F473268

General Info

Members Datasets Scaffolds Average Seq Length
659 373 636 136

Family's Representative Sequence

Representative Sequence 3300042007|Ga0439449_0004030|Ga0439449_0004030_5231_5674
Length 147
Sequence MNHAQHLQPDVAVAGMVVGLYVRDQDEAHDFYVGKLGFRVHTDARNGDYRWLTVQHPDQPSLQIGLFAPEQPMIDAATVQALREIVAKGAMPPLVLIVDDCRAAYAQMRARNVEFTQEPVERYGSIDANFRDPSGNGWKMIQSRKAS

Samples

Sample ID Description Type Environment
1 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
8 2734482264 Dyella sp. AD052 Isolate Unclassified
9 2738541277 Variovorax sp. GV051 Isolate Unclassified
10 2738543009 Luteibacter sp. OK325 Isolate Unclassified
11 2738543013 Variovorax sp. BT01 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
14 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
15 2858950400 Achromobacter sp. K91 Isolate Unclassified
16 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
17 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
18 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
19 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
20 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
21 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
22 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
23 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
26 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
27 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
28 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
34 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
35 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
36 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
39 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
45 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
53 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
56 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
63 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
64 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
65 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
66 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
70 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
81 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
86 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
87 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
88 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
97 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
129 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
130 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
131 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
132 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
133 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
138 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
143 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
200 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
201 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
206 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
207 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
208 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
209 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
219 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
220 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
226 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
227 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
243 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
244 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
245 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
249 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
252 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
260 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
261 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
262 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
265 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
266 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
267 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
268 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
269 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
270 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
271 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
276 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
277 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
278 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
279 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
280 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
283 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
284 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
285 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
286 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
287 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
297 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
298 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
299 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
300 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
301 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
302 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
303 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
304 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
305 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
312 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
313 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
314 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
315 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
325 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
326 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
327 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
330 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
331 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
343 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
344 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
345 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
349 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
350 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
351 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
352 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
353 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
355 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
356 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
357 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
358 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
359 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
360 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
361 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
362 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
363 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
366 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
367 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
368 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
371 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
372 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.51
Metatranscriptomes 0
Isolates 3.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.75
Nodule 0.91
Rhizoplane 1.67
Rhizosphere 77.09
Stem 0
Stem Tuber 0
Unclassified 7.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000039 3300002704 Bacteria 91670
2 JGI25156J39149_1000096 3300002705 Bacteria 64397
3 JGI25154J39366_1000077 3300002738 Bacteria 90455
4 JGI25157J39369_1000065 3300002741 Bacteria 98536
5 JGI25151J46595_10000399 3300003187 Bacteria 45110
6 JGI25151J46595_10001711 3300003187 Bacteria 14320
7 JGI25406J46586_10045925 3300003203 Bacteria 1500
8 JGI25153J46596_10063526 3300003215 Bacteria 989
9 Ga0055532_1000005 3300003758 Bacteria 458107
10 Ga0055535_1002690 3300003761 Bacteria 5779
11 Ga0055529_1014460 3300003763 Bacteria 999
12 Ga0055537_1000416 3300003773 Bacteria 27832
13 Ga0055534_1000008 3300003784 Bacteria 211098
14 Ga0055528_1000831 3300003790 Bacteria 21133
15 Ga0055540_1007192 3300003792 Bacteria 4257
16 Ga0055531_10002125 3300003794 Bacteria 13587
17 Ga0065165_1000241 3300005262 Bacteria 93644
18 Ga0065715_11107217 3300005293 Bacteria 518
19 Ga0070658_10014457 3300005327 Bacteria 6334
20 Ga0070658_10508521 3300005327 Bacteria 1041
21 Ga0070676_10001625 3300005328 Bacteria 11423
22 Ga0070676_10686776 3300005328 Bacteria 746
23 Ga0070683_100033656 3300005329 Bacteria 4674
24 Ga0070690_100073988 3300005330 Bacteria 2218
25 Ga0070677_10104135 3300005333 Bacteria 1256
26 Ga0070677_10447052 3300005333 Bacteria 691
27 Ga0068869_100003838 3300005334 Bacteria 9265
28 Ga0068869_100146296 3300005334 Bacteria 1829
29 Ga0070666_10012977 3300005335 Bacteria 5274
30 Ga0070666_10863369 3300005335 Bacteria 668
31 Ga0070682_101036956 3300005337 Bacteria 683
32 Ga0068868_100058614 3300005338 Bacteria 3044
33 Ga0070689_100359388 3300005340 Bacteria 1223
34 Ga0070687_100116721 3300005343 Bacteria 1520
35 Ga0070661_100039453 3300005344 Bacteria 3440
36 Ga0070668_100001082 3300005347 Bacteria 19162
37 Ga0070668_100109201 3300005347 Bacteria 2201
38 Ga0070669_100063828 3300005353 Bacteria 2711
39 Ga0070675_100031694 3300005354 Bacteria 4275
40 Ga0070671_100107502 3300005355 Bacteria 2342
41 Ga0070671_100598091 3300005355 Bacteria 953
42 Ga0070674_100012872 3300005356 Bacteria 5151
