | Ga0070667_1000086589 | 135 |
| 208 | 3300005367 | Ga0070667_100114328 | Ga0070667_1001143283 | 135 |
| 209 | 3300005367 | Ga0070667_100751332 | Ga0070667_1007513322 | 135 |
| 210 | 3300005437 | Ga0070710_10816837 | Ga0070710_108168371 | 135 |
| 211 | 3300005441 | Ga0070700_100371217 | Ga0070700_1003712172 | 135 |
| 212 | 3300005445 | Ga0070708_100730051 | Ga0070708_1007300512 | 135 |
| 213 | 3300005445 | Ga0070708_101587597 | Ga0070708_1015875971 | 135 |
| 214 | 3300005455 | Ga0070663_100101137 | Ga0070663_1001011372 | 135 |
| 215 | 3300005455 | Ga0070663_100318697 | Ga0070663_1003186972 | 135 |
| 216 | 3300005456 | Ga0070678_100016063 | Ga0070678_1000160633 | 135 |
| 217 | 3300005457 | Ga0070662_100017280 | Ga0070662_1000172804 | 135 |
| 218 | 3300005457 | Ga0070662_100062351 | Ga0070662_1000623514 | 135 |
| 219 | 3300005459 | Ga0068867_100004243 | Ga0068867_1000042436 | 135 |
| 220 | 3300005459 | Ga0068867_100034370 | Ga0068867_1000343702 | 135 |
| 221 | 3300005459 | Ga0068867_100719589 | Ga0068867_1007195892 | 135 |
| 222 | 3300005467 | Ga0070706_101434306 | Ga0070706_1014343061 | 135 |
| 223 | 3300005471 | Ga0070698_100396258 | Ga0070698_1003962582 | 135 |
| 224 | 3300005530 | Ga0070679_100904918 | Ga0070679_1009049182 | 135 |
| 225 | 3300005535 | Ga0070684_100045385 | Ga0070684_1000453853 | 135 |
| 226 | 3300005539 | Ga0068853_100174084 | Ga0068853_1001740843 | 135 |
| 227 | 3300005539 | Ga0068853_101293490 | Ga0068853_1012934902 | 135 |
| 228 | 3300005543 | Ga0070672_100005393 | Ga0070672_1000053933 | 135 |
| 229 | 3300005547 | Ga0070693_100072588 | Ga0070693_1000725883 | 135 |
| 230 | 3300005548 | Ga0070665_100001353 | Ga0070665_10000135327 | 135 |
| 231 | 3300005563 | Ga0068855_100007328 | Ga0068855_10000732812 | 135 |
| 232 | 3300005563 | Ga0068855_100111340 | Ga0068855_1001113404 | 135 |
| 233 | 3300005563 | Ga0068855_100322998 | Ga0068855_1003229981 | 135 |
| 234 | 3300005578 | Ga0068854_100541365 | Ga0068854_1005413652 | 135 |
| 235 | 3300005616 | Ga0068852_100003658 | Ga0068852_1000036583 | 135 |
| 236 | 3300005616 | Ga0068852_100070517 | Ga0068852_1000705172 | 135 |
| 237 | 3300005617 | Ga0068859_100112090 | Ga0068859_1001120902 | 135 |
| 238 | 3300005617 | Ga0068859_100149643 | Ga0068859_1001496433 | 135 |
| 239 | 3300005617 | Ga0068859_100179980 | Ga0068859_1001799802 | 135 |
| 240 | 3300005617 | Ga0068859_100208753 | Ga0068859_1002087532 | 135 |
| 241 | 3300005617 | Ga0068859_100241760 | Ga0068859_1002417604 | 135 |
| 242 | 3300005618 | Ga0068864_100627839 | Ga0068864_1006278392 | 135 |
| 243 | 3300005618 | Ga0068864_100671027 | Ga0068864_1006710272 | 135 |
| 244 | 3300005718 | Ga0068866_10059287 | Ga0068866_100592872 | 135 |
| 245 | 3300005719 | Ga0068861_100006162 | Ga0068861_1000061623 | 135 |
| 246 | 3300005719 | Ga0068861_100943535 | Ga0068861_1009435352 | 135 |
| 247 | 3300005841 | Ga0068863_100004706 | Ga0068863_10000470610 | 135 |
| 248 | 3300005841 | Ga0068863_100019695 | Ga0068863_1000196954 | 135 |
| 249 | 3300005841 | Ga0068863_100924989 | Ga0068863_1009249891 | 135 |
| 250 | 3300005843 | Ga0068860_100005570 | Ga0068860_10000557010 | 135 |
| 251 | 3300005843 | Ga0068860_100113682 | Ga0068860_1001136823 | 135 |
| 252 | 3300005843 | Ga0068860_100162228 | Ga0068860_1001622283 | 135 |
| 253 | 3300005844 | Ga0068862_100010381 | Ga0068862_1000103817 | 135 |
| 254 | 3300005844 | Ga0068862_100096765 | Ga0068862_1000967653 | 135 |
| 255 | 3300005844 | Ga0068862_101717683 | Ga0068862_1017176832 | 135 |
| 256 | 3300005937 | Ga0081455_10150777 | Ga0081455_101507771 | 135 |
| 257 | 3300005985 | Ga0081539_10000829 | Ga0081539_1000082953 | 135 |
| 258 | 3300006028 | Ga0070717_10375592 | Ga0070717_103755922 | 135 |
| 259 | 3300006038 | Ga0075365_10040676 | Ga0075365_100406762 | 135 |
| 260 | 3300006042 | Ga0075368_10182323 | Ga0075368_101823232 | 135 |
| 261 | 3300006048 | Ga0075363_100176715 | Ga0075363_1001767152 | 135 |
| 262 | 3300006048 | Ga0075363_100288502 | Ga0075363_1002885022 | 135 |
| 263 | 3300006048 | Ga0075363_100601211 | Ga0075363_1006012112 | 135 |
| 264 | 3300006051 | Ga0075364_10082145 | Ga0075364_100821452 | 135 |
| 265 | 3300006177 | Ga0075362_10035047 | Ga0075362_100350473 | 135 |
| 266 | 3300006177 | Ga0075362_10173451 | Ga0075362_101734512 | 135 |