43 Ga0070674_100294347 3300005356 Bacteria 1292
44 Ga0070673_102243076 3300005364 Bacteria 519
45 Ga0070659_100297161 3300005366 Bacteria 1346
46 Ga0070659_100317670 3300005366 Bacteria 1301
47 Ga0070659_101444575 3300005366 Bacteria 612
48 Ga0070667_100007734 3300005367 Bacteria 8911
49 Ga0070667_100008658 3300005367 Bacteria 8431
50 Ga0070667_100114328 3300005367 Bacteria 2343
51 Ga0070667_100751332 3300005367 Bacteria 904
52 Ga0070710_10816837 3300005437 Bacteria 667
53 Ga0070700_100143113 3300005441 Bacteria 1627
54 Ga0070700_100371217 3300005441 Bacteria 1067
55 Ga0070708_100730051 3300005445 Bacteria 932
56 Ga0070708_101587597 3300005445 Bacteria 609
57 Ga0070663_100101137 3300005455 Bacteria 2151
58 Ga0070663_100318697 3300005455 Bacteria 1249
59 Ga0070678_100016063 3300005456 Bacteria 4776
60 Ga0070662_100017280 3300005457 Bacteria 4860
61 Ga0070662_100062351 3300005457 Bacteria 2724
62 Ga0068867_100004243 3300005459 Bacteria 10087
63 Ga0068867_100034370 3300005459 Bacteria 3674
64 Ga0068867_100719589 3300005459 Bacteria 883
65 Ga0070706_101434306 3300005467 Bacteria 632
66 Ga0070698_100396258 3300005471 Bacteria 1313
67 Ga0070679_100904918 3300005530 Bacteria 826
68 Ga0070684_100045385 3300005535 Bacteria 3806
69 Ga0068853_100174084 3300005539 Bacteria 1948
70 Ga0068853_100785640 3300005539 Bacteria 911
71 Ga0068853_101293490 3300005539 Bacteria 705
72 Ga0070672_100005393 3300005543 Bacteria 8469
73 Ga0070693_100072588 3300005547 Bacteria 2030
74 Ga0070665_100000195 3300005548 Bacteria 106493
75 Ga0070665_100001353 3300005548 Bacteria 29032
76 Ga0068855_100007328 3300005563 Bacteria 13367
77 Ga0068855_100111340 3300005563 Bacteria 3143
78 Ga0068855_100322998 3300005563 Bacteria 1706
79 Ga0068855_101204898 3300005563 Bacteria 787
80 Ga0068854_100541365 3300005578 Bacteria 986
81 Ga0068852_100003658 3300005616 Bacteria 10771
82 Ga0068852_100070517 3300005616 Bacteria 3066
83 Ga0068859_100112090 3300005617 Bacteria 2791
84 Ga0068859_100149643 3300005617 Bacteria 2410
85 Ga0068859_100179980 3300005617 Bacteria 2197
86 Ga0068859_100208753 3300005617 Bacteria 2039
87 Ga0068859_100241760 3300005617 Bacteria 1895
88 Ga0068864_100627839 3300005618 Bacteria 1045
89 Ga0068864_100671027 3300005618 Bacteria 1011
90 Ga0068866_10043241 3300005718 Bacteria 2247
91 Ga0068866_10059287 3300005718 Bacteria 1980
92 Ga0068861_100006162 3300005719 Bacteria 8158
93 Ga0068861_100161157 3300005719 Bacteria 1850
94 Ga0068861_100943535 3300005719 Bacteria 820
95 Ga0068851_10023721 3300005834 Bacteria 3000
96 Ga0068863_100004706 3300005841 Bacteria 13448
97 Ga0068863_100019695 3300005841 Bacteria 6454
98 Ga0068863_100250957 3300005841 Bacteria 1709
99 Ga0068863_100924989 3300005841 Bacteria 873
100 Ga0068860_100005570 3300005843 Bacteria 12734
101 Ga0068860_100113682 3300005843 Bacteria 2588
102 Ga0068860_100162228 3300005843 Bacteria 2155
103 Ga0068860_100479607 3300005843 Bacteria 1240
104 Ga0068862_100010381 3300005844 Bacteria 7685
105 Ga0068862_100096765 3300005844 Bacteria 2577
106 Ga0068862_101717683 3300005844 Bacteria 636
107 Ga0081455_10150777 3300005937 Bacteria 1793
108 Ga0081539_10000829 3300005985 Bacteria 59715
109 Ga0070717_10375592 3300006028 Bacteria 1274
110 Ga0075365_10040676 3300006038 Bacteria 3032
111 Ga0075365_10093114 3300006038 Bacteria 2055
112 Ga0075365_10263267 3300006038 Bacteria 1212
113 Ga0075365_10439395 3300006038 Bacteria 921
114 Ga0075368_10182323 3300006042 Bacteria 885
115 Ga0075368_10243839 3300006042 Bacteria 767
116 Ga0075363_100100511 3300006048 Bacteria 1600
117 Ga0075363_100176715 3300006048 Bacteria 1213
118 Ga0075363_100288502 3300006048 Bacteria 951
119 Ga0075363_100601211 3300006048 Bacteria 659
120 Ga0075364_10082145 3300006051 Bacteria 2131
121 Ga0075364_10332621 3300006051 Bacteria 1035
122 Ga0075362_10035047 3300006177 Bacteria 2190
123 Ga0075362_10173451 3300006177 Bacteria 1043
124 Ga0075367_10095592 3300006178 Bacteria 1812
125 Ga0075367_10256315 3300006178 Bacteria 1097
126 Ga0075369_10392010 3300006186 Bacteria 654
127 Ga0075366_10013628 3300006195 Bacteria 4634
128 Ga0075366_10069201 3300006195 Bacteria 2101
129 Ga0075366_10860315 3300006195 Bacteria 564
130 Ga0097621_100376330 3300006237 Bacteria 1268
131 Ga0097621_100588835 3300006237 Bacteria 1016
132 Ga0075370_10004353 3300006353 Bacteria 6864
133 Ga0075370_10066987 3300006353 Bacteria 2049
134 Ga0075370_10084255 3300006353 Bacteria 1830
135 Ga0075370_10232002 3300006353 Bacteria 1092
136 Ga0075370_10366118 3300006353 Bacteria 862
137 Ga0075370_10418804 3300006353 Bacteria 805
138 Ga0068865_100031766 3300006881 Bacteria 3523
139 Ga0068865_100062565 3300006881 Bacteria 2613
140 Ga0068865_100418907 3300006881 Bacteria 1101
141 Ga0097620_100112089 3300006931 Bacteria 2791
142 Ga0097620_100149629 3300006931 Bacteria 2410
143 Ga0097620_100179981 3300006931 Bacteria 2197
144 Ga0097620_100208757 3300006931 Bacteria 2039
145 Ga0097620_100241759 3300006931 Bacteria 1895
146 Ga0079104_1006554 3300006946 Bacteria 4378
147 Ga0099826_10000171 3300006948 Bacteria 27420
148 Ga0099794_10038868 3300007265 Bacteria 2255
149 Ga0099795_10000001 3300007788 Bacteria 179944
150 Ga0105240_11389130 3300009093 Bacteria 738
151 Ga0111539_10726933 3300009094 Bacteria 1156
152 Ga0105245_10097764 3300009098 Bacteria 2711
153 Ga0105247_10003540 3300009101 Bacteria 10149
154 Ga0105247_11645939 3300009101 Bacteria 529
155 Ga0105243_10028062 3300009148 Bacteria 4318
156 Ga0105243_10134712 3300009148 Bacteria 2100
157 Ga0105243_10279803 3300009148 Bacteria 1502
158 Ga0105242_10163965 3300009176 Bacteria 1948
159 Ga0105248_10012920 3300009177 Bacteria 9205
160 Ga0105248_10021265 3300009177 Bacteria 7189
161 Ga0105238_10008209 3300009551 Bacteria 10445
162 Ga0105249_10042383 3300009553 Bacteria 4139
163 Ga0105249_10085916 3300009553 Bacteria 2933
164 Ga0105249_10113763 3300009553 Bacteria 2561
165 Ga0105249_10543612 3300009553 Bacteria 1211
166 Ga0105249_11766092 3300009553 Bacteria 691
167 Ga0099796_10000001 3300010159 Bacteria 107173
168 Ga0105246_10000157 3300011119 Bacteria 32454
169 Ga0105246_11661888 3300011119 Bacteria 606
170 Ga0157371_10637262 3300013102 Bacteria 795
171 Ga0157371_11222765 3300013102 Bacteria 579
172 Ga0157370_10224367 3300013104 Bacteria 1740
173 Ga0157370_10234533 3300013104 Bacteria 1698
174 Ga0157370_10892328 3300013104 Bacteria 807
175 Ga0157369_10119712 3300013105 Bacteria 2794
176 Ga0157369_11075206 3300013105 Bacteria 823
177 Ga0157374_10371446 3300013296 Bacteria 1423
178 Ga0157374_10430566 3300013296 Bacteria 1319
179 Ga0157374_10446667 3300013296 Bacteria 1294
180 Ga0157378_10007853 3300013297 Bacteria 9312
181 Ga0163162_10146196 3300013306 Bacteria 2480
182 Ga0157372_10387163 3300013307 Bacteria 1629
183 Ga0157372_10764561 3300013307 Bacteria 1123
184 Ga0157375_10349763 3300013308 Bacteria 1644
185 Ga0157375_10541888 3300013308 Bacteria 1326
186 Ga0157375_10883614 3300013308 Bacteria 1039
187 Ga0157375_11100103 3300013308 Bacteria 930
188 Ga0163163_10482068 3300014325 Bacteria 1301
189 Ga0157380_10005141 3300014326 Bacteria 9143
190 Ga0157380_10023694 3300014326 Bacteria 4634
191 Ga0157380_10083835 3300014326 Bacteria 2612
192 Ga0157379_10039462 3300014968 Bacteria 4212
193 Ga0157379_11018166 3300014968 Bacteria 790
194 Ga0157376_10224722 3300014969 Bacteria 1741
195 Ga0182006_1000077 3300015261 Bacteria 127377
196 Ga0182007_10112623 3300015262 Bacteria 906
197 Ga0182005_1009286 3300015265 Bacteria 2865
198 Ga0163161_10033690 3300017792 Bacteria 3660
199 Ga0163161_10040299 3300017792 Bacteria 3354
200 Ga0163161_10405563 3300017792 Bacteria 1094
201 Ga0163161_10650262 3300017792 Bacteria 873
202 Ga0209435_100043 3300025206 Bacteria 102049
203 Ga0209435_100050 3300025206 Bacteria 91356
204 Ga0209147_100011 3300025229 Bacteria 702140
205 Ga0209258_100401 3300025242 Bacteria 54149
206 Ga0209646_1000161 3300025246 Bacteria 91356
207 Ga0209026_1000173 3300025250 Bacteria 98585
208 Ga0209759_1000169 3300025256 Bacteria 110110
209 Ga0209565_1000042 3300025263 Bacteria 239712
210 Ga0209455_1002552 3300025272 Bacteria 6961
211 Ga0209673_1000071 3300025273 Bacteria 239966
212 Ga0209673_1011136 3300025273 Bacteria 3730
213 Ga0209130_1003792 3300025284 Bacteria 6141
214 Ga0209675_1000041 3300025291 Bacteria 239712
215 Ga0209675_1000811 3300025291 Bacteria 20589
216 Ga0209676_1006071 3300025292 Bacteria 6081
217 Ga0209025_1000552 3300025294 Bacteria 69909
218 Ga0209564_1045121 3300025295 Bacteria 1137
219 Ga0209758_1002239 3300025297 Bacteria 20070
220 Ga0209050_1000221 3300025298 Bacteria 126843
221 Ga0209050_1057544 3300025298 Bacteria 939
222 Ga0209256_1033506 3300025299 Bacteria 1381
223 Ga0209051_1000059 3300025303 Bacteria 260307
224 Ga0209051_1006159 3300025303 Bacteria 6815
225 Ga0209051_1089366 3300025303 Bacteria 861
226 Ga0209257_1000022 3300025304 Bacteria 765258
227 Ga0209257_1000302 3300025304 Bacteria 108038
228 Ga0209257_1004206 3300025304 Bacteria 11418
229 Ga0207697_10024462 3300025315 Bacteria 2472
230 Ga0207656_10219007 3300025321 Bacteria 924
231 Ga0207682_10359853 3300025893 Bacteria 686
232 Ga0207642_10134585 3300025899 Bacteria 1294
233 Ga0207710_10003190 3300025900 Bacteria 7337
234 Ga0207680_10046357 3300025903 Bacteria 2569
235 Ga0207680_10610101 3300025903 Bacteria 781
236 Ga0207645_10028998 3300025907 Bacteria 3568
237 Ga0207705_10036317 3300025909 Bacteria 3526
238 Ga0207684_11266598 3300025910 Bacteria 608
239 Ga0207662_10020646 3300025918 Bacteria 3760