| 267 | 3300006178 | Ga0075367_10095592 | Ga0075367_100955921 | 135 |
| 268 | 3300006178 | Ga0075367_10256315 | Ga0075367_102563152 | 135 |
| 269 | 3300006186 | Ga0075369_10392010 | Ga0075369_103920102 | 135 |
| 270 | 3300006195 | Ga0075366_10013628 | Ga0075366_100136283 | 135 |
| 271 | 3300006195 | Ga0075366_10069201 | Ga0075366_100692013 | 135 |
| 272 | 3300006195 | Ga0075366_10860315 | Ga0075366_108603151 | 135 |
| 273 | 3300006237 | Ga0097621_100376330 | Ga0097621_1003763301 | 135 |
| 274 | 3300006353 | Ga0075370_10004353 | Ga0075370_100043532 | 135 |
| 275 | 3300006353 | Ga0075370_10066987 | Ga0075370_100669873 | 135 |
| 276 | 3300006353 | Ga0075370_10232002 | Ga0075370_102320022 | 135 |
| 277 | 3300006353 | Ga0075370_10366118 | Ga0075370_103661182 | 135 |
| 278 | 3300006353 | Ga0075370_10418804 | Ga0075370_104188042 | 135 |
| 279 | 3300006881 | Ga0068865_100031766 | Ga0068865_1000317664 | 135 |
| 280 | 3300006881 | Ga0068865_100062565 | Ga0068865_1000625653 | 135 |
| 281 | 3300006881 | Ga0068865_100418907 | Ga0068865_1004189072 | 135 |
| 282 | 3300006931 | Ga0097620_100112089 | Ga0097620_1001120892 | 135 |
| 283 | 3300006931 | Ga0097620_100149629 | Ga0097620_1001496293 | 135 |
| 284 | 3300006931 | Ga0097620_100179981 | Ga0097620_1001799812 | 135 |
| 285 | 3300006931 | Ga0097620_100208757 | Ga0097620_1002087572 | 135 |
| 286 | 3300006931 | Ga0097620_100241759 | Ga0097620_1002417591 | 135 |
| 287 | 3300006946 | Ga0079104_1006554 | Ga0079104_100655410 | 135 |
| 288 | 3300006948 | Ga0099826_10000171 | Ga0099826_1000017113 | 135 |
| 289 | 3300007265 | Ga0099794_10038868 | Ga0099794_100388682 | 135 |
| 290 | 3300007788 | Ga0099795_10000001 | Ga0099795_1000000144 | 135 |
| 291 | 3300009093 | Ga0105240_11389130 | Ga0105240_113891302 | 135 |
| 292 | 3300009094 | Ga0111539_10726933 | Ga0111539_107269331 | 135 |
| 293 | 3300009098 | Ga0105245_10097764 | Ga0105245_100977642 | 135 |
| 294 | 3300009101 | Ga0105247_10003540 | Ga0105247_100035406 | 135 |
| 295 | 3300009101 | Ga0105247_11645939 | Ga0105247_116459392 | 135 |
| 296 | 3300009148 | Ga0105243_10028062 | Ga0105243_100280623 | 135 |
| 297 | 3300009148 | Ga0105243_10134712 | Ga0105243_101347123 | 135 |
| 298 | 3300009176 | Ga0105242_10163965 | Ga0105242_101639653 | 135 |
| 299 | 3300009177 | Ga0105248_10012920 | Ga0105248_1001292010 | 135 |
| 300 | 3300009177 | Ga0105248_10021265 | Ga0105248_1002126510 | 135 |
| 301 | 3300009551 | Ga0105238_10008209 | Ga0105238_100082099 | 135 |
| 302 | 3300009553 | Ga0105249_10042383 | Ga0105249_100423833 | 135 |
| 303 | 3300009553 | Ga0105249_10085916 | Ga0105249_100859163 | 135 |
| 304 | 3300009553 | Ga0105249_10113763 | Ga0105249_101137635 | 135 |
| 305 | 3300009553 | Ga0105249_10543612 | Ga0105249_105436122 | 135 |
| 306 | 3300010159 | Ga0099796_10000001 | Ga0099796_1000000129 | 135 |
| 307 | 3300011119 | Ga0105246_10000157 | Ga0105246_1000015733 | 135 |
| 308 | 3300011119 | Ga0105246_11661888 | Ga0105246_116618882 | 135 |
| 309 | 3300013102 | Ga0157371_10637262 | Ga0157371_106372621 | 135 |
| 310 | 3300013102 | Ga0157371_11222765 | Ga0157371_112227651 | 135 |
| 311 | 3300013104 | Ga0157370_10224367 | Ga0157370_102243672 | 135 |
| 312 | 3300013104 | Ga0157370_10892328 | Ga0157370_108923281 | 135 |
| 313 | 3300013105 | Ga0157369_10119712 | Ga0157369_101197123 | 135 |
| 314 | 3300013105 | Ga0157369_11075206 | Ga0157369_110752061 | 135 |
| 315 | 3300013296 | Ga0157374_10430566 | Ga0157374_104305661 | 135 |
| 316 | 3300013296 | Ga0157374_10446667 | Ga0157374_104466673 | 135 |
| 317 | 3300013297 | Ga0157378_10007853 | Ga0157378_100078537 | 135 |
| 318 | 3300013306 | Ga0163162_10146196 | Ga0163162_101461963 | 135 |
| 319 | 3300013307 | Ga0157372_10764561 | Ga0157372_107645613 | 135 |
| 320 | 3300013308 | Ga0157375_10541888 | Ga0157375_105418883 | 135 |
| 321 | 3300013308 | Ga0157375_10883614 | Ga0157375_108836142 | 135 |
| 322 | 3300013308 | Ga0157375_11100103 | Ga0157375_111001032 | 135 |
| 323 | 3300014325 | Ga0163163_10482068 | Ga0163163_104820682 | 135 |
| 324 | 3300014326 | Ga0157380_10005141 | Ga0157380_100051412 | 135 |
| 325 | 3300014326 | Ga0157380_10023694 | Ga0157380_100236945 | 135 |
| 326 | 3300014968 | Ga0157379_10039462 | Ga0157379_100394628 | 135 |
| 327 | 3300014968 | Ga0157379_11018166 | Ga0157379_110181662 | 135 |
| 328 | 3300014969 | Ga0157376_10224722 | Ga0157376_102247222 | 135 |
| 329 | 3300015261 | Ga0182006_1000077 | Ga0182006_1000077100 | 135 |
| 330 | 3300015262 | Ga0182007_10112623 | Ga0182007_101126232 | 135 |
| 331 | 3300015265 | Ga0182005_1009286 | Ga0182005_10092862 | 135 |
| 332 | 3300017792 | Ga0163161_10033690 | Ga0163161_100336904 | 135 |
| 333 | 3300017792 | Ga0163161_10040299 | Ga0163161_100402993 | 135 |
| 334 | 3300017792 | Ga0163161_10405563 | Ga0163161_104055632 | 135 |
| 335 | 3300025206 | Ga0209435_100043 | Ga0209435_10004392 | 135 |
| 336 | 3300025206 | Ga0209435_100050 | Ga0209435_1000504 | 135 |
| 337 | 3300025229 | Ga0209147_100011 | Ga0209147_100011116 | 135 |
| 338 | 3300025242 | Ga0209258_100401 | Ga0209258_10040139 | 135 |
| 339 | 3300025246 | Ga0209646_1000161 | Ga0209646_10001614 | 135 |
| 340 | 3300025250 | Ga0209026_1000173 | Ga0209026_100017391 | 135 |
| 341 | 3300025256 | Ga0209759_1000169 | Ga0209759_100016927 | 135 |
| 342 | 3300025263 | Ga0209565_1000042 | Ga0209565_100004227 | 135 |
| 343 | 3300025272 | Ga0209455_1002552 | Ga0209455_10025525 | 135 |
| 344 | 3300025273 | Ga0209673_1000071 | Ga0209673_1000071200 | 135 |
| 345 | 3300025273 | Ga0209673_1011136 | Ga0209673_10111364 | 135 |
| 346 | 3300025284 | Ga0209130_1003792 | Ga0209130_10037923 | 135 |
| 347 | 3300025291 | Ga0209675_1000041 | Ga0209675_1000041199 | 135 |
| 348 | 3300025291 | Ga0209675_1000811 | Ga0209675_10008114 | 135 |
| 349 | 3300025292 | Ga0209676_1006071 | Ga0209676_10060717 | 135 |
| 350 | 3300025295 | Ga0209564_1045121 | Ga0209564_10451213 | 135 |
| 351 | 3300025298 | Ga0209050_1000221 | Ga0209050_100022141 | 135 |
| 352 | 3300025298 | Ga0209050_1057544 | Ga0209050_10575442 | 135 |
| 353 | 3300025299 | Ga0209256_1033506 | Ga0209256_10335063 | 135 |
| 354 | 3300025303 | Ga0209051_1000059 | Ga0209051_1000059256 | 135 |
| 355 | 3300025303 | Ga0209051_1006159 | Ga0209051_10061598 | 135 |
| 356 | 3300025303 | Ga0209051_1089366 | Ga0209051_10893662 | 135 |
| 357 | 3300025304 | Ga0209257_1000022 | Ga0209257_1000022144 | 135 |
| 358 | 3300025304 | Ga0209257_1000302 | Ga0209257_10003026 | 135 |
| 359 | 3300025304 | Ga0209257_1004206 | Ga0209257_10042065 | 135 |
| 360 | 3300025315 | Ga0207697_10024462 | Ga0207697_100244622 | 135 |
| 361 | 3300025893 | Ga0207682_10359853 | Ga0207682_103598532 | 135 |
| 362 | 3300025899 | Ga0207642_10134585 | Ga0207642_101345852 | 135 |
| 363 | 3300025900 | Ga0207710_10003190 | Ga0207710_100031906 | 135 |
| 364 | 3300025903 | Ga0207680_10046357 | Ga0207680_100463572 | 135 |
| 365 | 3300025907 | Ga0207645_10028998 | Ga0207645_100289983 | 135 |
| 366 | 3300025909 | Ga0207705_10036317 | Ga0207705_100363172 | 135 |
| 367 | 3300025910 | Ga0207684_11266598 | Ga0207684_112665982 | 135 |
| 368 | 3300025918 | Ga0207662_10020646 | Ga0207662_100206464 | 135 |
| 369 | 3300025919 | Ga0207657_10708875 | Ga0207657_107088752 | 135 |
| 370 | 3300025920 | Ga0207649_10118467 | Ga0207649_101184673 | 135 |
| 371 | 3300025920 | Ga0207649_10193851 | Ga0207649_101938512 | 135 |
| 372 | 3300025922 | Ga0207646_11549483 | Ga0207646_115494831 | 135 |
| 373 | 3300025923 | Ga0207681_10022206 | Ga0207681_100222063 | 135 |
| 374 | 3300025923 | Ga0207681_10665180 | Ga0207681_106651802 | 135 |
| 375 | 3300025924 | Ga0207694_10004840 | Ga0207694_100048403 | 135 |
| 376 | 3300025925 | Ga0207650_11500607 | Ga0207650_115006072 | 135 |
| 377 | 3300025926 | Ga0207659_10063895 | Ga0207659_100638954 | 135 |
| 378 | 3300025926 | Ga0207659_10527232 | Ga0207659_105272322 | 135 |
| 379 | 3300025929 | Ga0207664_10132789 | Ga0207664_101327892 | 135 |
| 380 | 3300025931 | Ga0207644_10657057 | Ga0207644_106570572 | 135 |
| 381 | 3300025931 | Ga0207644_10840001 | Ga0207644_108400011 | 135 |
| 382 | 3300025931 | Ga0207644_11596438 | Ga0207644_115964382 | 135 |
| 383 | 3300025932 | Ga0207690_10124602 | Ga0207690_101246021 | 135 |
| 384 | 3300025932 | Ga0207690_10798893 | Ga0207690_107988931 | 135 |
| 385 | 3300025933 | Ga0207706_10002140 | Ga0207706_100021404 | 135 |
| 386 | 3300025933 | Ga0207706_10017021 | Ga0207706_100170214 | 135 |
| 387 | 3300025934 | Ga0207686_10050905 | Ga0207686_100509053 | 135 |
| 388 | 3300025934 | Ga0207686_10533978 | Ga0207686_105339782 | 135 |
| 389 | 3300025935 | Ga0207709_10019065 | Ga0207709_100190653 | 135 |