240 Ga0207657_10708875 3300025919 Bacteria 781
241 Ga0207649_10118467 3300025920 Bacteria 1781
242 Ga0207649_10193851 3300025920 Bacteria 1431
243 Ga0207646_11549483 3300025922 Bacteria 573
244 Ga0207681_10022206 3300025923 Bacteria 4044
245 Ga0207681_10665180 3300025923 Bacteria 864
246 Ga0207694_10004840 3300025924 Bacteria 10452
247 Ga0207650_11500607 3300025925 Bacteria 573
248 Ga0207659_10063895 3300025926 Bacteria 2662
249 Ga0207659_10527232 3300025926 Bacteria 1002
250 Ga0207664_10132789 3300025929 Bacteria 2097
251 Ga0207644_10657057 3300025931 Bacteria 873
252 Ga0207644_10840001 3300025931 Bacteria 769
253 Ga0207644_11596438 3300025931 Bacteria 547
254 Ga0207690_10124602 3300025932 Bacteria 1877
255 Ga0207690_10798893 3300025932 Bacteria 780
256 Ga0207706_10002140 3300025933 Bacteria 19325
257 Ga0207706_10017021 3300025933 Bacteria 6559
258 Ga0207686_10050905 3300025934 Bacteria 2578
259 Ga0207686_10533978 3300025934 Bacteria 915
260 Ga0207709_10019065 3300025935 Bacteria 3850
261 Ga0207709_10119189 3300025935 Bacteria 1779
262 Ga0207709_10149996 3300025935 Bacteria 1613
263 Ga0207670_10568791 3300025936 Bacteria 928
264 Ga0207669_10010674 3300025937 Bacteria 4431
265 Ga0207669_10214708 3300025937 Bacteria 1407
266 Ga0207669_10967535 3300025937 Bacteria 714
267 Ga0207704_10034967 3300025938 Bacteria 2874
268 Ga0207704_10044324 3300025938 Bacteria 2634
269 Ga0207704_10137074 3300025938 Bacteria 1705
270 Ga0207691_10018902 3300025940 Bacteria 6527
271 Ga0207711_10029322 3300025941 Bacteria 4640
272 Ga0207711_10074050 3300025941 Bacteria 2961
273 Ga0207689_10007114 3300025942 Bacteria 9837
274 Ga0207661_10197897 3300025944 Bacteria 1765
275 Ga0207667_10005245 3300025949 Bacteria 15813
276 Ga0207667_10066225 3300025949 Bacteria 3766
277 Ga0207667_10246777 3300025949 Bacteria 1827
278 Ga0207651_10098316 3300025960 Bacteria 2164
279 Ga0207651_10149006 3300025960 Bacteria 1819
280 Ga0207651_10370334 3300025960 Bacteria 1212
281 Ga0207712_10113835 3300025961 Bacteria 2034
282 Ga0207712_10148777 3300025961 Bacteria 1806
283 Ga0207668_10000003 3300025972 Bacteria 206959
284 Ga0207668_10034578 3300025972 Bacteria 3357
285 Ga0207668_10594638 3300025972 Bacteria 963
286 Ga0207658_10005552 3300025986 Bacteria 8637
287 Ga0207658_10011119 3300025986 Bacteria 6130
288 Ga0207658_10019554 3300025986 Bacteria 4684
289 Ga0207658_10662281 3300025986 Bacteria 941
290 Ga0207658_10742530 3300025986 Bacteria 888
291 Ga0207677_12094598 3300026023 Bacteria 526
292 Ga0207703_10094551 3300026035 Bacteria 2520
293 Ga0207703_10565673 3300026035 Bacteria 1073
294 Ga0207639_10099092 3300026041 Bacteria 2351
295 Ga0207639_10877122 3300026041 Bacteria 838
296 Ga0207678_10070271 3300026067 Bacteria 3002
297 Ga0207678_10095432 3300026067 Bacteria 2542
298 Ga0207678_10345080 3300026067 Bacteria 1283
299 Ga0207708_10042217 3300026075 Bacteria 3477
300 Ga0207708_10062994 3300026075 Bacteria 2833
301 Ga0207708_10326352 3300026075 Bacteria 1254
302 Ga0207702_10426720 3300026078 Bacteria 1283
303 Ga0207641_10010784 3300026088 Bacteria 7491
304 Ga0207641_10235352 3300026088 Bacteria 1704
305 Ga0207648_10000393 3300026089 Bacteria 48485
306 Ga0207648_10006515 3300026089 Bacteria 11592
307 Ga0207648_11132503 3300026089 Bacteria 734
308 Ga0207676_10504291 3300026095 Bacteria 1149
309 Ga0207676_11324686 3300026095 Bacteria 715
310 Ga0207674_11035860 3300026116 Bacteria 790
311 Ga0207674_11371259 3300026116 Bacteria 676
312 Ga0207675_100001089 3300026118 Bacteria 26890
313 Ga0207675_100001455 3300026118 Bacteria 23732
314 Ga0207675_100013845 3300026118 Bacteria 7521
315 Ga0207675_100590230 3300026118 Bacteria 1113
316 Ga0207675_101700611 3300026118 Bacteria 651
317 Ga0207683_10378464 3300026121 Bacteria 1301
318 Ga0207683_10427665 3300026121 Bacteria 1220
319 Ga0207683_11209825 3300026121 Bacteria 700
320 Ga0207698_10574167 3300026142 Bacteria 1108
321 Ga0207698_10602228 3300026142 Bacteria 1083
322 Ga0207698_11747171 3300026142 Bacteria 637
323 Ga0209281_1008261 3300027111 Bacteria 2541
324 Ga0209282_1021535 3300027666 Bacteria 4073
325 Ga0265356_1002639 3300028017 Bacteria 2351
326 Ga0268266_10000221 3300028379 Bacteria 99332
327 Ga0268266_10002760 3300028379 Bacteria 18356
328 Ga0268265_10011023 3300028380 Bacteria 6106
329 Ga0268265_10386407 3300028380 Bacteria 1289
330 Ga0268265_10675092 3300028380 Bacteria 996
331 Ga0268264_10022853 3300028381 Bacteria 5102
332 Ga0268264_10072710 3300028381 Bacteria 2916
333 Ga0268264_10306343 3300028381 Bacteria 1497
334 Ga0268264_10384630 3300028381 Bacteria 1344
335 Ga0268264_10905925 3300028381 Bacteria 885
336 Ga0316182_1019103 3300030745 Bacteria 1722
337 Ga0316182_1442232 3300030745 Bacteria 620
338 Ga0307513_10004600 3300031456 Bacteria 18380
339 Ga0307513_10011671 3300031456 Bacteria 10901
340 Ga0307513_10224612 3300031456 Bacteria 1696
341 Ga0307408_100038272 3300031548 Bacteria 3383
342 Ga0307408_100195605 3300031548 Bacteria 1633
343 Ga0307408_100337959 3300031548 Bacteria 1274
344 Ga0307514_10238935 3300031649 Bacteria 1091
345 Ga0316575_10001658 3300031665 Bacteria 7284
346 Ga0265314_10004277 3300031711 Bacteria 13355
347 Ga0307516_10134911 3300031730 Bacteria 2244
348 Ga0307405_10165271 3300031731 Bacteria 1572
349 Ga0307405_10914650 3300031731 Bacteria 743
350 Ga0307413_10429560 3300031824 Bacteria 1043
351 Ga0307410_10269804 3300031852 Bacteria 1331
352 Ga0307410_10620628 3300031852 Bacteria 904
353 Ga0307406_10185801 3300031901 Unclassified 1517
354 Ga0307407_10325510 3300031903 Bacteria 1080
355 Ga0307412_10070535 3300031911 Bacteria 2382
356 Ga0307412_11170510 3300031911 Bacteria 687
357 Ga0307412_11879001 3300031911 Bacteria 552
358 Ga0307409_100038783 3300031995 Bacteria 3527
359 Ga0307416_100318759 3300032002 Bacteria 1555
360 Ga0307416_102718447 3300032002 Bacteria 591
361 Ga0307414_10044936 3300032004 Bacteria 3021
362 Ga0307414_10204644 3300032004 Bacteria 1608
363 Ga0307414_10449744 3300032004 Bacteria 1129
364 Ga0307411_10595240 3300032005 Bacteria 950
365 Ga0307415_100853585 3300032126 Bacteria 836
366 Ga0307415_101436976 3300032126 Bacteria 658
367 Ga0307510_10017376 3300033180 Bacteria 8484
368 Ga0307510_10339915 3300033180 Bacteria 953
369 Ga0373953_0413203 3300035117 Bacteria 594
370 Ga0373943_0088993 3300035170 Bacteria 1596
371 Ga0373943_0455734 3300035170 Bacteria 744
372 Ga0373946_0035536 3300035171 Bacteria 2017
373 Ga0373946_0739299 3300035171 Bacteria 516
374 Ga0373955_0023276 3300035172 Bacteria 3154
375 Ga0373955_0131344 3300035172 Bacteria 1462
376 Ga0373931_0613273 3300035691 Bacteria 712
377 Ga0373935_0263588 3300035692 Bacteria 1209
378 Ga0373935_0486260 3300035692 Bacteria 895
379 Ga0373927_0319339 3300035695 Bacteria 1023
380 Ga0373947_0368014 3300035725 Bacteria 966
381 Ga0373937_0343073 3300036401 Bacteria 1414
382 Ga0373937_0424664 3300036401 Bacteria 1262
383 Ga0373937_1024341 3300036401 Bacteria 774
384 Ga0373937_1161019 3300036401 Bacteria 721
385 Ga0373925_0286654 3300037068 Bacteria 1327
386 Ga0373925_0607310 3300037068 Bacteria 901
387 Ga0373925_1277284 3300037068 Bacteria 603
388 Ga0395899_0003122 3300037312 Bacteria 13195
389 Ga0395899_0226277 3300037312 Bacteria 1293
390 Ga0395900_0000127 3300037418 Bacteria 127554
391 Ga0395900_0172671 3300037418 Bacteria 2200
392 Ga0395900_0192414 3300037418 Bacteria 2068
393 Ga0395900_0328240 3300037418 Bacteria 1508
394 Ga0395900_1079469 3300037418 Bacteria 720
395 Ga0395900_1381856 3300037418 Bacteria 617
396 Ga0395898_0023452 3300037466 Bacteria 6235
397 Ga0395898_0222658 3300037466 Bacteria 1799
398 Ga0395898_1268325 3300037466 Bacteria 667
399 Ga0395905_0003756 3300037471 Bacteria 16085
400 Ga0395905_0004727 3300037471 Bacteria 14066
401 Ga0395905_0035340 3300037471 Bacteria 4692
402 Ga0395905_0485846 3300037471 Bacteria 1134
403 Ga0395905_0492727 3300037471 Bacteria 1125
404 Ga0395905_0607564 3300037471 Bacteria 995
405 Ga0395905_1444287 3300037471 Bacteria 592
406 Ga0395901_0000098 3300038443 Bacteria 117656
407 Ga0395901_0125666 3300038443 Bacteria 2695
408 Ga0395901_0328642 3300038443 Bacteria 1581
409 Ga0395901_1120490 3300038443 Bacteria 756
410 Ga0395901_1668548 3300038443 Bacteria 589
411 Ga0436365_0185961 3300039437 Bacteria 849
412 Ga0436365_0936602 3300039437 Bacteria 6401
413 Ga0436361_0945996 3300039447 Bacteria 3339
414 Ga0436362_0689394 3300039453 Bacteria 1074
415 Ga0439436_0073494 3300041404 Bacteria 952
416 Ga0439453_0006788 3300041408 Bacteria 1796
417 Ga0439465_0182310 3300041413 Bacteria 760
418 Ga0439465_0195669 3300041413 Bacteria 735
419 Ga0439465_0397657 3300041413 Bacteria 524
420 Ga0451793_1783914 3300041452 Bacteria 924
421 Ga0451853_1343388 3300041512 Bacteria 602
422 Ga0439449_0004030 3300042007 Bacteria 5686
423 Ga0439449_0015730 3300042007 Bacteria 2844
424 Ga0439449_0063176 3300042007 Bacteria 1366
425 Ga0439455_0117585 3300042012 Bacteria 743
426 Ga0439457_112169 3300042014 Bacteria 641
427 Ga0439462_0102870 3300042015 Bacteria 788
428 Ga0439434_0063959 3300042435 Bacteria 1153
429 Ga0466969_0030177 3300044656 Bacteria 2763
430 Ga0466969_0032926 3300044656 Bacteria 2634
431 Ga0466969_0051825 3300044656 Bacteria 2018
432 Ga0466966_0002396 3300044684 Bacteria 12243
433 Ga0466966_0003316 3300044684 Bacteria 10609
434 Ga0466966_0147177 3300044684 Bacteria 1438
435 Ga0466961_0031753 3300044693 Bacteria 3395
436 Ga0466961_0033166 3300044693 Bacteria 3318
437 Ga0466961_0080610 3300044693 Bacteria 2060