| 390 | 3300025935 | Ga0207709_10119189 | Ga0207709_101191893 | 135 |
| 391 | 3300025935 | Ga0207709_10149996 | Ga0207709_101499963 | 135 |
| 392 | 3300025936 | Ga0207670_10568791 | Ga0207670_105687912 | 135 |
| 393 | 3300025937 | Ga0207669_10010674 | Ga0207669_100106744 | 135 |
| 394 | 3300025937 | Ga0207669_10967535 | Ga0207669_109675351 | 135 |
| 395 | 3300025938 | Ga0207704_10034967 | Ga0207704_100349673 | 135 |
| 396 | 3300025938 | Ga0207704_10044324 | Ga0207704_100443243 | 135 |
| 397 | 3300025938 | Ga0207704_10137074 | Ga0207704_101370743 | 135 |
| 398 | 3300025940 | Ga0207691_10018902 | Ga0207691_100189026 | 135 |
| 399 | 3300025941 | Ga0207711_10029322 | Ga0207711_100293222 | 135 |
| 400 | 3300025941 | Ga0207711_10074050 | Ga0207711_100740502 | 135 |
| 401 | 3300025942 | Ga0207689_10007114 | Ga0207689_100071143 | 135 |
| 402 | 3300025944 | Ga0207661_10197897 | Ga0207661_101978972 | 135 |
| 403 | 3300025949 | Ga0207667_10005245 | Ga0207667_1000524514 | 135 |
| 404 | 3300025949 | Ga0207667_10066225 | Ga0207667_100662254 | 135 |
| 405 | 3300025949 | Ga0207667_10246777 | Ga0207667_102467773 | 135 |
| 406 | 3300025960 | Ga0207651_10098316 | Ga0207651_100983162 | 135 |
| 407 | 3300025960 | Ga0207651_10149006 | Ga0207651_101490063 | 135 |
| 408 | 3300025960 | Ga0207651_10370334 | Ga0207651_103703342 | 135 |
| 409 | 3300025961 | Ga0207712_10113835 | Ga0207712_101138353 | 135 |
| 410 | 3300025961 | Ga0207712_10148777 | Ga0207712_101487774 | 135 |
| 411 | 3300025972 | Ga0207668_10000003 | Ga0207668_100000038 | 135 |
| 412 | 3300025972 | Ga0207668_10034578 | Ga0207668_100345783 | 135 |
| 413 | 3300025972 | Ga0207668_10594638 | Ga0207668_105946382 | 135 |
| 414 | 3300025986 | Ga0207658_10005552 | Ga0207658_100055525 | 135 |
| 415 | 3300025986 | Ga0207658_10011119 | Ga0207658_100111196 | 135 |
| 416 | 3300025986 | Ga0207658_10019554 | Ga0207658_100195546 | 135 |
| 417 | 3300025986 | Ga0207658_10662281 | Ga0207658_106622812 | 135 |
| 418 | 3300025986 | Ga0207658_10742530 | Ga0207658_107425301 | 135 |
| 419 | 3300026023 | Ga0207677_12094598 | Ga0207677_120945981 | 135 |
| 420 | 3300026035 | Ga0207703_10094551 | Ga0207703_100945512 | 135 |
| 421 | 3300026035 | Ga0207703_10565673 | Ga0207703_105656733 | 135 |
| 422 | 3300026041 | Ga0207639_10099092 | Ga0207639_100990921 | 135 |
| 423 | 3300026067 | Ga0207678_10070271 | Ga0207678_100702711 | 135 |
| 424 | 3300026067 | Ga0207678_10095432 | Ga0207678_100954322 | 135 |
| 425 | 3300026067 | Ga0207678_10345080 | Ga0207678_103450803 | 135 |
| 426 | 3300026075 | Ga0207708_10042217 | Ga0207708_100422173 | 135 |
| 427 | 3300026075 | Ga0207708_10326352 | Ga0207708_103263521 | 135 |
| 428 | 3300026078 | Ga0207702_10426720 | Ga0207702_104267202 | 135 |
| 429 | 3300026088 | Ga0207641_10010784 | Ga0207641_100107844 | 135 |
| 430 | 3300026089 | Ga0207648_10000393 | Ga0207648_1000039316 | 135 |
| 431 | 3300026089 | Ga0207648_10006515 | Ga0207648_100065153 | 135 |
| 432 | 3300026089 | Ga0207648_11132503 | Ga0207648_111325031 | 135 |
| 433 | 3300026095 | Ga0207676_10504291 | Ga0207676_105042912 | 135 |
| 434 | 3300026095 | Ga0207676_11324686 | Ga0207676_113246861 | 135 |
| 435 | 3300026116 | Ga0207674_11371259 | Ga0207674_113712591 | 135 |
| 436 | 3300026118 | Ga0207675_100001089 | Ga0207675_1000010892 | 135 |
| 437 | 3300026118 | Ga0207675_100001455 | Ga0207675_10000145516 | 135 |
| 438 | 3300026118 | Ga0207675_100590230 | Ga0207675_1005902303 | 135 |
| 439 | 3300026118 | Ga0207675_101700611 | Ga0207675_1017006111 | 135 |
| 440 | 3300026121 | Ga0207683_10378464 | Ga0207683_103784641 | 135 |
| 441 | 3300026121 | Ga0207683_10427665 | Ga0207683_104276652 | 135 |
| 442 | 3300026121 | Ga0207683_11209825 | Ga0207683_112098252 | 135 |
| 443 | 3300026142 | Ga0207698_10574167 | Ga0207698_105741673 | 135 |
| 444 | 3300026142 | Ga0207698_11747171 | Ga0207698_117471711 | 135 |
| 445 | 3300027111 | Ga0209281_1008261 | Ga0209281_10082615 | 135 |
| 446 | 3300027666 | Ga0209282_1021535 | Ga0209282_10215356 | 135 |
| 447 | 3300028017 | Ga0265356_1002639 | Ga0265356_10026392 | 135 |
| 448 | 3300028379 | Ga0268266_10000221 | Ga0268266_1000022146 | 135 |
| 449 | 3300028380 | Ga0268265_10011023 | Ga0268265_100110235 | 135 |
| 450 | 3300028380 | Ga0268265_10386407 | Ga0268265_103864073 | 135 |