438 Ga0466963_0016396 3300044694 Bacteria 4608
439 Ga0466963_0149066 3300044694 Bacteria 1624
440 Ga0466964_0012873 3300044706 Bacteria 3169
441 Ga0466964_0303751 3300044706 Bacteria 805
442 Ga0453684_0049083 3300044712 Bacteria 5570
443 Ga0466971_0036994 3300044719 Bacteria 2188
444 Ga0466971_0095916 3300044719 Bacteria 1360
445 Ga0466968_0014677 3300044735 Bacteria 3098
446 Ga0466968_0031665 3300044735 Bacteria 2195
447 Ga0466957_0004514 3300044842 Bacteria 7768
448 Ga0466957_0059800 3300044842 Bacteria 2336
449 Ga0466960_0009898 3300044901 Bacteria 3944
450 Ga0466959_0004778 3300045049 Bacteria 9136
451 Ga0466959_0039343 3300045049 Bacteria 3494
452 Ga0466959_0098199 3300045049 Bacteria 2098
453 Ga0466959_0251953 3300045049 Unclassified 1217
454 Ga0466959_0392765 3300045049 Bacteria 943
455 Ga0466958_0027877 3300045836 Bacteria 3344
456 Ga0466958_0042248 3300045836 Bacteria 2745
457 Ga0466967_0134351 3300045976 Bacteria 2300
458 Ga0466967_0350179 3300045976 Bacteria 1429
459 Ga0466967_0453521 3300045976 Bacteria 1253
460 Ga0466967_1739673 3300045976 Bacteria 621
461 Ga0495617_000337 3300046452 Bacteria 25904
462 Ga0495617_255395 3300046452 Bacteria 539
463 Ga0495627_016747 3300046453 Bacteria 2504
464 Ga0495629_0712689 3300046459 Bacteria 666
465 Ga0495638_0000430 3300046460 Bacteria 50741
466 Ga0495638_0012229 3300046460 Bacteria 5892
467 Ga0495651_0953672 3300046462 Bacteria 522
468 Ga0495585_0000028 3300046492 Bacteria 146662
469 Ga0495607_0000438 3300046501 Bacteria 42080
470 Ga0495607_0025777 3300046501 Bacteria 3654
471 Ga0495583_0025518 3300046506 Bacteria 2950
472 Ga0495606_0049161 3300046507 Bacteria 2768
473 Ga0495608_0094644 3300046511 Bacteria 1930
474 Ga0495608_0489218 3300046511 Bacteria 746
475 Ga0495610_0192976 3300046512 Bacteria 839
476 Ga0495616_0357026 3300046513 Bacteria 607
477 Ga0495620_0323856 3300046515 Unclassified 585
478 Ga0495628_0487134 3300046516 Bacteria 892
479 Ga0495630_0341975 3300046517 Bacteria 1145
480 Ga0495631_0004267 3300046518 Bacteria 7643
481 Ga0495632_0096863 3300046519 Bacteria 1393
482 Ga0495637_0005084 3300046520 Bacteria 6746
483 Ga0495648_0002326 3300046524 Bacteria 17687
484 Ga0495663_0001265 3300046525 Bacteria 8032
485 Ga0495663_0102972 3300046525 Bacteria 942
486 Ga0495640_0477513 3300046533 Bacteria 760
487 Ga0495609_0185436 3300046538 Bacteria 874
488 Ga0495621_0089935 3300046539 Bacteria 1156
489 Ga0495633_0075800 3300046558 Bacteria 1566
490 Ga0495656_0003485 3300046615 Bacteria 5322
491 Ga0495656_0169154 3300046615 Bacteria 1067
492 Ga0495668_0005604 3300046616 Bacteria 8446
493 Ga0495668_0153508 3300046616 Bacteria 1261
494 Ga0495668_0195133 3300046616 Bacteria 1109
495 Ga0495634_0398660 3300046642 Bacteria 818
496 Ga0495611_0017877 3300046648 Bacteria 3037
497 Ga0495625_0263704 3300046660 Bacteria 1114
498 Ga0495659_0040301 3300046664 Bacteria 1664
499 Ga0495661_0010391 3300046665 Bacteria 6352
500 Ga0495661_0448951 3300046665 Bacteria 621
501 Ga0495657_0220672 3300046675 Bacteria 1149
502 Ga0495599_0094041 3300046678 Bacteria 1870
503 Ga0495623_0515199 3300046679 Bacteria 630
504 Ga0495647_0168550 3300046681 Bacteria 947
505 Ga0495658_0040275 3300046683 Bacteria 2597
506 Ga0495669_0005214 3300046684 Bacteria 5409
507 Ga0495670_0002216 3300046691 Bacteria 9601
508 Ga0495670_0172975 3300046691 Bacteria 1138
509 Ga0495671_0003326 3300046692 Bacteria 9929
510 Ga0495671_0137071 3300046692 Bacteria 1193
511 Ga0495671_0409018 3300046692 Bacteria 649
512 Ga0495589_0000523 3300046794 Bacteria 26993
513 Ga0495589_0200348 3300046794 Bacteria 942
514 Ga0495660_0000076 3300046810 Bacteria 105580
515 Ga0495660_0000567 3300046810 Bacteria 29946
516 Ga0495636_0002043 3300047318 Bacteria 7741
517 Ga0495636_0003291 3300047318 Bacteria 6258
518 Ga0495636_0022435 3300047318 Bacteria 2551
519 Ga0495636_0124573 3300047318 Bacteria 1142
520 Ga0495636_0170311 3300047318 Bacteria 984
521 Ga0495636_0349632 3300047318 Bacteria 698
522 Ga0495674_0396836 3300047319 Bacteria 1114
523 Ga0495672_0100769 3300047320 Bacteria 1567
524 Ga0495680_0063976 3300047322 Bacteria 2823
525 Ga0495680_0749047 3300047322 Bacteria 642
526 Ga0495677_0149952 3300047445 Bacteria 898
527 Ga0495679_000001 3300047446 Bacteria 1607568
528 Ga0495673_0000087 3300047469 Bacteria 190669
529 Ga0495673_0001346 3300047469 Bacteria 19925
530 Ga0495673_0108343 3300047469 Bacteria 1114
531 Ga0495673_0164798 3300047469 Bacteria 848
532 Ga0495681_0004708 3300047470 Bacteria 9253
533 Ga0495684_0222066 3300047471 Bacteria 1385
534 Ga0495684_0293714 3300047471 Unclassified 1169
535 Ga0495686_0138193 3300047472 Bacteria 1440
536 Ga0495686_0182569 3300047472 Bacteria 1215
537 Ga0496100_0011561 3300048903 Bacteria 5029
538 Ga0496101_0005404 3300048904 Bacteria 8140
539 Ga0496101_0287481 3300048904 Bacteria 1286
540 Ga0496104_0198328 3300048907 Bacteria 1919
541 Ga0496107_0797028 3300048910 Bacteria 692
542 Ga0496110_0515628 3300048913 Bacteria 1088
543 Ga0496111_0481930 3300048914 Bacteria 914
544 Ga0496111_0548557 3300048914 Bacteria 849
545 Ga0496115_0288793 3300048918 Bacteria 1346
546 Ga0496115_0575823 3300048918 Bacteria 897
547 Ga0496118_0203476 3300048921 Bacteria 1170
548 Ga0496121_0000735 3300048924 Bacteria 60384
549 Ga0496121_0001673 3300048924 Bacteria 36526
550 Ga0496121_0116786 3300048924 Bacteria 2023
551 Ga0496121_0348763 3300048924 Bacteria 987
552 Ga0496121_0363492 3300048924 Bacteria 960
553 Ga0496122_0012141 3300048925 Bacteria 8623
554 Ga0496122_0041865 3300048925 Bacteria 3613
555 Ga0496122_0145357 3300048925 Bacteria 1475
556 Ga0496122_0192190 3300048925 Bacteria 1203
557 Ga0496123_0003232 3300048926 Bacteria 18540
558 Ga0496123_0040310 3300048926 Bacteria 3255
559 Ga0496123_0152610 3300048926 Bacteria 1244
560 Ga0496123_0321276 3300048926 Bacteria 730
561 Ga0496124_0111309 3300048927 Bacteria 2203
562 Ga0495678_000028 3300049459 Bacteria 220080
563 Ga0495682_0002363 3300049460 Bacteria 8965
564 Ga0495682_0011933 3300049460 Bacteria 3339
565 Ga0501298_033143 3300049521 Bacteria 1022
566 Ga0501300_052506 3300049523 Bacteria 631
567 Ga0501032_0118318 3300049569 Bacteria 1752
568 Ga0501033_0101555 3300049570 Bacteria 2098
569 Ga0501033_0218682 3300049570 Bacteria 1356
570 Ga0501034_0006833 3300049571 Bacteria 12207
571 Ga0501034_0009247 3300049571 Bacteria 10328
572 Ga0501034_0141331 3300049571 Bacteria 2387
573 Ga0501034_0465960 3300049571 Bacteria 1180
574 Ga0501034_0513540 3300049571 Bacteria 1111
575 Ga0501036_1434206 3300049572 Bacteria 559
576 Ga0501037_0033835 3300049573 Bacteria 3774
577 Ga0501037_0042176 3300049573 Bacteria 3354
578 Ga0501042_0757101 3300049578 Bacteria 707
579 Ga0501042_1440047 3300049578 Bacteria 503
580 Ga0501043_0162565 3300049579 Bacteria 1744
581 Ga0501043_0977267 3300049579 Bacteria 604
582 Ga0501047_0001004 3300049581 Bacteria 28467
583 Ga0501047_0098285 3300049581 Bacteria 2806
584 Ga0501047_0677351 3300049581 Bacteria 849
585 Ga0501048_0365626 3300049582 Bacteria 1029
586 Ga0501074_0218471 3300049590 Bacteria 1357
587 Ga0501206_021183 3300049653 Bacteria 928
588 Ga0501223_039419 3300049663 Bacteria 917
589 Ga0501224_021903 3300049664 Bacteria 953
590 Ga0501242_007653 3300049674 Bacteria 1250
591 Ga0501080_0270694 3300049742 Bacteria 1546
592 Ga0501083_0401304 3300049744 Bacteria 892
593 Ga0501265_006029 3300049762 Bacteria 1406
594 Ga0501268_027537 3300049765 Bacteria 1011
595 Ga0501269_002551 3300049766 Bacteria 2234
596 Ga0501275_000999 3300049772 Bacteria 2949
597 Ga0501280_012350 3300049776 Bacteria 1200
598 Ga0501035_0094503 3300049822 Bacteria 2629
599 Ga0501035_0125653 3300049822 Bacteria 2239
600 Ga0501035_0528885 3300049822 Bacteria 968
601 Ga0501044_0026683 3300049823 Bacteria 6114
602 Ga0501044_0051951 3300049823 Bacteria 4226
603 Ga0501044_0159204 3300049823 Bacteria 2236
604 Ga0501044_0588976 3300049823 Bacteria 1006
605 Ga0501044_0698258 3300049823 Bacteria 900
606 Ga0501044_0997468 3300049823 Bacteria 709
607 nmdc:mga03n38_163407_c1 3300050490 Bacteria 1129
608 nmdc:mga03n38_25391_c1 3300050490 Bacteria 2432
609 nmdc:mga03n38_499416_c1 3300050490 Bacteria 682
610 nmdc:mga00v17_953300_c1 3300050491 Bacteria 541
611 nmdc:mga0yw44_14763_c1 3300050492 Bacteria 4160
612 nmdc:mga0yw44_826801_c1 3300050492 Bacteria 629
613 nmdc:mga0k408_44177_c1 3300050493 Bacteria 2569
614 nmdc:mga06z11_122372_c1 3300050494 Bacteria 1453
615 nmdc:mga06z11_203515_c1 3300050494 Bacteria 1151
616 nmdc:mga04h51_260696_c1 3300050495 Bacteria 697
617 nmdc:mga07m45_194545_c1 3300050496 Bacteria 1179
618 nmdc:mga07m45_221047_c1 3300050496 Bacteria 1102
619 nmdc:mga07m45_27606_c1 3300050496 Bacteria 3128
620 nmdc:mga07m45_67367_c1 3300050496 Bacteria 2034
621 nmdc:mga05p37_251174_c1 3300050507 Bacteria 2121
622 nmdc:mga0sz30_143009_c1 3300050516 Bacteria 1056
623 Ga0495601_0260598 3300053077 Bacteria 1132
624 Ga0500643_000152 3300053087 Bacteria 69800
625 Ga0500555_000409 3300053103 Bacteria 17896
626 Ga0500562_090737 3300053108 Bacteria 829
627 Ga0500652_224977 3300053131 Bacteria 753
628 Ga0500573_0028053 3300053140 Bacteria 3240
629 Ga0500573_0165823 3300053140 Bacteria 1199
630 Ga0500634_0047011 3300053161 Bacteria 2331
631 Ga0500637_0453864 3300053178 Bacteria 649
632 Ga0500645_002248 3300053730 Bacteria 8787
633 Ga0466962_0003081 3300061719 Bacteria 7934
634 Ga0466962_0008145 3300061719 Bacteria 5025
635 Ga0466962_0064144 3300061719 Bacteria 1754
636 Ga0466962_0303469 3300061719 Bacteria 790