| 451 | 3300028380 | Ga0268265_10675092 | Ga0268265_106750922 | 135 |
| 452 | 3300028381 | Ga0268264_10022853 | Ga0268264_100228534 | 135 |
| 453 | 3300028381 | Ga0268264_10072710 | Ga0268264_100727103 | 135 |
| 454 | 3300028381 | Ga0268264_10384630 | Ga0268264_103846303 | 135 |
| 455 | 3300028381 | Ga0268264_10905925 | Ga0268264_109059251 | 135 |
| 456 | 3300030745 | Ga0316182_1019103 | Ga0316182_10191032 | 135 |
| 457 | 3300030745 | Ga0316182_1442232 | Ga0316182_14422321 | 135 |
| 458 | 3300031456 | Ga0307513_10004600 | Ga0307513_100046006 | 135 |
| 459 | 3300031456 | Ga0307513_10011671 | Ga0307513_100116715 | 135 |
| 460 | 3300031456 | Ga0307513_10224612 | Ga0307513_102246122 | 135 |
| 461 | 3300031548 | Ga0307408_100038272 | Ga0307408_1000382723 | 135 |
| 462 | 3300031548 | Ga0307408_100195605 | Ga0307408_1001956052 | 135 |
| 463 | 3300031649 | Ga0307514_10238935 | Ga0307514_102389352 | 135 |
| 464 | 3300031665 | Ga0316575_10001658 | Ga0316575_100016581 | 135 |
| 465 | 3300031711 | Ga0265314_10004277 | Ga0265314_100042778 | 135 |
| 466 | 3300031730 | Ga0307516_10134911 | Ga0307516_101349113 | 135 |
| 467 | 3300031731 | Ga0307405_10165271 | Ga0307405_101652712 | 135 |
| 468 | 3300031824 | Ga0307413_10429560 | Ga0307413_104295602 | 135 |
| 469 | 3300031852 | Ga0307410_10269804 | Ga0307410_102698043 | 135 |
| 470 | 3300031901 | Ga0307406_10185801 | Ga0307406_101858013 | 135 |
| 471 | 3300031911 | Ga0307412_10070535 | Ga0307412_100705353 | 135 |
| 472 | 3300032002 | Ga0307416_100318759 | Ga0307416_1003187593 | 135 |
| 473 | 3300032002 | Ga0307416_102718447 | Ga0307416_1027184471 | 135 |
| 474 | 3300032004 | Ga0307414_10044936 | Ga0307414_100449366 | 135 |
| 475 | 3300032004 | Ga0307414_10204644 | Ga0307414_102046442 | 135 |
| 476 | 3300032005 | Ga0307411_10595240 | Ga0307411_105952402 | 135 |
| 477 | 3300032126 | Ga0307415_101436976 | Ga0307415_1014369762 | 135 |
| 478 | 3300033180 | Ga0307510_10017376 | Ga0307510_100173762 | 135 |
| 479 | 3300033180 | Ga0307510_10339915 | Ga0307510_103399152 | 135 |
| 480 | 3300035117 | Ga0373953_0413203 | Ga0373953_0413203_155_562 | 135 |
| 481 | 3300035170 | Ga0373943_0088993 | Ga0373943_0088993_1070_1477 | 135 |
| 482 | 3300035170 | Ga0373943_0455734 | Ga0373943_0455734_73_480 | 135 |
| 483 | 3300035171 | Ga0373946_0035536 | Ga0373946_0035536_864_1271 | 135 |
| 484 | 3300035171 | Ga0373946_0739299 | Ga0373946_0739299_64_486 | 135 |
| 485 | 3300035172 | Ga0373955_0023276 | Ga0373955_0023276_1597_2004 | 135 |
| 486 | 3300035172 | Ga0373955_0131344 | Ga0373955_0131344_526_939 | 135 |
| 487 | 3300035692 | Ga0373935_0263588 | Ga0373935_0263588_320_727 | 135 |
| 488 | 3300035695 | Ga0373927_0319339 | Ga0373927_0319339_470_877 | 135 |
| 489 | 3300035725 | Ga0373947_0368014 | Ga0373947_0368014_199_606 | 135 |
| 490 | 3300036401 | Ga0373937_0343073 | Ga0373937_0343073_47_454 | 135 |
| 491 | 3300036401 | Ga0373937_1161019 | Ga0373937_1161019_10_423 | 135 |
| 492 | 3300037068 | Ga0373925_0286654 | Ga0373925_0286654_451_858 | 135 |
| 493 | 3300037068 | Ga0373925_1277284 | Ga0373925_1277284_90_503 | 135 |
| 494 | 3300037312 | Ga0395899_0003122 | Ga0395899_0003122_8690_9103 | 135 |
| 495 | 3300037418 | Ga0395900_0000127 | Ga0395900_0000127_93783_94196 | 135 |
| 496 | 3300037418 | Ga0395900_0192414 | Ga0395900_0192414_1120_1527 | 135 |
| 497 | 3300037418 | Ga0395900_1381856 | Ga0395900_1381856_46_453 | 135 |
| 498 | 3300037466 | Ga0395898_0023452 | Ga0395898_0023452_1256_1669 | 135 |
| 499 | 3300037471 | Ga0395905_0003756 | Ga0395905_0003756_11577_11984 | 135 |
| 500 | 3300037471 | Ga0395905_0004727 | Ga0395905_0004727_3982_4395 | 135 |
| 501 | 3300037471 | Ga0395905_0035340 | Ga0395905_0035340_566_979 | 135 |
| 502 | 3300037471 | Ga0395905_0492727 | Ga0395905_0492727_204_611 | 135 |
| 503 | 3300038443 | Ga0395901_0000098 | Ga0395901_0000098_23461_23874 | 135 |
| 504 | 3300038443 | Ga0395901_0328642 | Ga0395901_0328642_534_941 | 135 |
| 505 | 3300038443 | Ga0395901_1668548 | Ga0395901_1668548_30_449 | 135 |
| 506 | 3300039437 | Ga0436365_0185961 | Ga0436365_0185961_297_704 | 135 |
| 507 | 3300041404 | Ga0439436_0073494 | Ga0439436_0073494_144_554 | 135 |
| 508 | 3300041408 | Ga0439453_0006788 | Ga0439453_0006788_1177_1584 | 135 |