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0613273 Ga0373931_0613273_10_384 124
2 3300042012 Ga0439455_0117585 Ga0439455_0117585_342_731 126
3 3300049653 Ga0501206_021183 Ga0501206_021183_448_831 126
4 3300049664 Ga0501224_021903 Ga0501224_021903_220_603 126
5 3300049674 Ga0501242_007653 Ga0501242_007653_511_894 126
6 3300049765 Ga0501268_027537 Ga0501268_027537_461_844 126
7 3300049776 Ga0501280_012350 Ga0501280_012350_307_690 126
8 3300044694 Ga0466963_0016396 Ga0466963_0016396_3895_4281 128
9 3300044706 Ga0466964_0303751 Ga0466964_0303751_367_753 128
10 3300044719 Ga0466971_0095916 Ga0466971_0095916_348_734 128
11 3300044842 Ga0466957_0059800 Ga0466957_0059800_1423_1809 128
12 3300045976 Ga0466967_0453521 Ga0466967_0453521_822_1208 128
13 3300049744 Ga0501083_0401304 Ga0501083_0401304_106_492 128
14 3300061719 Ga0466962_0064144 Ga0466962_0064144_602_988 128
15 3300006042 Ga0075368_10243839 Ga0075368_102438392 129
16 3300013308 Ga0157375_10349763 Ga0157375_103497631 129
17 3300036401 Ga0373937_1024341 Ga0373937_1024341_345_734 129
18 3300037418 Ga0395900_0172671 Ga0395900_0172671_1309_1710 129
19 3300049521 Ga0501298_033143 Ga0501298_033143_233_622 129
20 3300049663 Ga0501223_039419 Ga0501223_039419_476_865 129
21 3300053077 Ga0495601_0260598 Ga0495601_0260598_728_1117 129
22 iso_pu_bacteria 2548876994 2550695914 131
23 iso_pu_bacteria 2571042365 2572254066 131
24 iso_pu_bacteria 2576861471 2578460172 131
25 iso_pu_bacteria 2585428057 2587727637 131
26 iso_pu_bacteria 2643221592 2643969455 131
27 iso_pu_bacteria 2643221625 2644143755 131
28 iso_pu_bacteria 2643221648 2644276539 131
29 iso_pu_bacteria 2734482264 2735836054 131
30 iso_pu_bacteria 2738541277 2738721170 131
31 iso_pu_bacteria 2738543009 2739227769 131
32 iso_pu_bacteria 2738543013 2739251568 131
33 iso_pu_bacteria 2738543019 2739280369 131
34 iso_pu_bacteria 2818991445 2819594633 131
35 iso_pu_bacteria 2858950400 2858950897 131
36 iso_pu_bacteria 2884811622 2884813453 131
37 iso_pu_bacteria 2884811622 2884813530 131
38 iso_pu_bacteria 2884836552 2884838339 131
39 iso_pu_bacteria 2884852848 2884854631 131
40 iso_pu_bacteria 2896154374 2896156701 131
41 iso_pu_bacteria 2904615490 2904621823 131
42 iso_pu_bacteria 2919462493 2919467049 131
43 iso_pu_bacteria 2954767861 2954767936 131
44 iso_pu_bacteria 2844533157 2844533808 132
45 3300005834 Ga0068851_10023721 Ga0068851_100237215 133
46 3300025321 Ga0207656_10219007 Ga0207656_102190071 133
47 3300044656 Ga0466969_0030177 Ga0466969_0030177_385_786 133
48 3300044684 Ga0466966_0147177 Ga0466966_0147177_159_560 133
49 3300044693 Ga0466961_0033166 Ga0466961_0033166_1074_1475 133
50 3300045049 Ga0466959_0039343 Ga0466959_0039343_2003_2404 133
51 3300045836 Ga0466958_0042248 Ga0466958_0042248_698_1099 133
52 3300061719 Ga0466962_0003081 Ga0466962_0003081_1078_1479 133
53 3300003187 JGI25151J46595_10000399 JGI25151J46595_100003992 134
54 3300003187 JGI25151J46595_10001711 JGI25151J46595_1000171113 134
55 3300003215 JGI25153J46596_10063526 JGI25153J46596_100635261 134
56 3300005327 Ga0070658_10508521 Ga0070658_105085211 134
57 3300005328 Ga0070676_10686776 Ga0070676_106867762 134
58 3300005335 Ga0070666_10863369 Ga0070666_108633692 134
59 3300005356 Ga0070674_100294347 Ga0070674_1002943473 134
60 3300005441 Ga0070700_100143113 Ga0070700_1001431133 134
61 3300005539 Ga0068853_100785640 Ga0068853_1007856402 134
62 3300005548 Ga0070665_100000195 Ga0070665_10000019556 134
63 3300005563 Ga0068855_101204898 Ga0068855_1012048981 134
64 3300005718 Ga0068866_10043241 Ga0068866_100432412 134
65 3300005719 Ga0068861_100161157 Ga0068861_1001611571 134
66 3300005841 Ga0068863_100250957 Ga0068863_1002509572 134
67 3300005843 Ga0068860_100479607 Ga0068860_1004796072 134
68 3300006038 Ga0075365_10093114 Ga0075365_100931142 134
69 3300006038 Ga0075365_10263267 Ga0075365_102632671 134
70 3300006038 Ga0075365_10439395 Ga0075365_104393951 134
71 3300006048 Ga0075363_100100511 Ga0075363_1001005112 134
72 3300006051 Ga0075364_10332621 Ga0075364_103326212 134
73 3300006237 Ga0097621_100588835 Ga0097621_1005888352 134
74 3300006353 Ga0075370_10084255 Ga0075370_100842552 134
75 3300009148 Ga0105243_10279803 Ga0105243_102798032 134
76 3300009553 Ga0105249_11766092 Ga0105249_117660921 134
77 3300013104 Ga0157370_10234533 Ga0157370_102345332 134
78 3300013296 Ga0157374_10371446 Ga0157374_103714462 134
79 3300013307 Ga0157372_10387163 Ga0157372_103871633 134
80 3300014326 Ga0157380_10083835 Ga0157380_100838352 134
81 3300017792 Ga0163161_10650262 Ga0163161_106502622 134
82 3300025294 Ga0209025_1000552 Ga0209025_100055256 134
83 3300025297 Ga0209758_1002239 Ga0209758_100223912 134
84 3300025903 Ga0207680_10610101 Ga0207680_106101012 134
85 3300025937 Ga0207669_10214708 Ga0207669_102147083 134
86 3300026041 Ga0207639_10877122 Ga0207639_108771222 134
87 3300026075 Ga0207708_10062994 Ga0207708_100629943 134
88 3300026088 Ga0207641_10235352 Ga0207641_102353523 134
89 3300026116 Ga0207674_11035860 Ga0207674_110358601 134
90 3300026118 Ga0207675_100013845 Ga0207675_1000138455 134
91 3300026142 Ga0207698_10602228 Ga0207698_106022282 134
92 3300028379 Ga0268266_10002760 Ga0268266_1000276013 134
93 3300028381 Ga0268264_10306343 Ga0268264_103063434 134
94 3300031548 Ga0307408_100337959 Ga0307408_1003379592 134
95 3300031731 Ga0307405_10914650 Ga0307405_109146502 134
96 3300031852 Ga0307410_10620628 Ga0307410_106206281 134
97 3300031903 Ga0307407_10325510 Ga0307407_103255102 134
98 3300031911 Ga0307412_11170510 Ga0307412_111705102 134
99 3300031911 Ga0307412_11879001 Ga0307412_118790011 134
100 3300031995 Ga0307409_100038783 Ga0307409_1000387835 134
101 3300032004 Ga0307414_10449744 Ga0307414_104497442 134
102 3300032126 Ga0307415_100853585 Ga0307415_1008535852 134
103 3300035692 Ga0373935_0486260 Ga0373935_0486260_383_820 134
104 3300036401 Ga0373937_0424664 Ga0373937_0424664_639_1049 134
105 3300037068 Ga0373925_0607310 Ga0373925_0607310_52_462 134
106 3300037312 Ga0395899_0226277 Ga0395899_0226277_218_622 134
107 3300037418 Ga0395900_0328240 Ga0395900_0328240_28_432 134
108 3300037418 Ga0395900_1079469 Ga0395900_1079469_63_467 134
109 3300037466 Ga0395898_0222658 Ga0395898_0222658_942_1346 134
110 3300037466 Ga0395898_1268325 Ga0395898_1268325_168_572 134
111 3300037471 Ga0395905_0485846 Ga0395905_0485846_513_917 134
112 3300037471 Ga0395905_0607564 Ga0395905_0607564_529_933 134
113 3300037471 Ga0395905_1444287 Ga0395905_1444287_76_480 134
114 3300038443 Ga0395901_0125666 Ga0395901_0125666_1456_1860 134
115 3300038443 Ga0395901_1120490 Ga0395901_1120490_49_453 134
116 3300039437 Ga0436365_0936602 Ga0436365_0936602_5751_6155 134
117 3300039447 Ga0436361_0945996 Ga0436361_0945996_503_907 134
118 3300039453 Ga0436362_0689394 Ga0436362_0689394_567_971 134
119 3300041413 Ga0439465_0195669 Ga0439465_0195669_310_714 134
120 3300042007 Ga0439449_0004030 Ga0439449_0004030_5231_5674 134
121 3300042007 Ga0439449_0015730 Ga0439449_0015730_1768_2181 134
122 3300044656 Ga0466969_0051825 Ga0466969_0051825_1531_1935 134
123 3300044684 Ga0466966_0003316 Ga0466966_0003316_9001_9405 134
124 3300044693 Ga0466961_0080610 Ga0466961_0080610_1579_1983 134
125 3300044901 Ga0466960_0009898 Ga0466960_0009898_2604_3008 134
126 3300045049 Ga0466959_0251953 Ga0466959_0251953_672_1076 134
127 3300045049 Ga0466959_0392765 Ga0466959_0392765_26_448 134
128 3300045976 Ga0466967_1739673 Ga0466967_1739673_141_563 134
129 3300046460 Ga0495638_0012229 Ga0495638_0012229_1458_1871 134
130 3300046507 Ga0495606_0049161 Ga0495606_0049161_1956_2360 134
131 3300046511 Ga0495608_0094644 Ga0495608_0094644_1219_1656 134
132 3300046512 Ga0495610_0192976 Ga0495610_0192976_40_444 134
133 3300046525 Ga0495663_0102972 Ga0495663_0102972_340_744 134
134 3300046539 Ga0495621_0089935 Ga0495621_0089935_476_880 134
135 3300046558 Ga0495633_0075800 Ga0495633_0075800_580_984 134
136 3300046615 Ga0495656_0169154 Ga0495656_0169154_132_536 134
137 3300046616 Ga0495668_0195133 Ga0495668_0195133_411_821 134
138 3300046675 Ga0495657_0220672 Ga0495657_0220672_442_879 134
139 3300046691 Ga0495670_0172975 Ga0495670_0172975_711_1115 134
140 3300046692 Ga0495671_0137071 Ga0495671_0137071_272_676 134
141 3300047318 Ga0495636_0002043 Ga0495636_0002043_7327_7731 134
142 3300047318 Ga0495636_0003291 Ga0495636_0003291_1438_1842 134
143 3300047318 Ga0495636_0124573 Ga0495636_0124573_573_977 134
144 3300047319 Ga0495674_0396836 Ga0495674_0396836_283_720 134
145 3300047320 Ga0495672_0100769 Ga0495672_0100769_112_525 134
146 3300047322 Ga0495680_0063976 Ga0495680_0063976_452_889 134
147 3300047470 Ga0495681_0004708 Ga0495681_0004708_8592_8996 134
148 3300047471 Ga0495684_0293714 Ga0495684_0293714_688_1125 134
149 3300048904 Ga0496101_0287481 Ga0496101_0287481_463_873 134
150 3300048907 Ga0496104_0198328 Ga0496104_0198328_478_927 134
151 3300048913 Ga0496110_0515628 Ga0496110_0515628_419_853 134
152 3300048914 Ga0496111_0548557 Ga0496111_0548557_199_642 134
153 3300048918 Ga0496115_0575823 Ga0496115_0575823_420_824 134
154 3300048924 Ga0496121_0000735 Ga0496121_0000735_29945_30349 134
155 3300048924 Ga0496121_0116786 Ga0496121_0116786_1587_1991 134
156 3300049578 Ga0501042_0757101 Ga0501042_0757101_123_527 134
157 3300050490 nmdc:mga03n38_25391_c1 nmdc:mga03n38_25391_c1_1556_1990 134
158 3300050491 nmdc:mga00v17_953300_c1 nmdc:mga00v17_953300_c1_33_467 134
159 3300050492 nmdc:mga0yw44_14763_c1 nmdc:mga0yw44_14763_c1_1043_1477 134
160 3300050494 nmdc:mga06z11_122372_c1 nmdc:mga06z11_122372_c1_373_807 134
161 3300050496 nmdc:mga07m45_27606_c1 nmdc:mga07m45_27606_c1_2335_2754 134
162 3300050496 nmdc:mga07m45_67367_c1 nmdc:mga07m45_67367_c1_988_1422 134
163 3300053140 Ga0500573_0028053 Ga0500573_0028053_2103_2522 134
164 3300053161 Ga0500634_0047011 Ga0500634_0047011_1767_2171 134
165 3300061719 Ga0466962_0303469 Ga0466962_0303469_264_686 134
166 3300002704 JGI25155J39150_1000039 JGI25155J39150_100003913 135
167 3300002705 JGI25156J39149_1000096 JGI25156J39149_100009614 135
168 3300002738 JGI25154J39366_1000077 JGI25154J39366_100007713 135
169 3300002741 JGI25157J39369_1000065 JGI25157J39369_100006513 135
170 3300003203 JGI25406J46586_10045925 JGI25406J46586_100459252 135
171 3300003758 Ga0055532_1000005 Ga0055532_1000005317 135
172 3300003761 Ga0055535_1002690 Ga0055535_10026907 135
173 3300003763 Ga0055529_1014460 Ga0055529_10144602 135
174 3300003773 Ga0055537_1000416 Ga0055537_100041627 135
175 3300003784 Ga0055534_1000008 Ga0055534_100000827 135
176 3300003790 Ga0055528_1000831 Ga0055528_100083120 135
177 3300003792 Ga0055540_1007192 Ga0055540_10071926 135
178 3300003794 Ga0055531_10002125 Ga0055531_100021254 135
179 3300005262 Ga0065165_1000241 Ga0065165_100024175 135
180 3300005293 Ga0065715_11107217 Ga0065715_111072171 135
181 3300005327 Ga0070658_10014457 Ga0070658_100144579 135
182 3300005328 Ga0070676_10001625 Ga0070676_100016252 135
183 3300005329 Ga0070683_100033656 Ga0070683_1000336565 135
184 3300005330 Ga0070690_100073988 Ga0070690_1000739882 135
185 3300005333 Ga0070677_10104135 Ga0070677_101041351 135
186 3300005333 Ga0070677_10447052 Ga0070677_104470521 135
187 3300005334 Ga0068869_100003838 Ga0068869_10000383810 135
188 3300005334 Ga0068869_100146296 Ga0068869_1001462963 135
189 3300005335 Ga0070666_10012977 Ga0070666_100129774 135
190 3300005337 Ga0070682_101036956 Ga0070682_1010369561 135
191 3300005338 Ga0068868_100058614 Ga0068868_1000586142 135
192 3300005340 Ga0070689_100359388 Ga0070689_1003593882 135
193 3300005343 Ga0070687_100116721 Ga0070687_1001167212 135
194 3300005344 Ga0070661_100039453 Ga0070661_1000394532 135
195 3300005347 Ga0070668_100001082 Ga0070668_10000108217 135
196 3300005347 Ga0070668_100109201 Ga0070668_1001092013 135
197 3300005353 Ga0070669_100063828 Ga0070669_1000638283 135
198 3300005354 Ga0070675_100031694 Ga0070675_1000316946 135
199 3300005355 Ga0070671_100107502 Ga0070671_1001075023 135
200 3300005355 Ga0070671_100598091 Ga0070671_1005980912 135
201 3300005356 Ga0070674_100012872 Ga0070674_1000128725 135
202 3300005364 Ga0070673_102243076 Ga0070673_1022430761 135
203 3300005366 Ga0070659_100297161 Ga0070659_1002971612 135
204 3300005366 Ga0070659_100317670 Ga0070659_1003176702 135
205 3300005366 Ga0070659_101444575 Ga0070659_1014445751 135
206 3300005367 Ga0070667_100007734 Ga0070667_1000077342 135
207 3300005367 Ga0070667_100008658 Ga0070667_1000086589 135
208 3300005367 Ga0070667_100114328 Ga0070667_1001143283 135
209 3300005367 Ga0070667_100751332 Ga0070667_1007513322 135
210 3300005437 Ga0070710_10816837 Ga0070710_108168371 135
211 3300005441 Ga0070700_100371217 Ga0070700_1003712172 135
212 3300005445 Ga0070708_100730051 Ga0070708_1007300512 135
213 3300005445 Ga0070708_101587597 Ga0070708_1015875971 135
214 3300005455 Ga0070663_100101137 Ga0070663_1001011372 135
215 3300005455 Ga0070663_100318697 Ga0070663_1003186972 135
216 3300005456 Ga0070678_100016063 Ga0070678_1000160633 135
217 3300005457 Ga0070662_100017280 Ga0070662_1000172804 135
218 3300005457 Ga0070662_100062351 Ga0070662_1000623514 135
219 3300005459 Ga0068867_100004243 Ga0068867_1000042436 135
220 3300005459 Ga0068867_100034370 Ga0068867_1000343702 135
221 3300005459 Ga0068867_100719589 Ga0068867_1007195892 135
222 3300005467 Ga0070706_101434306 Ga0070706_1014343061 135
223 3300005471 Ga0070698_100396258 Ga0070698_1003962582 135
224 3300005530 Ga0070679_100904918 Ga0070679_1009049182 135
225 3300005535 Ga0070684_100045385 Ga0070684_1000453853 135
226 3300005539 Ga0068853_100174084 Ga0068853_1001740843 135
227 3300005539 Ga0068853_101293490 Ga0068853_1012934902 135
228 3300005543 Ga0070672_100005393 Ga0070672_1000053933 135
229 3300005547 Ga0070693_100072588 Ga0070693_1000725883 135
230 3300005548 Ga0070665_100001353 Ga0070665_10000135327 135
231 3300005563 Ga0068855_100007328 Ga0068855_10000732812 135
232 3300005563 Ga0068855_100111340 Ga0068855_1001113404 135
233 3300005563 Ga0068855_100322998 Ga0068855_1003229981 135
234 3300005578 Ga0068854_100541365 Ga0068854_1005413652 135
235 3300005616 Ga0068852_100003658 Ga0068852_1000036583 135
236 3300005616 Ga0068852_100070517 Ga0068852_1000705172 135
237 3300005617 Ga0068859_100112090 Ga0068859_1001120902 135
238 3300005617 Ga0068859_100149643 Ga0068859_1001496433 135
239 3300005617 Ga0068859_100179980 Ga0068859_1001799802 135
240 3300005617 Ga0068859_100208753 Ga0068859_1002087532 135
241 3300005617 Ga0068859_100241760 Ga0068859_1002417604 135
242 3300005618 Ga0068864_100627839 Ga0068864_1006278392 135
243 3300005618 Ga0068864_100671027 Ga0068864_1006710272 135
244 3300005718 Ga0068866_10059287 Ga0068866_100592872 135
245 3300005719 Ga0068861_100006162 Ga0068861_1000061623 135
246 3300005719 Ga0068861_100943535 Ga0068861_1009435352 135
247 3300005841 Ga0068863_100004706 Ga0068863_10000470610 135
248 3300005841 Ga0068863_100019695 Ga0068863_1000196954 135
249 3300005841 Ga0068863_100924989 Ga0068863_1009249891 135
250 3300005843 Ga0068860_100005570 Ga0068860_10000557010 135
251 3300005843 Ga0068860_100113682 Ga0068860_1001136823 135
252 3300005843 Ga0068860_100162228 Ga0068860_1001622283 135
253 3300005844 Ga0068862_100010381 Ga0068862_1000103817 135
254 3300005844 Ga0068862_100096765 Ga0068862_1000967653 135
255 3300005844 Ga0068862_101717683 Ga0068862_1017176832 135
256 3300005937 Ga0081455_10150777 Ga0081455_101507771 135
257 3300005985 Ga0081539_10000829 Ga0081539_1000082953 135
258 3300006028 Ga0070717_10375592 Ga0070717_103755922 135
259 3300006038 Ga0075365_10040676 Ga0075365_100406762 135
260 3300006042 Ga0075368_10182323 Ga0075368_101823232 135
261 3300006048 Ga0075363_100176715 Ga0075363_1001767152 135
262 3300006048 Ga0075363_100288502 Ga0075363_1002885022 135
263 3300006048 Ga0075363_100601211 Ga0075363_1006012112 135
264 3300006051 Ga0075364_10082145 Ga0075364_100821452 135
265 3300006177 Ga0075362_10035047 Ga0075362_100350473 135
266 3300006177 Ga0075362_10173451 Ga0075362_101734512 135
267 3300006178 Ga0075367_10095592 Ga0075367_100955921 135
268 3300006178 Ga0075367_10256315 Ga0075367_102563152 135
269 3300006186 Ga0075369_10392010 Ga0075369_103920102 135
270 3300006195 Ga0075366_10013628 Ga0075366_100136283 135
271 3300006195 Ga0075366_10069201 Ga0075366_100692013 135
272 3300006195 Ga0075366_10860315 Ga0075366_108603151 135
273 3300006237 Ga0097621_100376330 Ga0097621_1003763301 135
274 3300006353 Ga0075370_10004353 Ga0075370_100043532 135
275 3300006353 Ga0075370_10066987 Ga0075370_100669873 135
276 3300006353 Ga0075370_10232002 Ga0075370_102320022 135
277 3300006353 Ga0075370_10366118 Ga0075370_103661182 135
278 3300006353 Ga0075370_10418804 Ga0075370_104188042 135
279 3300006881 Ga0068865_100031766 Ga0068865_1000317664 135
280 3300006881 Ga0068865_100062565 Ga0068865_1000625653 135
281 3300006881 Ga0068865_100418907 Ga0068865_1004189072 135
282 3300006931 Ga0097620_100112089 Ga0097620_1001120892 135
283 3300006931 Ga0097620_100149629 Ga0097620_1001496293 135
284 3300006931 Ga0097620_100179981 Ga0097620_1001799812 135
285 3300006931 Ga0097620_100208757 Ga0097620_1002087572 135
286 3300006931 Ga0097620_100241759 Ga0097620_1002417591 135
287 3300006946 Ga0079104_1006554 Ga0079104_100655410 135
288 3300006948 Ga0099826_10000171 Ga0099826_1000017113 135
289 3300007265 Ga0099794_10038868 Ga0099794_100388682 135
290 3300007788 Ga0099795_10000001 Ga0099795_1000000144 135
291 3300009093 Ga0105240_11389130 Ga0105240_113891302 135
292 3300009094 Ga0111539_10726933 Ga0111539_107269331 135
293 3300009098 Ga0105245_10097764 Ga0105245_100977642 135
294 3300009101 Ga0105247_10003540 Ga0105247_100035406 135
295 3300009101 Ga0105247_11645939 Ga0105247_116459392 135
296 3300009148 Ga0105243_10028062 Ga0105243_100280623 135
297 3300009148 Ga0105243_10134712 Ga0105243_101347123 135
298 3300009176 Ga0105242_10163965 Ga0105242_101639653 135
299 3300009177 Ga0105248_10012920 Ga0105248_1001292010 135
300 3300009177 Ga0105248_10021265 Ga0105248_1002126510 135
301 3300009551 Ga0105238_10008209 Ga0105238_100082099 135
302 3300009553 Ga0105249_10042383 Ga0105249_100423833 135
303 3300009553 Ga0105249_10085916 Ga0105249_100859163 135
304 3300009553 Ga0105249_10113763 Ga0105249_101137635 135
305 3300009553 Ga0105249_10543612 Ga0105249_105436122 135
306 3300010159 Ga0099796_10000001 Ga0099796_1000000129 135
307 3300011119 Ga0105246_10000157 Ga0105246_1000015733 135
308 3300011119 Ga0105246_11661888 Ga0105246_116618882 135
309 3300013102 Ga0157371_10637262 Ga0157371_106372621 135
310 3300013102 Ga0157371_11222765 Ga0157371_112227651 135
311 3300013104 Ga0157370_10224367 Ga0157370_102243672 135
312 3300013104 Ga0157370_10892328 Ga0157370_108923281 135
313 3300013105 Ga0157369_10119712 Ga0157369_101197123 135
314 3300013105 Ga0157369_11075206 Ga0157369_110752061 135
315 3300013296 Ga0157374_10430566 Ga0157374_104305661 135
316 3300013296 Ga0157374_10446667 Ga0157374_104466673 135
317 3300013297 Ga0157378_10007853 Ga0157378_100078537 135
318 3300013306 Ga0163162_10146196 Ga0163162_101461963 135
319 3300013307 Ga0157372_10764561 Ga0157372_107645613 135
320 3300013308 Ga0157375_10541888 Ga0157375_105418883 135
321 3300013308 Ga0157375_10883614 Ga0157375_108836142 135
322 3300013308 Ga0157375_11100103 Ga0157375_111001032 135
323 3300014325 Ga0163163_10482068 Ga0163163_104820682 135
324 3300014326 Ga0157380_10005141 Ga0157380_100051412 135
325 3300014326 Ga0157380_10023694 Ga0157380_100236945 135
326 3300014968 Ga0157379_10039462 Ga0157379_100394628 135
327 3300014968 Ga0157379_11018166 Ga0157379_110181662 135
328 3300014969 Ga0157376_10224722 Ga0157376_102247222 135
329 3300015261 Ga0182006_1000077 Ga0182006_1000077100 135
330 3300015262 Ga0182007_10112623 Ga0182007_101126232 135
331 3300015265 Ga0182005_1009286 Ga0182005_10092862 135
332 3300017792 Ga0163161_10033690 Ga0163161_100336904 135
333 3300017792 Ga0163161_10040299 Ga0163161_100402993 135
334 3300017792 Ga0163161_10405563 Ga0163161_104055632 135
335 3300025206 Ga0209435_100043 Ga0209435_10004392 135
336 3300025206 Ga0209435_100050 Ga0209435_1000504 135
337 3300025229 Ga0209147_100011 Ga0209147_100011116 135
338 3300025242 Ga0209258_100401 Ga0209258_10040139 135
339 3300025246 Ga0209646_1000161 Ga0209646_10001614 135
340 3300025250 Ga0209026_1000173 Ga0209026_100017391 135
341 3300025256 Ga0209759_1000169 Ga0209759_100016927 135
342 3300025263 Ga0209565_1000042 Ga0209565_100004227 135
343 3300025272 Ga0209455_1002552 Ga0209455_10025525 135
344 3300025273 Ga0209673_1000071 Ga0209673_1000071200 135
345 3300025273 Ga0209673_1011136 Ga0209673_10111364 135
346 3300025284 Ga0209130_1003792 Ga0209130_10037923 135
347 3300025291 Ga0209675_1000041 Ga0209675_1000041199 135