| 509 | 3300041413 | Ga0439465_0182310 | Ga0439465_0182310_222_629 | 135 |
| 510 | 3300041413 | Ga0439465_0397657 | Ga0439465_0397657_54_470 | 135 |
| 511 | 3300041452 | Ga0451793_1783914 | Ga0451793_1783914_155_562 | 135 |
| 512 | 3300041512 | Ga0451853_1343388 | Ga0451853_1343388_135_548 | 135 |
| 513 | 3300042007 | Ga0439449_0063176 | Ga0439449_0063176_460_870 | 135 |
| 514 | 3300042014 | Ga0439457_112169 | Ga0439457_112169_72_488 | 135 |
| 515 | 3300042015 | Ga0439462_0102870 | Ga0439462_0102870_358_768 | 135 |
| 516 | 3300042435 | Ga0439434_0063959 | Ga0439434_0063959_456_866 | 135 |
| 517 | 3300044656 | Ga0466969_0032926 | Ga0466969_0032926_2120_2557 | 135 |
| 518 | 3300044684 | Ga0466966_0002396 | Ga0466966_0002396_7187_7594 | 135 |
| 519 | 3300044693 | Ga0466961_0031753 | Ga0466961_0031753_212_619 | 135 |
| 520 | 3300044694 | Ga0466963_0149066 | Ga0466963_0149066_761_1168 | 135 |
| 521 | 3300044706 | Ga0466964_0012873 | Ga0466964_0012873_651_1058 | 135 |
| 522 | 3300044712 | Ga0453684_0049083 | Ga0453684_0049083_4291_4704 | 135 |
| 523 | 3300044719 | Ga0466971_0036994 | Ga0466971_0036994_1304_1711 | 135 |
| 524 | 3300044735 | Ga0466968_0014677 | Ga0466968_0014677_1327_1734 | 135 |
| 525 | 3300044735 | Ga0466968_0031665 | Ga0466968_0031665_566_973 | 135 |
| 526 | 3300044842 | Ga0466957_0004514 | Ga0466957_0004514_1456_1863 | 135 |
| 527 | 3300045049 | Ga0466959_0004778 | Ga0466959_0004778_2808_3215 | 135 |
| 528 | 3300045049 | Ga0466959_0098199 | Ga0466959_0098199_595_1032 | 135 |
| 529 | 3300045836 | Ga0466958_0027877 | Ga0466958_0027877_180_587 | 135 |
| 530 | 3300045976 | Ga0466967_0134351 | Ga0466967_0134351_1185_1592 | 135 |
| 531 | 3300045976 | Ga0466967_0350179 | Ga0466967_0350179_504_911 | 135 |
| 532 | 3300046452 | Ga0495617_000337 | Ga0495617_000337_3460_3873 | 135 |
| 533 | 3300046452 | Ga0495617_255395 | Ga0495617_255395_82_495 | 135 |
| 534 | 3300046453 | Ga0495627_016747 | Ga0495627_016747_1322_1729 | 135 |
| 535 | 3300046459 | Ga0495629_0712689 | Ga0495629_0712689_171_584 | 135 |
| 536 | 3300046460 | Ga0495638_0000430 | Ga0495638_0000430_26593_27006 | 135 |
| 537 | 3300046462 | Ga0495651_0953672 | Ga0495651_0953672_84_491 | 135 |
| 538 | 3300046492 | Ga0495585_0000028 | Ga0495585_0000028_12312_12725 | 135 |
| 539 | 3300046501 | Ga0495607_0000438 | Ga0495607_0000438_5189_5602 | 135 |
| 540 | 3300046501 | Ga0495607_0025777 | Ga0495607_0025777_413_823 | 135 |
| 541 | 3300046506 | Ga0495583_0025518 | Ga0495583_0025518_2391_2804 | 135 |
| 542 | 3300046511 | Ga0495608_0489218 | Ga0495608_0489218_109_516 | 135 |
| 543 | 3300046513 | Ga0495616_0357026 | Ga0495616_0357026_147_560 | 135 |
| 544 | 3300046515 | Ga0495620_0323856 | Ga0495620_0323856_61_468 | 135 |
| 545 | 3300046516 | Ga0495628_0487134 | Ga0495628_0487134_202_609 | 135 |
| 546 | 3300046517 | Ga0495630_0341975 | Ga0495630_0341975_565_972 | 135 |
| 547 | 3300046518 | Ga0495631_0004267 | Ga0495631_0004267_4359_4772 | 135 |
| 548 | 3300046519 | Ga0495632_0096863 | Ga0495632_0096863_676_1089 | 135 |
| 549 | 3300046520 | Ga0495637_0005084 | Ga0495637_0005084_1735_2148 | 135 |
| 550 | 3300046524 | Ga0495648_0002326 | Ga0495648_0002326_9939_10352 | 135 |
| 551 | 3300046525 | Ga0495663_0001265 | Ga0495663_0001265_3933_4349 | 135 |
| 552 | 3300046533 | Ga0495640_0477513 | Ga0495640_0477513_141_548 | 135 |
| 553 | 3300046538 | Ga0495609_0185436 | Ga0495609_0185436_71_484 | 135 |
| 554 | 3300046615 | Ga0495656_0003485 | Ga0495656_0003485_382_789 | 135 |
| 555 | 3300046616 | Ga0495668_0005604 | Ga0495668_0005604_7495_7908 | 135 |
| 556 | 3300046616 | Ga0495668_0153508 | Ga0495668_0153508_695_1102 | 135 |
| 557 | 3300046642 | Ga0495634_0398660 | Ga0495634_0398660_296_703 | 135 |
| 558 | 3300046648 | Ga0495611_0017877 | Ga0495611_0017877_2405_2818 | 135 |
| 559 | 3300046660 | Ga0495625_0263704 | Ga0495625_0263704_364_780 | 135 |
| 560 | 3300046664 | Ga0495659_0040301 | Ga0495659_0040301_672_1079 | 135 |
| 561 | 3300046665 | Ga0495661_0010391 | Ga0495661_0010391_5881_6294 | 135 |
| 562 | 3300046665 | Ga0495661_0448951 | Ga0495661_0448951_74_487 | 135 |
| 563 | 3300046678 | Ga0495599_0094041 | Ga0495599_0094041_713_1120 | 135 |
| 564 | 3300046679 | Ga0495623_0515199 | Ga0495623_0515199_153_560 | 135 |
| 565 | 3300046681 | Ga0495647_0168550 | Ga0495647_0168550_290_697 | 135 |