348 3300025291 Ga0209675_1000811 Ga0209675_10008114 135
349 3300025292 Ga0209676_1006071 Ga0209676_10060717 135
350 3300025295 Ga0209564_1045121 Ga0209564_10451213 135
351 3300025298 Ga0209050_1000221 Ga0209050_100022141 135
352 3300025298 Ga0209050_1057544 Ga0209050_10575442 135
353 3300025299 Ga0209256_1033506 Ga0209256_10335063 135
354 3300025303 Ga0209051_1000059 Ga0209051_1000059256 135
355 3300025303 Ga0209051_1006159 Ga0209051_10061598 135
356 3300025303 Ga0209051_1089366 Ga0209051_10893662 135
357 3300025304 Ga0209257_1000022 Ga0209257_1000022144 135
358 3300025304 Ga0209257_1000302 Ga0209257_10003026 135
359 3300025304 Ga0209257_1004206 Ga0209257_10042065 135
360 3300025315 Ga0207697_10024462 Ga0207697_100244622 135
361 3300025893 Ga0207682_10359853 Ga0207682_103598532 135
362 3300025899 Ga0207642_10134585 Ga0207642_101345852 135
363 3300025900 Ga0207710_10003190 Ga0207710_100031906 135
364 3300025903 Ga0207680_10046357 Ga0207680_100463572 135
365 3300025907 Ga0207645_10028998 Ga0207645_100289983 135
366 3300025909 Ga0207705_10036317 Ga0207705_100363172 135
367 3300025910 Ga0207684_11266598 Ga0207684_112665982 135
368 3300025918 Ga0207662_10020646 Ga0207662_100206464 135
369 3300025919 Ga0207657_10708875 Ga0207657_107088752 135
370 3300025920 Ga0207649_10118467 Ga0207649_101184673 135
371 3300025920 Ga0207649_10193851 Ga0207649_101938512 135
372 3300025922 Ga0207646_11549483 Ga0207646_115494831 135
373 3300025923 Ga0207681_10022206 Ga0207681_100222063 135
374 3300025923 Ga0207681_10665180 Ga0207681_106651802 135
375 3300025924 Ga0207694_10004840 Ga0207694_100048403 135
376 3300025925 Ga0207650_11500607 Ga0207650_115006072 135
377 3300025926 Ga0207659_10063895 Ga0207659_100638954 135
378 3300025926 Ga0207659_10527232 Ga0207659_105272322 135
379 3300025929 Ga0207664_10132789 Ga0207664_101327892 135
380 3300025931 Ga0207644_10657057 Ga0207644_106570572 135
381 3300025931 Ga0207644_10840001 Ga0207644_108400011 135
382 3300025931 Ga0207644_11596438 Ga0207644_115964382 135
383 3300025932 Ga0207690_10124602 Ga0207690_101246021 135
384 3300025932 Ga0207690_10798893 Ga0207690_107988931 135
385 3300025933 Ga0207706_10002140 Ga0207706_100021404 135
386 3300025933 Ga0207706_10017021 Ga0207706_100170214 135
387 3300025934 Ga0207686_10050905 Ga0207686_100509053 135
388 3300025934 Ga0207686_10533978 Ga0207686_105339782 135
389 3300025935 Ga0207709_10019065 Ga0207709_100190653 135
390 3300025935 Ga0207709_10119189 Ga0207709_101191893 135
391 3300025935 Ga0207709_10149996 Ga0207709_101499963 135
392 3300025936 Ga0207670_10568791 Ga0207670_105687912 135
393 3300025937 Ga0207669_10010674 Ga0207669_100106744 135
394 3300025937 Ga0207669_10967535 Ga0207669_109675351 135
395 3300025938 Ga0207704_10034967 Ga0207704_100349673 135
396 3300025938 Ga0207704_10044324 Ga0207704_100443243 135
397 3300025938 Ga0207704_10137074 Ga0207704_101370743 135
398 3300025940 Ga0207691_10018902 Ga0207691_100189026 135
399 3300025941 Ga0207711_10029322 Ga0207711_100293222 135
400 3300025941 Ga0207711_10074050 Ga0207711_100740502 135
401 3300025942 Ga0207689_10007114 Ga0207689_100071143 135
402 3300025944 Ga0207661_10197897 Ga0207661_101978972 135
403 3300025949 Ga0207667_10005245 Ga0207667_1000524514 135
404 3300025949 Ga0207667_10066225 Ga0207667_100662254 135
405 3300025949 Ga0207667_10246777 Ga0207667_102467773 135
406 3300025960 Ga0207651_10098316 Ga0207651_100983162 135
407 3300025960 Ga0207651_10149006 Ga0207651_101490063 135
408 3300025960 Ga0207651_10370334 Ga0207651_103703342 135
409 3300025961 Ga0207712_10113835 Ga0207712_101138353 135
410 3300025961 Ga0207712_10148777 Ga0207712_101487774 135
411 3300025972 Ga0207668_10000003 Ga0207668_100000038 135
412 3300025972 Ga0207668_10034578 Ga0207668_100345783 135
413 3300025972 Ga0207668_10594638 Ga0207668_105946382 135
414 3300025986 Ga0207658_10005552 Ga0207658_100055525 135
415 3300025986 Ga0207658_10011119 Ga0207658_100111196 135
416 3300025986 Ga0207658_10019554 Ga0207658_100195546 135
417 3300025986 Ga0207658_10662281 Ga0207658_106622812 135
418 3300025986 Ga0207658_10742530 Ga0207658_107425301 135
419 3300026023 Ga0207677_12094598 Ga0207677_120945981 135
420 3300026035 Ga0207703_10094551 Ga0207703_100945512 135
421 3300026035 Ga0207703_10565673 Ga0207703_105656733 135
422 3300026041 Ga0207639_10099092 Ga0207639_100990921 135
423 3300026067 Ga0207678_10070271 Ga0207678_100702711 135
424 3300026067 Ga0207678_10095432 Ga0207678_100954322 135
425 3300026067 Ga0207678_10345080 Ga0207678_103450803 135
426 3300026075 Ga0207708_10042217 Ga0207708_100422173 135
427 3300026075 Ga0207708_10326352 Ga0207708_103263521 135
428 3300026078 Ga0207702_10426720 Ga0207702_104267202 135
429 3300026088 Ga0207641_10010784 Ga0207641_100107844 135
430 3300026089 Ga0207648_10000393 Ga0207648_1000039316 135
431 3300026089 Ga0207648_10006515 Ga0207648_100065153 135
432 3300026089 Ga0207648_11132503 Ga0207648_111325031 135
433 3300026095 Ga0207676_10504291 Ga0207676_105042912 135
434 3300026095 Ga0207676_11324686 Ga0207676_113246861 135
435 3300026116 Ga0207674_11371259 Ga0207674_113712591 135
436 3300026118 Ga0207675_100001089 Ga0207675_1000010892 135
437 3300026118 Ga0207675_100001455 Ga0207675_10000145516 135
438 3300026118 Ga0207675_100590230 Ga0207675_1005902303 135
439 3300026118 Ga0207675_101700611 Ga0207675_1017006111 135
440 3300026121 Ga0207683_10378464 Ga0207683_103784641 135
441 3300026121 Ga0207683_10427665 Ga0207683_104276652 135
442 3300026121 Ga0207683_11209825 Ga0207683_112098252 135
443 3300026142 Ga0207698_10574167 Ga0207698_105741673 135
444 3300026142 Ga0207698_11747171 Ga0207698_117471711 135
445 3300027111 Ga0209281_1008261 Ga0209281_10082615 135
446 3300027666 Ga0209282_1021535 Ga0209282_10215356 135
447 3300028017 Ga0265356_1002639 Ga0265356_10026392 135
448 3300028379 Ga0268266_10000221 Ga0268266_1000022146 135
449 3300028380 Ga0268265_10011023 Ga0268265_100110235 135
450 3300028380 Ga0268265_10386407 Ga0268265_103864073 135
451 3300028380 Ga0268265_10675092 Ga0268265_106750922 135
452 3300028381 Ga0268264_10022853 Ga0268264_100228534 135
453 3300028381 Ga0268264_10072710 Ga0268264_100727103 135
454 3300028381 Ga0268264_10384630 Ga0268264_103846303 135
455 3300028381 Ga0268264_10905925 Ga0268264_109059251 135
456 3300030745 Ga0316182_1019103 Ga0316182_10191032 135
457 3300030745 Ga0316182_1442232 Ga0316182_14422321 135
458 3300031456 Ga0307513_10004600 Ga0307513_100046006 135
459 3300031456 Ga0307513_10011671 Ga0307513_100116715 135
460 3300031456 Ga0307513_10224612 Ga0307513_102246122 135
461 3300031548 Ga0307408_100038272 Ga0307408_1000382723 135
462 3300031548 Ga0307408_100195605 Ga0307408_1001956052 135
463 3300031649 Ga0307514_10238935 Ga0307514_102389352 135
464 3300031665 Ga0316575_10001658 Ga0316575_100016581 135
465 3300031711 Ga0265314_10004277 Ga0265314_100042778 135
466 3300031730 Ga0307516_10134911 Ga0307516_101349113 135
467 3300031731 Ga0307405_10165271 Ga0307405_101652712 135
468 3300031824 Ga0307413_10429560 Ga0307413_104295602 135
469 3300031852 Ga0307410_10269804 Ga0307410_102698043 135
470 3300031901 Ga0307406_10185801 Ga0307406_101858013 135
471 3300031911 Ga0307412_10070535 Ga0307412_100705353 135
472 3300032002 Ga0307416_100318759 Ga0307416_1003187593 135
473 3300032002 Ga0307416_102718447 Ga0307416_1027184471 135
474 3300032004 Ga0307414_10044936 Ga0307414_100449366 135
475 3300032004 Ga0307414_10204644 Ga0307414_102046442 135
476 3300032005 Ga0307411_10595240 Ga0307411_105952402 135
477 3300032126 Ga0307415_101436976 Ga0307415_1014369762 135
478 3300033180 Ga0307510_10017376 Ga0307510_100173762 135
479 3300033180 Ga0307510_10339915 Ga0307510_103399152 135
480 3300035117 Ga0373953_0413203 Ga0373953_0413203_155_562 135
481 3300035170 Ga0373943_0088993 Ga0373943_0088993_1070_1477 135
482 3300035170 Ga0373943_0455734 Ga0373943_0455734_73_480 135
483 3300035171 Ga0373946_0035536 Ga0373946_0035536_864_1271 135
484 3300035171 Ga0373946_0739299 Ga0373946_0739299_64_486 135
485 3300035172 Ga0373955_0023276 Ga0373955_0023276_1597_2004 135
486 3300035172 Ga0373955_0131344 Ga0373955_0131344_526_939 135
487 3300035692 Ga0373935_0263588 Ga0373935_0263588_320_727 135
488 3300035695 Ga0373927_0319339 Ga0373927_0319339_470_877 135
489 3300035725 Ga0373947_0368014 Ga0373947_0368014_199_606 135
490 3300036401 Ga0373937_0343073 Ga0373937_0343073_47_454 135
491 3300036401 Ga0373937_1161019 Ga0373937_1161019_10_423 135
492 3300037068 Ga0373925_0286654 Ga0373925_0286654_451_858 135
493 3300037068 Ga0373925_1277284 Ga0373925_1277284_90_503 135
494 3300037312 Ga0395899_0003122 Ga0395899_0003122_8690_9103 135
495 3300037418 Ga0395900_0000127 Ga0395900_0000127_93783_94196 135
496 3300037418 Ga0395900_0192414 Ga0395900_0192414_1120_1527 135
497 3300037418 Ga0395900_1381856 Ga0395900_1381856_46_453 135
498 3300037466 Ga0395898_0023452 Ga0395898_0023452_1256_1669 135
499 3300037471 Ga0395905_0003756 Ga0395905_0003756_11577_11984 135
500 3300037471 Ga0395905_0004727 Ga0395905_0004727_3982_4395 135
501 3300037471 Ga0395905_0035340 Ga0395905_0035340_566_979 135
502 3300037471 Ga0395905_0492727 Ga0395905_0492727_204_611 135
503 3300038443 Ga0395901_0000098 Ga0395901_0000098_23461_23874 135
504 3300038443 Ga0395901_0328642 Ga0395901_0328642_534_941 135
505 3300038443 Ga0395901_1668548 Ga0395901_1668548_30_449 135
506 3300039437 Ga0436365_0185961 Ga0436365_0185961_297_704 135
507 3300041404 Ga0439436_0073494 Ga0439436_0073494_144_554 135
508 3300041408 Ga0439453_0006788 Ga0439453_0006788_1177_1584 135
509 3300041413 Ga0439465_0182310 Ga0439465_0182310_222_629 135
510 3300041413 Ga0439465_0397657 Ga0439465_0397657_54_470 135
511 3300041452 Ga0451793_1783914 Ga0451793_1783914_155_562 135
512 3300041512 Ga0451853_1343388 Ga0451853_1343388_135_548 135
513 3300042007 Ga0439449_0063176 Ga0439449_0063176_460_870 135
514 3300042014 Ga0439457_112169 Ga0439457_112169_72_488 135
515 3300042015 Ga0439462_0102870 Ga0439462_0102870_358_768 135
516 3300042435 Ga0439434_0063959 Ga0439434_0063959_456_866 135
517 3300044656 Ga0466969_0032926 Ga0466969_0032926_2120_2557 135
518 3300044684 Ga0466966_0002396 Ga0466966_0002396_7187_7594 135
519 3300044693 Ga0466961_0031753 Ga0466961_0031753_212_619 135
520 3300044694 Ga0466963_0149066 Ga0466963_0149066_761_1168 135
521 3300044706 Ga0466964_0012873 Ga0466964_0012873_651_1058 135
522 3300044712 Ga0453684_0049083 Ga0453684_0049083_4291_4704 135
523 3300044719 Ga0466971_0036994 Ga0466971_0036994_1304_1711 135
524 3300044735 Ga0466968_0014677 Ga0466968_0014677_1327_1734 135
525 3300044735 Ga0466968_0031665 Ga0466968_0031665_566_973 135
526 3300044842 Ga0466957_0004514 Ga0466957_0004514_1456_1863 135
527 3300045049 Ga0466959_0004778 Ga0466959_0004778_2808_3215 135
528 3300045049 Ga0466959_0098199 Ga0466959_0098199_595_1032 135
529 3300045836 Ga0466958_0027877 Ga0466958_0027877_180_587 135
530 3300045976 Ga0466967_0134351 Ga0466967_0134351_1185_1592 135
531 3300045976 Ga0466967_0350179 Ga0466967_0350179_504_911 135
532 3300046452 Ga0495617_000337 Ga0495617_000337_3460_3873 135
533 3300046452 Ga0495617_255395 Ga0495617_255395_82_495 135
534 3300046453 Ga0495627_016747 Ga0495627_016747_1322_1729 135
535 3300046459 Ga0495629_0712689 Ga0495629_0712689_171_584 135
536 3300046460 Ga0495638_0000430 Ga0495638_0000430_26593_27006 135
537 3300046462 Ga0495651_0953672 Ga0495651_0953672_84_491 135
538 3300046492 Ga0495585_0000028 Ga0495585_0000028_12312_12725 135
539 3300046501 Ga0495607_0000438 Ga0495607_0000438_5189_5602 135
540 3300046501 Ga0495607_0025777 Ga0495607_0025777_413_823 135
541 3300046506 Ga0495583_0025518 Ga0495583_0025518_2391_2804 135
542 3300046511 Ga0495608_0489218 Ga0495608_0489218_109_516 135
543 3300046513 Ga0495616_0357026 Ga0495616_0357026_147_560 135
544 3300046515 Ga0495620_0323856 Ga0495620_0323856_61_468 135
545 3300046516 Ga0495628_0487134 Ga0495628_0487134_202_609 135
546 3300046517 Ga0495630_0341975 Ga0495630_0341975_565_972 135
547 3300046518 Ga0495631_0004267 Ga0495631_0004267_4359_4772 135
548 3300046519 Ga0495632_0096863 Ga0495632_0096863_676_1089 135
549 3300046520 Ga0495637_0005084 Ga0495637_0005084_1735_2148 135
550 3300046524 Ga0495648_0002326 Ga0495648_0002326_9939_10352 135
551 3300046525 Ga0495663_0001265 Ga0495663_0001265_3933_4349 135
552 3300046533 Ga0495640_0477513 Ga0495640_0477513_141_548 135
553 3300046538 Ga0495609_0185436 Ga0495609_0185436_71_484 135
554 3300046615 Ga0495656_0003485 Ga0495656_0003485_382_789 135
555 3300046616 Ga0495668_0005604 Ga0495668_0005604_7495_7908 135
556 3300046616 Ga0495668_0153508 Ga0495668_0153508_695_1102 135
557 3300046642 Ga0495634_0398660 Ga0495634_0398660_296_703 135
558 3300046648 Ga0495611_0017877 Ga0495611_0017877_2405_2818 135
559 3300046660 Ga0495625_0263704 Ga0495625_0263704_364_780 135
560 3300046664 Ga0495659_0040301 Ga0495659_0040301_672_1079 135
561 3300046665 Ga0495661_0010391 Ga0495661_0010391_5881_6294 135
562 3300046665 Ga0495661_0448951 Ga0495661_0448951_74_487 135
563 3300046678 Ga0495599_0094041 Ga0495599_0094041_713_1120 135
564 3300046679 Ga0495623_0515199 Ga0495623_0515199_153_560 135
565 3300046681 Ga0495647_0168550 Ga0495647_0168550_290_697 135
566 3300046683 Ga0495658_0040275 Ga0495658_0040275_1638_2045 135
567 3300046684 Ga0495669_0005214 Ga0495669_0005214_1389_1796 135
568 3300046691 Ga0495670_0002216 Ga0495670_0002216_5206_5619 135
569 3300046692 Ga0495671_0003326 Ga0495671_0003326_4087_4500 135
570 3300046692 Ga0495671_0409018 Ga0495671_0409018_37_453 135
571 3300046794 Ga0495589_0000523 Ga0495589_0000523_23684_24097 135
572 3300046794 Ga0495589_0200348 Ga0495589_0200348_357_770 135
573 3300046810 Ga0495660_0000076 Ga0495660_0000076_97493_97906 135
574 3300046810 Ga0495660_0000567 Ga0495660_0000567_11310_11723 135
575 3300047318 Ga0495636_0022435 Ga0495636_0022435_2092_2499 135
576 3300047318 Ga0495636_0170311 Ga0495636_0170311_28_435 135
577 3300047318 Ga0495636_0349632 Ga0495636_0349632_85_492 135
578 3300047322 Ga0495680_0749047 Ga0495680_0749047_120_533 135
579 3300047445 Ga0495677_0149952 Ga0495677_0149952_202_609 135
580 3300047446 Ga0495679_000001 Ga0495679_000001_1316821_1317234 135
581 3300047469 Ga0495673_0000087 Ga0495673_0000087_62102_62515 135
582 3300047469 Ga0495673_0001346 Ga0495673_0001346_14902_15315 135
583 3300047469 Ga0495673_0108343 Ga0495673_0108343_391_807 135
584 3300047469 Ga0495673_0164798 Ga0495673_0164798_323_736 135
585 3300047471 Ga0495684_0222066 Ga0495684_0222066_533_940 135
586 3300047472 Ga0495686_0138193 Ga0495686_0138193_69_482 135
587 3300047472 Ga0495686_0182569 Ga0495686_0182569_358_768 135
588 3300048903 Ga0496100_0011561 Ga0496100_0011561_2571_2984 135
589 3300048904 Ga0496101_0005404 Ga0496101_0005404_7584_7997 135
590 3300048910 Ga0496107_0797028 Ga0496107_0797028_273_680 135
591 3300048914 Ga0496111_0481930 Ga0496111_0481930_145_555 135
592 3300048918 Ga0496115_0288793 Ga0496115_0288793_304_714 135
593 3300048921 Ga0496118_0203476 Ga0496118_0203476_193_609 135
594 3300048924 Ga0496121_0001673 Ga0496121_0001673_29677_30090 135
595 3300048924 Ga0496121_0348763 Ga0496121_0348763_25_432 135
596 3300048924 Ga0496121_0363492 Ga0496121_0363492_99_509 135
597 3300048925 Ga0496122_0012141 Ga0496122_0012141_4628_5035 135
598 3300048925 Ga0496122_0041865 Ga0496122_0041865_2514_2927 135
599 3300048925 Ga0496122_0145357 Ga0496122_0145357_439_852 135
600 3300048925 Ga0496122_0192190 Ga0496122_0192190_158_574 135
601 3300048926 Ga0496123_0003232 Ga0496123_0003232_17664_18077 135
602 3300048926 Ga0496123_0040310 Ga0496123_0040310_1993_2400 135
603 3300048926 Ga0496123_0152610 Ga0496123_0152610_440_847 135
604 3300048926 Ga0496123_0321276 Ga0496123_0321276_272_688 135
605 3300048927 Ga0496124_0111309 Ga0496124_0111309_830_1237 135
606 3300049459 Ga0495678_000028 Ga0495678_000028_44615_45028 135
607 3300049460 Ga0495682_0002363 Ga0495682_0002363_1205_1618 135
608 3300049460 Ga0495682_0011933 Ga0495682_0011933_245_658 135
609 3300049523 Ga0501300_052506 Ga0501300_052506_72_503 135
610 3300049569 Ga0501032_0118318 Ga0501032_0118318_18_434 135
611 3300049570 Ga0501033_0101555 Ga0501033_0101555_1490_1906 135
612 3300049570 Ga0501033_0218682 Ga0501033_0218682_439_849 135
613 3300049571 Ga0501034_0006833 Ga0501034_0006833_1838_2248 135
614 3300049571 Ga0501034_0009247 Ga0501034_0009247_7804_8211 135
615 3300049571 Ga0501034_0141331 Ga0501034_0141331_1219_1635 135
616 3300049571 Ga0501034_0465960 Ga0501034_0465960_183_590 135
617 3300049571 Ga0501034_0513540 Ga0501034_0513540_595_1005 135
618 3300049572 Ga0501036_1434206 Ga0501036_1434206_112_522 135
619 3300049573 Ga0501037_0033835 Ga0501037_0033835_386_808 135
620 3300049573 Ga0501037_0042176 Ga0501037_0042176_1494_1904 135
621 3300049578 Ga0501042_1440047 Ga0501042_1440047_54_461 135
622 3300049579 Ga0501043_0162565 Ga0501043_0162565_608_1018 135
623 3300049579 Ga0501043_0977267 Ga0501043_0977267_19_426 135
624 3300049581 Ga0501047_0001004 Ga0501047_0001004_15985_16392 135
625 3300049581 Ga0501047_0098285 Ga0501047_0098285_518_925 135
626 3300049581 Ga0501047_0677351 Ga0501047_0677351_57_467 135
627 3300049582 Ga0501048_0365626 Ga0501048_0365626_202_612 135
628 3300049590 Ga0501074_0218471 Ga0501074_0218471_505_912 135
629 3300049742 Ga0501080_0270694 Ga0501080_0270694_673_1080 135
630 3300049762 Ga0501265_006029 Ga0501265_006029_527_958 135
631 3300049766 Ga0501269_002551 Ga0501269_002551_1450_1857 135
632 3300049772 Ga0501275_000999 Ga0501275_000999_1317_1748 135
633 3300049822 Ga0501035_0094503 Ga0501035_0094503_1220_1630 135
634 3300049822 Ga0501035_0125653 Ga0501035_0125653_1666_2082 135
635 3300049822 Ga0501035_0528885 Ga0501035_0528885_196_603 135
636 3300049823 Ga0501044_0026683 Ga0501044_0026683_302_709 135
637 3300049823 Ga0501044_0051951 Ga0501044_0051951_3640_4050 135
638 3300049823 Ga0501044_0159204 Ga0501044_0159204_978_1394 135
639 3300049823 Ga0501044_0588976 Ga0501044_0588976_280_687 135
640 3300049823 Ga0501044_0698258 Ga0501044_0698258_481_888 135
641 3300049823 Ga0501044_0997468 Ga0501044_0997468_61_468 135
642 3300050490 nmdc:mga03n38_163407_c1 nmdc:mga03n38_163407_c1_636_1043 135
643 3300050490 nmdc:mga03n38_499416_c1 nmdc:mga03n38_499416_c1_215_631 135
644 3300050492 nmdc:mga0yw44_826801_c1 nmdc:mga0yw44_826801_c1_36_443 135
645 3300050493 nmdc:mga0k408_44177_c1 nmdc:mga0k408_44177_c1_1299_1706 135
646 3300050494 nmdc:mga06z11_203515_c1 nmdc:mga06z11_203515_c1_128_535 135
647 3300050495 nmdc:mga04h51_260696_c1 nmdc:mga04h51_260696_c1_165_572 135
648 3300050496 nmdc:mga07m45_194545_c1 nmdc:mga07m45_194545_c1_460_867 135
649 3300050496 nmdc:mga07m45_221047_c1 nmdc:mga07m45_221047_c1_201_608 135
650 3300050507 nmdc:mga05p37_251174_c1 nmdc:mga05p37_251174_c1_111_542 135
651 3300050516 nmdc:mga0sz30_143009_c1 nmdc:mga0sz30_143009_c1_604_1011 135
652 3300053087 Ga0500643_000152 Ga0500643_000152_31569_31982 135
653 3300053103 Ga0500555_000409 Ga0500555_000409_9809_10222 135
654 3300053108 Ga0500562_090737 Ga0500562_090737_322_735 135
655 3300053131 Ga0500652_224977 Ga0500652_224977_322_735 135
656 3300053140 Ga0500573_0165823 Ga0500573_0165823_133_540 135
657 3300053178 Ga0500637_0453864 Ga0500637_0453864_19_426 135
658 3300053730 Ga0500645_002248 Ga0500645_002248_2698_3111 135
659 3300061719 Ga0466962_0008145 Ga0466962_0008145_1488_1895 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

10

140

0.89

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

17

143

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9366 1 132
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9329 1 130
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9308 2 134
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.9297 1 132
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.9062 1 130
ID Description Score Start End Superfamily
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9131 83 131 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8522 83 132 3.30.720.110
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8308 1 132 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8244 81 134 3.30.720.110
4g6xA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8228 2 132 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A257KH99-F1-model_v4 Glyoxalase 0.9973 1 132
AF-A0A0Q8S3J9-F1-model_v4 Glyoxalase 0.9899 2 133
AF-A0A522EC71-F1-model_v4 VOC family protein 0.9877 1 132
AF-A0A1H1H8R4-F1-model_v4 Catechol 2,3-dioxygenase 0.9874 1 134 GO:0051213
AF-A0A7Y8GXY9-F1-model_v4 VOC family protein 0.9841 1 133

Feature Viewer

pLDDT pTM Quality
94.95 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map