| 566 | 3300046683 | Ga0495658_0040275 | Ga0495658_0040275_1638_2045 | 135 |
| 567 | 3300046684 | Ga0495669_0005214 | Ga0495669_0005214_1389_1796 | 135 |
| 568 | 3300046691 | Ga0495670_0002216 | Ga0495670_0002216_5206_5619 | 135 |
| 569 | 3300046692 | Ga0495671_0003326 | Ga0495671_0003326_4087_4500 | 135 |
| 570 | 3300046692 | Ga0495671_0409018 | Ga0495671_0409018_37_453 | 135 |
| 571 | 3300046794 | Ga0495589_0000523 | Ga0495589_0000523_23684_24097 | 135 |
| 572 | 3300046794 | Ga0495589_0200348 | Ga0495589_0200348_357_770 | 135 |
| 573 | 3300046810 | Ga0495660_0000076 | Ga0495660_0000076_97493_97906 | 135 |
| 574 | 3300046810 | Ga0495660_0000567 | Ga0495660_0000567_11310_11723 | 135 |
| 575 | 3300047318 | Ga0495636_0022435 | Ga0495636_0022435_2092_2499 | 135 |
| 576 | 3300047318 | Ga0495636_0170311 | Ga0495636_0170311_28_435 | 135 |
| 577 | 3300047318 | Ga0495636_0349632 | Ga0495636_0349632_85_492 | 135 |
| 578 | 3300047322 | Ga0495680_0749047 | Ga0495680_0749047_120_533 | 135 |
| 579 | 3300047445 | Ga0495677_0149952 | Ga0495677_0149952_202_609 | 135 |
| 580 | 3300047446 | Ga0495679_000001 | Ga0495679_000001_1316821_1317234 | 135 |
| 581 | 3300047469 | Ga0495673_0000087 | Ga0495673_0000087_62102_62515 | 135 |
| 582 | 3300047469 | Ga0495673_0001346 | Ga0495673_0001346_14902_15315 | 135 |
| 583 | 3300047469 | Ga0495673_0108343 | Ga0495673_0108343_391_807 | 135 |
| 584 | 3300047469 | Ga0495673_0164798 | Ga0495673_0164798_323_736 | 135 |
| 585 | 3300047471 | Ga0495684_0222066 | Ga0495684_0222066_533_940 | 135 |
| 586 | 3300047472 | Ga0495686_0138193 | Ga0495686_0138193_69_482 | 135 |
| 587 | 3300047472 | Ga0495686_0182569 | Ga0495686_0182569_358_768 | 135 |
| 588 | 3300048903 | Ga0496100_0011561 | Ga0496100_0011561_2571_2984 | 135 |
| 589 | 3300048904 | Ga0496101_0005404 | Ga0496101_0005404_7584_7997 | 135 |
| 590 | 3300048910 | Ga0496107_0797028 | Ga0496107_0797028_273_680 | 135 |
| 591 | 3300048914 | Ga0496111_0481930 | Ga0496111_0481930_145_555 | 135 |
| 592 | 3300048918 | Ga0496115_0288793 | Ga0496115_0288793_304_714 | 135 |
| 593 | 3300048921 | Ga0496118_0203476 | Ga0496118_0203476_193_609 | 135 |
| 594 | 3300048924 | Ga0496121_0001673 | Ga0496121_0001673_29677_30090 | 135 |
| 595 | 3300048924 | Ga0496121_0348763 | Ga0496121_0348763_25_432 | 135 |
| 596 | 3300048924 | Ga0496121_0363492 | Ga0496121_0363492_99_509 | 135 |
| 597 | 3300048925 | Ga0496122_0012141 | Ga0496122_0012141_4628_5035 | 135 |
| 598 | 3300048925 | Ga0496122_0041865 | Ga0496122_0041865_2514_2927 | 135 |
| 599 | 3300048925 | Ga0496122_0145357 | Ga0496122_0145357_439_852 | 135 |
| 600 | 3300048925 | Ga0496122_0192190 | Ga0496122_0192190_158_574 | 135 |
| 601 | 3300048926 | Ga0496123_0003232 | Ga0496123_0003232_17664_18077 | 135 |
| 602 | 3300048926 | Ga0496123_0040310 | Ga0496123_0040310_1993_2400 | 135 |
| 603 | 3300048926 | Ga0496123_0152610 | Ga0496123_0152610_440_847 | 135 |
| 604 | 3300048926 | Ga0496123_0321276 | Ga0496123_0321276_272_688 | 135 |
| 605 | 3300048927 | Ga0496124_0111309 | Ga0496124_0111309_830_1237 | 135 |
| 606 | 3300049459 | Ga0495678_000028 | Ga0495678_000028_44615_45028 | 135 |
| 607 | 3300049460 | Ga0495682_0002363 | Ga0495682_0002363_1205_1618 | 135 |
| 608 | 3300049460 | Ga0495682_0011933 | Ga0495682_0011933_245_658 | 135 |
| 609 | 3300049523 | Ga0501300_052506 | Ga0501300_052506_72_503 | 135 |
| 610 | 3300049569 | Ga0501032_0118318 | Ga0501032_0118318_18_434 | 135 |
| 611 | 3300049570 | Ga0501033_0101555 | Ga0501033_0101555_1490_1906 | 135 |
| 612 | 3300049570 | Ga0501033_0218682 | Ga0501033_0218682_439_849 | 135 |
| 613 | 3300049571 | Ga0501034_0006833 | Ga0501034_0006833_1838_2248 | 135 |
| 614 | 3300049571 | Ga0501034_0009247 | Ga0501034_0009247_7804_8211 | 135 |
| 615 | 3300049571 | Ga0501034_0141331 | Ga0501034_0141331_1219_1635 | 135 |
| 616 | 3300049571 | Ga0501034_0465960 | Ga0501034_0465960_183_590 | 135 |
| 617 | 3300049571 | Ga0501034_0513540 | Ga0501034_0513540_595_1005 | 135 |
| 618 | 3300049572 | Ga0501036_1434206 | Ga0501036_1434206_112_522 | 135 |
| 619 | 3300049573 | Ga0501037_0033835 | Ga0501037_0033835_386_808 | 135 |
| 620 | 3300049573 | Ga0501037_0042176 | Ga0501037_0042176_1494_1904 | 135 |
| 621 | 3300049578 | Ga0501042_1440047 | Ga0501042_1440047_54_461 | 135 |
| 622 | 3300049579 | Ga0501043_0162565 | Ga0501043_0162565_608_1018 | 135 |
| 623 | 3300049579 | Ga0501043_0977267 | Ga0501043_0977267_19_426 | 135 |
| 624 | 3300049581 | Ga0501047_0001004 | Ga0501047_0001004_15985_16392 | 135 |
| 625 | 3300049581 | Ga0501047_0098285 | Ga0501047_0098285_518_925 | 135 |
| 626 | 3300049581 | Ga0501047_0677351 | Ga0501047_0677351_57_467 | 135 |
| 627 | 3300049582 | Ga0501048_0365626 | Ga0501048_0365626_202_612 | 135 |
| 628 | 3300049590 | Ga0501074_0218471 | Ga0501074_0218471_505_912 | 135 |
| 629 | 3300049742 | Ga0501080_0270694 | Ga0501080_0270694_673_1080 | 135 |
| 630 | 3300049762 | Ga0501265_006029 | Ga0501265_006029_527_958 | 135 |
| 631 | 3300049766 | Ga0501269_002551 | Ga0501269_002551_1450_1857 | 135 |
| 632 | 3300049772 | Ga0501275_000999 | Ga0501275_000999_1317_1748 | 135 |
| 633 | 3300049822 | Ga0501035_0094503 | Ga0501035_0094503_1220_1630 | 135 |
| 634 | 3300049822 | Ga0501035_0125653 | Ga0501035_0125653_1666_2082 | 135 |
| 635 | 3300049822 | Ga0501035_0528885 | Ga0501035_0528885_196_603 | 135 |
| 636 | 3300049823 | Ga0501044_0026683 | Ga0501044_0026683_302_709 | 135 |
| 637 | 3300049823 | Ga0501044_0051951 | Ga0501044_0051951_3640_4050 | 135 |
| 638 | 3300049823 | Ga0501044_0159204 | Ga0501044_0159204_978_1394 | 135 |
| 639 | 3300049823 | Ga0501044_0588976 | Ga0501044_0588976_280_687 | 135 |
| 640 | 3300049823 | Ga0501044_0698258 | Ga0501044_0698258_481_888 | 135 |
| 641 | 3300049823 | Ga0501044_0997468 | Ga0501044_0997468_61_468 | 135 |
| 642 | 3300050490 | nmdc:mga03n38_163407_c1 | nmdc:mga03n38_163407_c1_636_1043 | 135 |
| 643 | 3300050490 | nmdc:mga03n38_499416_c1 | nmdc:mga03n38_499416_c1_215_631 | 135 |
| 644 | 3300050492 | nmdc:mga0yw44_826801_c1 | nmdc:mga0yw44_826801_c1_36_443 | 135 |
| 645 | 3300050493 | nmdc:mga0k408_44177_c1 | nmdc:mga0k408_44177_c1_1299_1706 | 135 |
| 646 | 3300050494 | nmdc:mga06z11_203515_c1 | nmdc:mga06z11_203515_c1_128_535 | 135 |
| 647 | 3300050495 | nmdc:mga04h51_260696_c1 | nmdc:mga04h51_260696_c1_165_572 | 135 |
| 648 | 3300050496 | nmdc:mga07m45_194545_c1 | nmdc:mga07m45_194545_c1_460_867 | 135 |
| 649 | 3300050496 | nmdc:mga07m45_221047_c1 | nmdc:mga07m45_221047_c1_201_608 | 135 |
| 650 | 3300050507 | nmdc:mga05p37_251174_c1 | nmdc:mga05p37_251174_c1_111_542 | 135 |
| 651 | 3300050516 | nmdc:mga0sz30_143009_c1 | nmdc:mga0sz30_143009_c1_604_1011 | 135 |
| 652 | 3300053087 | Ga0500643_000152 | Ga0500643_000152_31569_31982 | 135 |
| 653 | 3300053103 | Ga0500555_000409 | Ga0500555_000409_9809_10222 | 135 |
| 654 | 3300053108 | Ga0500562_090737 | Ga0500562_090737_322_735 | 135 |
| 655 | 3300053131 | Ga0500652_224977 | Ga0500652_224977_322_735 | 135 |
| 656 | 3300053140 | Ga0500573_0165823 | Ga0500573_0165823_133_540 | 135 |
| 657 | 3300053178 | Ga0500637_0453864 | Ga0500637_0453864_19_426 | 135 |
| 658 | 3300053730 | Ga0500645_002248 | Ga0500645_002248_2698_3111 | 135 |
| 659 | 3300061719 | Ga0466962_0008145 | Ga0466962_0008145_1488_1895 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9366 | 1 | 132 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.9329 | 1 | 130 |
| 5umw-assembly2.cif.gz_B | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9308 | 2 | 134 |
| 5umw-assembly3.cif.gz_D | crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 | 0.9297 | 1 | 132 |
| 6cky-assembly1.cif.gz_B | crystal structure of ucms2 | 0.9062 | 1 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9131 | 83 | 131 | 3.30.720.110 |
| 3itwB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8522 | 83 | 132 | 3.30.720.110 |
| 5uhjB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8308 | 1 | 132 | 3.10.180.10 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8244 | 81 | 134 | 3.30.720.110 |
| 4g6xA00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8228 | 2 | 132 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257KH99-F1-model_v4 | Glyoxalase | 0.9973 | 1 | 132 |
|
| AF-A0A0Q8S3J9-F1-model_v4 | Glyoxalase | 0.9899 | 2 | 133 |
|
| AF-A0A522EC71-F1-model_v4 | VOC family protein | 0.9877 | 1 | 132 |
|
| AF-A0A1H1H8R4-F1-model_v4 | Catechol 2,3-dioxygenase | 0.9874 | 1 | 134 |
GO:0051213
|
| AF-A0A7Y8GXY9-F1-model_v4 | VOC family protein | 0.9841 | 1 | 133 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar