F472986
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 656 | 366 | 655 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300003794|Ga0055531_10060115|Ga0055531_100601152 |
| Length | 185 |
| Sequence | MSQLKIAVVIGSLRKDSLNRKLALALAQLAPSGVTFEHVRIDDLPHYDQDQDGNQAPEVRRLKNEISAADGVLFVTPEYNRSVPGVLKNAIDNASRPYDGQSAWAGKPAGVIGISVGAIGTALAQQHLRNTLAYLDMPTLGQPEAFVQNKEGLFDDKGHVAVEATREFLKGWVEKYVAWVKAHAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2974320154 | Acidovorax wautersii SORGH_AS 335 | Isolate | Unclassified |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 4 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 87 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 88 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 195 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 204 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 208 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 211 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 213 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 217 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 218 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 219 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 224 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 232 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 233 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 234 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 235 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 236 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 241 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 242 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 243 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 244 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 245 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 246 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 250 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 251 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 254 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 255 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 256 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 257 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 258 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 259 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 260 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 261 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 262 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 263 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 264 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 265 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 266 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 267 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 268 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 269 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 270 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 271 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 317 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 318 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 319 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 322 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 344 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 346 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 347 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 356 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 357 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 360 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 366 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.39 |
| Metatranscriptomes | 0.46 |
| Isolates | 0.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.45 |
| Nodule | 0.15 |
| Rhizoplane | 5.64 |
| Rhizosphere | 78.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10010593 | 3300002075 | Bacteria | 2047 |
| 2 | JGI25159J45721_1028197 | 3300002987 | Bacteria | 941 |
| 3 | JGI25151J46595_10007367 | 3300003187 | Bacteria | 5405 |
| 4 | rootH1_10053255 | 3300003323 | Bacteria | 3687 |
| 5 | Ga0007416J51690_1045190 | 3300003577 | Bacteria | 1452 |
| 6 | Ga0055525_1000046 | 3300003759 | Bacteria | 261587 |
| 7 | Ga0055536_1038771 | 3300003781 | Bacteria | 1151 |
| 8 | Ga0055534_1000830 | 3300003784 | Bacteria | 14273 |
| 9 | Ga0055531_10001259 | 3300003794 | Bacteria | 19156 |
| 10 | Ga0055531_10060115 | 3300003794 | Bacteria | 934 |
| 11 | Ga0065714_10158578 | 3300005288 | Bacteria | 1064 |
| 12 | Ga0065712_10488927 | 3300005290 | Bacteria | 657 |
| 13 | Ga0065715_10246939 | 3300005293 | Bacteria | 1180 |
| 14 | Ga0070658_10036341 | 3300005327 | Bacteria | 3970 |
| 15 | Ga0070658_10163156 | 3300005327 | Bacteria | 1870 |
| 16 | Ga0070676_10058519 | 3300005328 | Bacteria | 2284 |
| 17 | Ga0070677_10003364 | 3300005333 | Bacteria | 5154 |
| 18 | Ga0068869_100014018 | 3300005334 | Bacteria | 5348 |
| 19 | Ga0070680_100020142 | 3300005336 | Bacteria | 5292 |
| 20 | Ga0068868_100128778 | 3300005338 | Bacteria | 2070 |
| 21 | Ga0068868_100613629 | 3300005338 | Bacteria | 965 |
| 22 | Ga0070691_10010717 | 3300005341 | Bacteria | 4184 |
| 23 | Ga0070687_100081552 | 3300005343 | Bacteria | 1766 |
| 24 | Ga0070661_100150208 | 3300005344 | Bacteria | 1761 |
| 25 | Ga0070692_10045832 | 3300005345 | Bacteria | 2257 |
| 26 | Ga0070675_100007299 | 3300005354 | Bacteria | 8530 |
| 27 | Ga0070675_100055685 | 3300005354 | Bacteria | 3256 |
| 28 | Ga0070675_100767959 | 3300005354 | Bacteria | 880 |
| 29 | Ga0070671_100176145 | 3300005355 | Bacteria | 1810 |
| 30 | Ga0070671_100354747 | 3300005355 | Unclassified | 1252 |
| 31 | Ga0070674_100019397 | 3300005356 | Bacteria | 4319 |
| 32 | Ga0070674_100396412 | 3300005356 | Unclassified | 1127 |
| 33 | Ga0070673_100005707 | 3300005364 | Bacteria | 8001 |
| 34 | Ga0070673_100053999 | 3300005364 | Bacteria | 3159 |
| 35 | Ga0070673_100172184 | 3300005364 | Unclassified | 1848 |
| 36 | Ga0070688_100567641 | 3300005365 | Unclassified | 865 |
| 37 | Ga0070659_100542326 | 3300005366 | Bacteria | 995 |
| 38 | Ga0070667_100000126 | 3300005367 | Bacteria | 96729 |
| 39 | Ga0070667_100017882 | 3300005367 | Bacteria | 5875 |
| 40 | Ga0070667_100066632 | 3300005367 | Bacteria | 3060 |
| 41 | Ga0070703_10002365 | 3300005406 | Bacteria | 5443 |
| 42 | Ga0070713_100415619 | 3300005436 | Bacteria | 1258 |
| 43 | Ga0070701_10013275 | 3300005438 | Bacteria | 3744 |
| 44 | Ga0070701_10013492 | 3300005438 | Bacteria | 3719 |
| 45 | Ga0070705_100000901 | 3300005440 | Bacteria | 16586 |
| 46 | Ga0070700_100001924 | 3300005441 | Bacteria | 10504 |
| 47 | Ga0070694_100001405 | 3300005444 | Bacteria | 14089 |
| 48 | Ga0070708_100016481 | 3300005445 | Bacteria | 6134 |
| 49 | Ga0070663_100135786 | 3300005455 | Bacteria | 1872 |
| 50 | Ga0070663_100489168 | 3300005455 | Bacteria | 1020 |
| 51 | Ga0070678_100155685 | 3300005456 | Bacteria | 1846 |
| 52 | Ga0070678_100170557 | 3300005456 | Bacteria | 1772 |
| 53 | Ga0070678_100283762 | 3300005456 | Bacteria | 1401 |
| 54 | Ga0070662_100004214 | 3300005457 | Bacteria | 9058 |
| 55 | Ga0070662_100084052 | 3300005457 | Bacteria | 2377 |
| 56 | Ga0070662_100405133 | 3300005457 | Bacteria | 1126 |
| 57 | Ga0070681_10134315 | 3300005458 | Bacteria | 2405 |
| 58 | Ga0070681_10657371 | 3300005458 | Bacteria | 963 |
| 59 | Ga0068867_100006945 | 3300005459 | Bacteria | 8010 |
| 60 | Ga0068867_100327498 | 3300005459 | Bacteria | 1271 |
| 61 | Ga0070685_10782778 | 3300005466 | Bacteria | 702 |
| 62 | Ga0070706_100029463 | 3300005467 | Bacteria | 5057 |
| 63 | Ga0070698_100017908 | 3300005471 | Bacteria | 7463 |
| 64 | Ga0070699_100015194 | 3300005518 | Bacteria | 6615 |
| 65 | Ga0070679_100241151 | 3300005530 | Bacteria | 1765 |
| 66 | Ga0070679_100388884 | 3300005530 | Bacteria | 1341 |
| 67 | Ga0070679_100414668 | 3300005530 | Bacteria | 1292 |
| 68 | Ga0070697_100009532 | 3300005536 | Bacteria | 7588 |
| 69 | Ga0070672_100097790 | 3300005543 | Bacteria | 2376 |
| 70 | Ga0070672_100117463 | 3300005543 | Bacteria | 2175 |
| 71 | Ga0070695_100000158 | 3300005545 | Bacteria | 32227 |
| 72 | Ga0070696_100004561 | 3300005546 | Bacteria | 9246 |
| 73 | Ga0070693_100022136 | 3300005547 | Bacteria | 3375 |
| 74 | Ga0070665_100011192 | 3300005548 | Bacteria | 9072 |
| 75 | Ga0070665_100088712 | 3300005548 | Bacteria | 3098 |
| 76 | Ga0070665_100805428 | 3300005548 | Bacteria | 952 |
| 77 | Ga0070704_100008256 | 3300005549 | Bacteria | 6233 |
| 78 | Ga0070704_100059348 | 3300005549 | Bacteria | 2729 |
| 79 | Ga0068855_100029598 | 3300005563 | Bacteria | 6546 |
| 80 | Ga0068855_100086706 | 3300005563 | Bacteria | 3620 |
| 81 | Ga0068855_100126864 | 3300005563 | Bacteria | 2917 |
| 82 | Ga0068855_100828720 | 3300005563 | Bacteria | 981 |
| 83 | Ga0070664_100041366 | 3300005564 | Bacteria | 3889 |
| 84 | Ga0070664_101256036 | 3300005564 | Bacteria | 699 |
| 85 | Ga0068857_100009560 | 3300005577 | Bacteria | 8420 |
| 86 | Ga0068854_100112572 | 3300005578 | Bacteria | 2055 |
| 87 | Ga0068854_100565227 | 3300005578 | Bacteria | 967 |
| 88 | Ga0070702_100621617 | 3300005615 | Unclassified | 813 |
| 89 | Ga0068852_100385929 | 3300005616 | Bacteria | 1375 |
| 90 | Ga0068852_100665084 | 3300005616 | Bacteria | 1050 |
| 91 | Ga0068859_100003502 | 3300005617 | Bacteria | 15988 |
| 92 | Ga0068859_100573091 | 3300005617 | Bacteria | 1223 |
| 93 | Ga0068864_100014556 | 3300005618 | Bacteria | 6536 |
| 94 | Ga0068864_100025178 | 3300005618 | Bacteria | 5009 |
| 95 | Ga0068864_100379845 | 3300005618 | Bacteria | 1339 |
| 96 | Ga0068866_10089975 | 3300005718 | Bacteria | 1669 |
| 97 | Ga0068866_10391779 | 3300005718 | Bacteria | 894 |
| 98 | Ga0068861_100042905 | 3300005719 | Bacteria | 3392 |
| 99 | Ga0068861_100194215 | 3300005719 | Bacteria | 1699 |
| 100 | Ga0068861_100414923 | 3300005719 | Unclassified | 1198 |
| 101 | Ga0068870_10009503 | 3300005840 | Bacteria | 4428 |
| 102 | Ga0068870_10018925 | 3300005840 | Bacteria | 3334 |
| 103 | Ga0068863_100794612 | 3300005841 | Bacteria | 944 |
| 104 | Ga0068858_100054191 | 3300005842 | Bacteria | 3708 |
| 105 | Ga0068860_100001841 | 3300005843 | Bacteria | 22590 |
| 106 | Ga0068860_100113479 | 3300005843 | Bacteria | 2591 |
| 107 | Ga0068862_100002731 | 3300005844 | Bacteria | 15492 |
| 108 | Ga0068862_100043810 | 3300005844 | Bacteria | 3815 |
| 109 | Ga0075368_10047295 | 3300006042 | Bacteria | 1703 |
| 110 | Ga0075363_100110546 | 3300006048 | Bacteria | 1527 |
| 111 | Ga0075363_100192940 | 3300006048 | Bacteria | 1162 |
| 112 | Ga0075364_10068103 | 3300006051 | Bacteria | 2340 |
| 113 | Ga0070716_100123171 | 3300006173 | Bacteria | 1627 |
| 114 | Ga0070716_100245128 | 3300006173 | Bacteria | 1217 |
| 115 | Ga0075362_10198653 | 3300006177 | Bacteria | 976 |
| 116 | Ga0075367_10097913 | 3300006178 | Bacteria | 1790 |
| 117 | Ga0075367_10244352 | 3300006178 | Bacteria | 1125 |
| 118 | Ga0075366_10000371 | 3300006195 | Bacteria | 20821 |
| 119 | Ga0075366_10014438 | 3300006195 | Bacteria | 4511 |
| 120 | Ga0075366_10015834 | 3300006195 | Bacteria | 4329 |
| 121 | Ga0075366_10048208 | 3300006195 | Bacteria | 2525 |
| 122 | Ga0097621_100031472 | 3300006237 | Bacteria | 4211 |
| 123 | Ga0097621_100073271 | 3300006237 | Bacteria | 2835 |
| 124 | Ga0097621_100086234 | 3300006237 | Bacteria | 2620 |
| 125 | Ga0097621_100204124 | 3300006237 | Bacteria | 1717 |
| 126 | Ga0097621_100295183 | 3300006237 | Bacteria | 1430 |
| 127 | Ga0075370_10009692 | 3300006353 | Bacteria | 5013 |
| 128 | Ga0075370_10040097 | 3300006353 | Bacteria | 2641 |
| 129 | Ga0075370_10169388 | 3300006353 | Bacteria | 1283 |
| 130 | Ga0075370_10397692 | 3300006353 | Bacteria | 826 |
| 131 | Ga0068871_100027904 | 3300006358 | Bacteria | 4421 |
| 132 | Ga0068871_100185732 | 3300006358 | Bacteria | 1788 |
| 133 | Ga0068871_100330282 | 3300006358 | Bacteria | 1345 |
| 134 | Ga0068871_100796591 | 3300006358 | Bacteria | 871 |
| 135 | Ga0075430_100074103 | 3300006846 | Bacteria | 2854 |
| 136 | Ga0075431_100228668 | 3300006847 | Bacteria | 1896 |
| 137 | Ga0075433_10292612 | 3300006852 | Bacteria | 1442 |
| 138 | Ga0075429_100386532 | 3300006880 | Bacteria | 1225 |
| 139 | Ga0068865_100157758 | 3300006881 | Bacteria | 1728 |
| 140 | Ga0068865_100384230 | 3300006881 | Bacteria | 1146 |
| 141 | Ga0097620_100003500 | 3300006931 | Bacteria | 15988 |
| 142 | Ga0097620_100573063 | 3300006931 | Bacteria | 1223 |
| 143 | Ga0099826_10100537 | 3300006948 | Bacteria | 1745 |
| 144 | Ga0099795_10022813 | 3300007788 | Bacteria | 2070 |
| 145 | Ga0105244_10006285 | 3300009036 | Bacteria | 7731 |
| 146 | Ga0105240_10002809 | 3300009093 | Bacteria | 27496 |
| 147 | Ga0105240_10264560 | 3300009093 | Bacteria | 1983 |
| 148 | Ga0105240_10315421 | 3300009093 | Bacteria | 1784 |
| 149 | Ga0105240_10422603 | 3300009093 | Bacteria | 1497 |
| 150 | Ga0105240_10829872 | 3300009093 | Bacteria | 999 |
| 151 | Ga0111539_10007314 | 3300009094 | Bacteria | 14138 |
| 152 | Ga0111539_10319637 | 3300009094 | Bacteria | 1806 |
| 153 | Ga0111539_10346507 | 3300009094 | Bacteria | 1729 |
| 154 | Ga0111539_10382640 | 3300009094 | Bacteria | 1638 |
| 155 | Ga0105245_10227463 | 3300009098 | Bacteria | 1802 |
| 156 | Ga0105247_10630404 | 3300009101 | Bacteria | 798 |
| 157 | Ga0114129_11077473 | 3300009147 | Bacteria | 1007 |
| 158 | Ga0114129_11537441 | 3300009147 | Bacteria | 816 |
| 159 | Ga0105243_10014281 | 3300009148 | Bacteria | 6009 |
| 160 | Ga0105243_10020340 | 3300009148 | Bacteria | 5034 |
| 161 | Ga0105243_11599670 | 3300009148 | Bacteria | 678 |
| 162 | Ga0105241_10279185 | 3300009174 | Bacteria | 1426 |
| 163 | Ga0105241_11588154 | 3300009174 | Unclassified | 632 |
| 164 | Ga0105242_10135094 | 3300009176 | Bacteria | 2134 |
| 165 | Ga0105242_10457450 | 3300009176 | Bacteria | 1204 |
| 166 | Ga0105242_10475924 | 3300009176 | Bacteria | 1183 |
| 167 | Ga0105242_11013213 | 3300009176 | Bacteria | 839 |
| 168 | Ga0105248_10097185 | 3300009177 | Bacteria | 3318 |
| 169 | Ga0105237_10006964 | 3300009545 | Bacteria | 12461 |
| 170 | Ga0105237_10122282 | 3300009545 | Bacteria | 2597 |
| 171 | Ga0105237_10255533 | 3300009545 | Bacteria | 1754 |
| 172 | Ga0105238_10218757 | 3300009551 | Bacteria | 1880 |
| 173 | Ga0105238_10277921 | 3300009551 | Bacteria | 1655 |
| 174 | Ga0105238_10452207 | 3300009551 | Bacteria | 1281 |
| 175 | Ga0105238_10785937 | 3300009551 | Bacteria | 967 |
| 176 | Ga0105249_10046892 | 3300009553 | Bacteria | 3935 |
| 177 | Ga0105249_10184246 | 3300009553 | Bacteria | 2033 |
| 178 | Ga0099796_10009871 | 3300010159 | Bacteria | 2602 |
| 179 | Ga0105239_10001353 | 3300010375 | Bacteria | 32991 |
| 180 | Ga0105239_10206651 | 3300010375 | Bacteria | 2200 |
| 181 | Ga0105239_10494175 | 3300010375 | Bacteria | 1391 |
| 182 | Ga0105246_10000896 | 3300011119 | Bacteria | 17101 |
| 183 | Ga0105246_10019026 | 3300011119 | Bacteria | 4381 |
| 184 | Ga0105246_10097776 | 3300011119 | Bacteria | 2131 |
| 185 | Ga0157373_10064951 | 3300013100 | Bacteria | 2583 |
| 186 | Ga0157373_10178389 | 3300013100 | Bacteria | 1495 |
| 187 | Ga0157370_10034191 | 3300013104 | Bacteria | 4952 |
| 188 | Ga0157370_10034844 | 3300013104 | Bacteria | 4898 |
| 189 | Ga0157370_10157913 | 3300013104 | Bacteria | 2110 |
| 190 | Ga0157370_10788032 | 3300013104 | Bacteria | 865 |
| 191 | Ga0157370_11352092 | 3300013104 | Bacteria | 641 |
| 192 | Ga0157378_10075339 | 3300013297 | Bacteria | 3038 |
| 193 | Ga0163162_10204769 | 3300013306 | Bacteria | 2102 |
| 194 | Ga0163162_10207189 | 3300013306 | Bacteria | 2090 |
| 195 | Ga0157372_10816511 | 3300013307 | Bacteria | 1083 |
| 196 | Ga0157375_10005559 | 3300013308 | Bacteria | 10970 |
| 197 | Ga0157375_10664819 | 3300013308 | Bacteria | 1197 |
| 198 | Ga0157375_11238975 | 3300013308 | Bacteria | 876 |
| 199 | Ga0163163_10087001 | 3300014325 | Bacteria | 3135 |
| 200 | Ga0163163_10270276 | 3300014325 | Bacteria | 1751 |
| 201 | Ga0157380_10017946 | 3300014326 | Bacteria | 5246 |
| 202 | Ga0157380_10039990 | 3300014326 | Bacteria | 3650 |
| 203 | Ga0157380_10043724 | 3300014326 | Bacteria | 3508 |
| 204 | Ga0157380_10081240 | 3300014326 | Bacteria | 2651 |
| 205 | Ga0157380_10091942 | 3300014326 | Unclassified | 2506 |
| 206 | Ga0157380_10492242 | 3300014326 | Unclassified | 1189 |
| 207 | Ga0157380_11486310 | 3300014326 | Bacteria | 730 |
| 208 | Ga0182008_10000190 | 3300014497 | Bacteria | 48677 |
| 209 | Ga0182008_10001821 | 3300014497 | Bacteria | 13892 |
| 210 | Ga0182008_10012122 | 3300014497 | Bacteria | 4560 |
| 211 | Ga0182008_10055900 | 3300014497 | Bacteria | 1951 |
| 212 | Ga0157377_10158844 | 3300014745 | Bacteria | 1404 |
| 213 | Ga0157377_10333239 | 3300014745 | Bacteria | 1012 |
| 214 | Ga0157376_10104459 | 3300014969 | Bacteria | 2482 |
| 215 | Ga0157376_10277736 | 3300014969 | Bacteria | 1576 |
| 216 | Ga0157376_10529909 | 3300014969 | Bacteria | 1162 |
| 217 | Ga0157376_10571101 | 3300014969 | Bacteria | 1122 |
| 218 | Ga0157376_10848076 | 3300014969 | Bacteria | 929 |
| 219 | Ga0157376_10935923 | 3300014969 | Bacteria | 886 |
| 220 | Ga0182006_1001217 | 3300015261 | Bacteria | 16063 |
| 221 | Ga0182007_10000916 | 3300015262 | Bacteria | 16314 |
| 222 | Ga0182007_10001403 | 3300015262 | Bacteria | 12974 |
| 223 | Ga0182005_1021950 | 3300015265 | Bacteria | 1749 |
| 224 | Ga0163161_10000092 | 3300017792 | Bacteria | 90636 |
| 225 | Ga0163161_10048563 | 3300017792 | Bacteria | 3065 |
| 226 | Ga0163161_10048941 | 3300017792 | Bacteria | 3053 |
| 227 | Ga0163161_10070504 | 3300017792 | Bacteria | 2555 |
| 228 | Ga0163161_10087775 | 3300017792 | Bacteria | 2298 |
| 229 | Ga0163161_10194495 | 3300017792 | Bacteria | 1560 |
| 230 | Ga0206356_11249086 | 3300020070 | Bacteria | 837 |
| 231 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 232 | Ga0209148_1000501 | 3300025254 | Bacteria | 39942 |
| 233 | Ga0207666_1033809 | 3300025271 | Bacteria | 789 |
| 234 | Ga0209455_1003800 | 3300025272 | Bacteria | 5184 |
| 235 | Ga0209673_1041890 | 3300025273 | Bacteria | 1294 |
| 236 | Ga0209130_1004992 | 3300025284 | Bacteria | 4791 |
| 237 | Ga0209675_1004723 | 3300025291 | Bacteria | 5948 |
| 238 | Ga0209676_1001468 | 3300025292 | Bacteria | 21920 |
| 239 | Ga0209676_1025600 | 3300025292 | Bacteria | 1889 |
| 240 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 241 | Ga0209564_1041276 | 3300025295 | Bacteria | 1240 |
| 242 | Ga0209051_1000254 | 3300025303 | Bacteria | 90411 |
| 243 | Ga0209051_1020090 | 3300025303 | Bacteria | 2890 |
| 244 | Ga0209257_1000012 | 3300025304 | Bacteria | 1111138 |
| 245 | Ga0209257_1000045 | 3300025304 | Bacteria | 484429 |
| 246 | Ga0209257_1000137 | 3300025304 | Bacteria | 204210 |
| 247 | Ga0209257_1010252 | 3300025304 | Bacteria | 4792 |
| 248 | Ga0207655_1010441 | 3300025728 | Bacteria | 5629 |
| 249 | Ga0207653_10002878 | 3300025885 | Bacteria | 5463 |
| 250 | Ga0207682_10002252 | 3300025893 | Bacteria | 8707 |
| 251 | Ga0207692_10043374 | 3300025898 | Bacteria | 2238 |
| 252 | Ga0207642_10102332 | 3300025899 | Bacteria | 1441 |
| 253 | Ga0207642_10266882 | 3300025899 | Bacteria | 978 |
| 254 | Ga0207688_10254502 | 3300025901 | Bacteria | 1064 |
| 255 | Ga0207685_10120601 | 3300025905 | Bacteria | 1150 |
| 256 | Ga0207645_10166886 | 3300025907 | Bacteria | 1442 |
| 257 | Ga0207643_10045292 | 3300025908 | Bacteria | 2484 |
| 258 | Ga0207643_10124418 | 3300025908 | Bacteria | 1530 |
| 259 | Ga0207705_10032130 | 3300025909 | Bacteria | 3750 |
| 260 | Ga0207705_10058067 | 3300025909 | Bacteria | 2791 |
| 261 | Ga0207654_10230518 | 3300025911 | Bacteria | 1233 |
| 262 | Ga0207654_10925928 | 3300025911 | Bacteria | 632 |
| 263 | Ga0207707_10152090 | 3300025912 | Bacteria | 2023 |
| 264 | Ga0207707_11048495 | 3300025912 | Bacteria | 667 |
| 265 | Ga0207695_10005251 | 3300025913 | Bacteria | 17291 |
| 266 | Ga0207695_10565174 | 3300025913 | Bacteria | 1019 |
| 267 | Ga0207671_10001552 | 3300025914 | Bacteria | 26284 |
| 268 | Ga0207671_10545140 | 3300025914 | Bacteria | 925 |
| 269 | Ga0207660_10004296 | 3300025917 | Bacteria | 9297 |
| 270 | Ga0207662_10100667 | 3300025918 | Bacteria | 1790 |
| 271 | Ga0207649_10115897 | 3300025920 | Bacteria | 1798 |
| 272 | Ga0207652_10322397 | 3300025921 | Bacteria | 1395 |
| 273 | Ga0207652_10339037 | 3300025921 | Bacteria | 1357 |
| 274 | Ga0207694_10102739 | 3300025924 | Bacteria | 2267 |
| 275 | Ga0207650_10100860 | 3300025925 | Bacteria | 2221 |
| 276 | Ga0207659_10010491 | 3300025926 | Bacteria | 5824 |
| 277 | Ga0207659_10040540 | 3300025926 | Bacteria | 3256 |
| 278 | Ga0207659_11071081 | 3300025926 | Bacteria | 694 |
| 279 | Ga0207644_10020849 | 3300025931 | Bacteria | 4459 |
| 280 | Ga0207644_10051468 | 3300025931 | Bacteria | 2956 |
| 281 | Ga0207644_10311665 | 3300025931 | Unclassified | 1271 |
| 282 | Ga0207644_10801337 | 3300025931 | Bacteria | 788 |
| 283 | Ga0207690_10291234 | 3300025932 | Bacteria | 1274 |
| 284 | Ga0207706_10015206 | 3300025933 | Bacteria | 6964 |
| 285 | Ga0207706_10028972 | 3300025933 | Bacteria | 4943 |
| 286 | Ga0207706_10041291 | 3300025933 | Bacteria | 4090 |
| 287 | Ga0207686_10306372 | 3300025934 | Bacteria | 1181 |
| 288 | Ga0207709_10001793 | 3300025935 | Bacteria | 14391 |
| 289 | Ga0207709_10051052 | 3300025935 | Bacteria | 2533 |
| 290 | Ga0207709_10266285 | 3300025935 | Bacteria | 1259 |
| 291 | Ga0207670_10095863 | 3300025936 | Bacteria | 2108 |
| 292 | Ga0207670_10396956 | 3300025936 | Bacteria | 1102 |
| 293 | Ga0207669_10017639 | 3300025937 | Bacteria | 3668 |
| 294 | Ga0207669_10164764 | 3300025937 | Bacteria | 1570 |
| 295 | Ga0207704_10206810 | 3300025938 | Bacteria | 1441 |
| 296 | Ga0207704_10246637 | 3300025938 | Bacteria | 1338 |
| 297 | Ga0207704_10525551 | 3300025938 | Bacteria | 958 |
| 298 | Ga0207665_10291509 | 3300025939 | Bacteria | 1217 |
| 299 | Ga0207691_10005068 | 3300025940 | Bacteria | 12713 |
| 300 | Ga0207691_10005116 | 3300025940 | Bacteria | 12652 |
| 301 | Ga0207691_10019129 | 3300025940 | Bacteria | 6483 |
| 302 | Ga0207691_10031346 | 3300025940 | Unclassified | 4962 |
| 303 | Ga0207691_10167489 | 3300025940 | Bacteria | 1925 |
| 304 | Ga0207711_10093072 | 3300025941 | Bacteria | 2654 |
| 305 | Ga0207689_10113048 | 3300025942 | Bacteria | 2232 |
| 306 | Ga0207689_10146016 | 3300025942 | Bacteria | 1949 |
| 307 | Ga0207679_10260614 | 3300025945 | Bacteria | 1478 |
| 308 | Ga0207679_11161028 | 3300025945 | Bacteria | 709 |
| 309 | Ga0207667_10022875 | 3300025949 | Bacteria | 6891 |
| 310 | Ga0207667_10038744 | 3300025949 | Bacteria | 5085 |
| 311 | Ga0207667_10576672 | 3300025949 | Bacteria | 1136 |
| 312 | Ga0207667_10646545 | 3300025949 | Bacteria | 1063 |
| 313 | Ga0207651_10101407 | 3300025960 | Unclassified | 2137 |
| 314 | Ga0207651_10137005 | 3300025960 | Bacteria | 1884 |
| 315 | Ga0207651_10149439 | 3300025960 | Bacteria | 1816 |
| 316 | Ga0207651_10477916 | 3300025960 | Bacteria | 1073 |
| 317 | Ga0207712_10023018 | 3300025961 | Bacteria | 4108 |
| 318 | Ga0207668_10553714 | 3300025972 | Bacteria | 997 |
| 319 | Ga0207640_10276794 | 3300025981 | Bacteria | 1316 |
| 320 | Ga0207640_10464726 | 3300025981 | Bacteria | 1046 |
| 321 | Ga0207640_10507485 | 3300025981 | Bacteria | 1005 |
| 322 | Ga0207658_10002969 | 3300025986 | Bacteria | 12134 |
| 323 | Ga0207658_10079468 | 3300025986 | Bacteria | 2509 |
| 324 | Ga0207658_10099340 | 3300025986 | Bacteria | 2276 |
| 325 | Ga0207658_10690327 | 3300025986 | Bacteria | 922 |
| 326 | Ga0207639_10089228 | 3300026041 | Bacteria | 2463 |
| 327 | Ga0207639_10602943 | 3300026041 | Bacteria | 1013 |
| 328 | Ga0207678_10043388 | 3300026067 | Bacteria | 3892 |
| 329 | Ga0207678_10044918 | 3300026067 | Bacteria | 3821 |
| 330 | Ga0207678_10312314 | 3300026067 | Bacteria | 1351 |
| 331 | Ga0207678_10720167 | 3300026067 | Bacteria | 879 |
| 332 | Ga0207708_10001399 | 3300026075 | Bacteria | 18108 |
| 333 | Ga0207708_11189846 | 3300026075 | Bacteria | 666 |
| 334 | Ga0207641_10262314 | 3300026088 | Bacteria | 1618 |
| 335 | Ga0207648_10009613 | 3300026089 | Bacteria | 9250 |
| 336 | Ga0207648_10015126 | 3300026089 | Bacteria | 7101 |
| 337 | Ga0207676_10003912 | 3300026095 | Bacteria | 10515 |
| 338 | Ga0207676_10122475 | 3300026095 | Bacteria | 2196 |
| 339 | Ga0207676_10442844 | 3300026095 | Bacteria | 1223 |
| 340 | Ga0207674_10001143 | 3300026116 | Bacteria | 34428 |
| 341 | Ga0207675_100020669 | 3300026118 | Bacteria | 6136 |
| 342 | Ga0207675_100041267 | 3300026118 | Bacteria | 4309 |
| 343 | Ga0207675_100237744 | 3300026118 | Bacteria | 1759 |
| 344 | Ga0207683_10012443 | 3300026121 | Bacteria | 7262 |
| 345 | Ga0207683_10049675 | 3300026121 | Bacteria | 3673 |
| 346 | Ga0207683_10207785 | 3300026121 | Bacteria | 1781 |
| 347 | Ga0207683_10359743 | 3300026121 | Bacteria | 1337 |
| 348 | Ga0207698_10365826 | 3300026142 | Bacteria | 1367 |
| 349 | Ga0207698_10469407 | 3300026142 | Bacteria | 1218 |
| 350 | Ga0207698_11126418 | 3300026142 | Bacteria | 798 |
| 351 | Ga0209179_1014804 | 3300027512 | Bacteria | 1439 |
| 352 | Ga0209971_1008275 | 3300027682 | Bacteria | 2466 |
| 353 | Ga0209813_10045836 | 3300027866 | Bacteria | 1348 |
| 354 | Ga0207428_10145559 | 3300027907 | Bacteria | 1806 |
| 355 | Ga0268266_10014965 | 3300028379 | Bacteria | 6660 |
| 356 | Ga0268266_10051532 | 3300028379 | Bacteria | 3533 |
| 357 | Ga0268266_10087997 | 3300028379 | Bacteria | 2718 |
| 358 | Ga0268266_10229649 | 3300028379 | Bacteria | 1709 |
| 359 | Ga0268266_10645387 | 3300028379 | Bacteria | 1018 |
| 360 | Ga0268265_10000626 | 3300028380 | Bacteria | 35203 |
| 361 | Ga0268265_10701674 | 3300028380 | Bacteria | 978 |
| 362 | Ga0268264_10003320 | 3300028381 | Bacteria | 13903 |
| 363 | Ga0268264_10091898 | 3300028381 | Bacteria | 2618 |
| 364 | Ga0265334_10000420 | 3300028573 | Bacteria | 22284 |
| 365 | Ga0265336_10000405 | 3300028666 | Bacteria | 26992 |
| 366 | Ga0307515_10000137 | 3300028794 | Bacteria | 173516 |
| 367 | Ga0307515_10000267 | 3300028794 | Bacteria | 128554 |
| 368 | Ga0307515_10217636 | 3300028794 | Bacteria | 1737 |
| 369 | Ga0307515_10443672 | 3300028794 | Bacteria | 914 |
| 370 | Ga0265338_10050863 | 3300028800 | Bacteria | 3740 |
| 371 | Ga0265338_10710892 | 3300028800 | Bacteria | 693 |
| 372 | Ga0265324_10000005 | 3300029957 | Bacteria | 347038 |
| 373 | Ga0265324_10001798 | 3300029957 | Bacteria | 11663 |
| 374 | Ga0265324_10042811 | 3300029957 | Bacteria | 1564 |
| 375 | Ga0307512_10283918 | 3300030522 | Bacteria | 788 |
| 376 | Ga0265330_10000076 | 3300031235 | Bacteria | 84642 |
| 377 | Ga0265330_10007256 | 3300031235 | Bacteria | 5421 |
| 378 | Ga0265332_10000002 | 3300031238 | Bacteria | 709510 |
| 379 | Ga0265328_10000558 | 3300031239 | Bacteria | 17328 |
| 380 | Ga0265328_10013762 | 3300031239 | Bacteria | 3196 |
| 381 | Ga0265325_10001692 | 3300031241 | Bacteria | 15320 |
| 382 | Ga0265325_10005064 | 3300031241 | Bacteria | 8200 |
| 383 | Ga0265325_10040154 | 3300031241 | Bacteria | 2459 |
| 384 | Ga0265325_10040248 | 3300031241 | Bacteria | 2455 |
| 385 | Ga0265329_10010276 | 3300031242 | Bacteria | 3444 |
| 386 | Ga0265340_10100631 | 3300031247 | Bacteria | 1343 |
| 387 | Ga0265340_10112049 | 3300031247 | Bacteria | 1261 |
| 388 | Ga0265339_10010065 | 3300031249 | Bacteria | 5893 |
| 389 | Ga0265331_10000030 | 3300031250 | Bacteria | 215032 |
| 390 | Ga0265331_10000704 | 3300031250 | Bacteria | 28516 |
| 391 | Ga0265331_10000818 | 3300031250 | Bacteria | 25607 |
| 392 | Ga0265327_10000072 | 3300031251 | Bacteria | 215055 |
| 393 | Ga0265327_10000374 | 3300031251 | Bacteria | 84337 |
| 394 | Ga0265327_10020293 | 3300031251 | Bacteria | 4054 |
| 395 | Ga0265327_10021128 | 3300031251 | Bacteria | 3937 |
| 396 | Ga0265327_10076465 | 3300031251 | Bacteria | 1664 |
| 397 | Ga0265316_10019208 | 3300031344 | Bacteria | 5852 |
| 398 | Ga0265316_10069636 | 3300031344 | Bacteria | 2715 |
| 399 | Ga0265316_10096020 | 3300031344 | Bacteria | 2257 |
| 400 | Ga0265316_10237000 | 3300031344 | Bacteria | 1342 |
| 401 | Ga0307513_10007611 | 3300031456 | Bacteria | 13999 |
| 402 | Ga0307513_10105537 | 3300031456 | Bacteria | 2826 |
| 403 | Ga0307513_10109605 | 3300031456 | Bacteria | 2758 |
| 404 | Ga0307513_10232176 | 3300031456 | Bacteria | 1657 |
| 405 | Ga0307513_10371905 | 3300031456 | Bacteria | 1171 |
| 406 | Ga0307408_100154028 | 3300031548 | Bacteria | 1817 |
| 407 | Ga0307408_100252592 | 3300031548 | Bacteria | 1455 |
| 408 | Ga0307514_10000806 | 3300031649 | Bacteria | 51095 |
| 409 | Ga0265314_10000066 | 3300031711 | Bacteria | 156399 |
| 410 | Ga0265314_10002543 | 3300031711 | Bacteria | 18546 |
| 411 | Ga0265314_10004160 | 3300031711 | Bacteria | 13610 |
| 412 | Ga0265342_10064404 | 3300031712 | Bacteria | 2151 |
| 413 | Ga0307516_10018058 | 3300031730 | Bacteria | 7338 |
| 414 | Ga0307405_10100499 | 3300031731 | Bacteria | 1938 |
| 415 | Ga0307405_10541310 | 3300031731 | Bacteria | 940 |
| 416 | Ga0307413_10735315 | 3300031824 | Bacteria | 823 |
| 417 | Ga0307413_11163037 | 3300031824 | Bacteria | 669 |
| 418 | Ga0307410_10069663 | 3300031852 | Bacteria | 2434 |
| 419 | Ga0307407_10702163 | 3300031903 | Bacteria | 762 |
| 420 | Ga0307412_10036938 | 3300031911 | Bacteria | 3134 |
| 421 | Ga0307412_10101480 | 3300031911 | Bacteria | 2036 |
| 422 | Ga0307412_10164970 | 3300031911 | Bacteria | 1651 |
| 423 | Ga0307412_10211383 | 3300031911 | Bacteria | 1480 |
| 424 | Ga0307412_10262918 | 3300031911 | Bacteria | 1346 |
| 425 | Ga0307412_11487217 | 3300031911 | Bacteria | 615 |
| 426 | Ga0307409_100003240 | 3300031995 | Bacteria | 8775 |
| 427 | Ga0307416_100137401 | 3300032002 | Bacteria | 2214 |
| 428 | Ga0307416_100263104 | 3300032002 | Bacteria | 1687 |
| 429 | Ga0307416_100497282 | 3300032002 | Bacteria | 1283 |
| 430 | Ga0307414_10010665 | 3300032004 | Bacteria | 5347 |
| 431 | Ga0307414_10390534 | 3300032004 | Bacteria | 1206 |
| 432 | Ga0307414_11050451 | 3300032004 | Bacteria | 751 |
| 433 | Ga0373958_0019893 | 3300034819 | Unclassified | 1231 |
| 434 | Ga0373949_0009470 | 3300035090 | Bacteria | 2134 |
| 435 | Ga0373951_0085048 | 3300035091 | Unclassified | 823 |
| 436 | Ga0373932_0013561 | 3300035112 | Bacteria | 2031 |
| 437 | Ga0373936_0057185 | 3300035113 | Bacteria | 1586 |
| 438 | Ga0373960_0110439 | 3300035121 | Unclassified | 901 |
| 439 | Ga0373955_0262999 | 3300035172 | Bacteria | 1036 |
| 440 | Ga0373962_0023463 | 3300035242 | Bacteria | 1643 |
| 441 | Ga0373931_0000751 | 3300035691 | Bacteria | 13545 |
| 442 | Ga0373931_0439959 | 3300035691 | Bacteria | 832 |
| 443 | Ga0395905_0038725 | 3300037471 | Bacteria | 4472 |
| 444 | Ga0395905_0507613 | 3300037471 | Bacteria | 1106 |
| 445 | Ga0395901_1294051 | 3300038443 | Bacteria | 691 |
| 446 | Ga0436363_0022589 | 3300039450 | Bacteria | 749 |
| 447 | Ga0439436_0032533 | 3300041404 | Bacteria | 1512 |
| 448 | Ga0439439_0010182 | 3300041406 | Bacteria | 2246 |
| 449 | Ga0439447_047573 | 3300041407 | Bacteria | 1030 |
| 450 | Ga0439466_0087474 | 3300041411 | Bacteria | 979 |
| 451 | Ga0439465_0198302 | 3300041413 | Bacteria | 731 |
| 452 | Ga0451791_0373605 | 3300041451 | Bacteria | 942 |
| 453 | Ga0451793_0612856 | 3300041452 | Bacteria | 1740 |
| 454 | Ga0451797_1533881 | 3300041453 | Bacteria | 1229 |
| 455 | Ga0451807_0569212 | 3300041486 | Bacteria | 841 |
| 456 | Ga0451807_1298242 | 3300041486 | Bacteria | 1577 |
| 457 | Ga0451807_1494639 | 3300041486 | Bacteria | 3566 |
| 458 | Ga0451807_2154701 | 3300041486 | Bacteria | 1710 |
| 459 | Ga0451833_0202489 | 3300041491 | Bacteria | 1434 |
| 460 | Ga0451833_1346353 | 3300041491 | Bacteria | 2908 |
| 461 | Ga0451837_0937937 | 3300041494 | Bacteria | 1150 |
| 462 | Ga0451839_0661452 | 3300041496 | Bacteria | 852 |
| 463 | Ga0451841_0961435 | 3300041498 | Bacteria | 3396 |
| 464 | Ga0451845_0394193 | 3300041501 | Bacteria | 1616 |
| 465 | Ga0451851_0805390 | 3300041507 | Bacteria | 746 |
| 466 | Ga0451843_0549395 | 3300041509 | Bacteria | 1612 |
| 467 | Ga0451843_0995758 | 3300041509 | Unclassified | 3174 |
| 468 | Ga0451853_1991779 | 3300041512 | Bacteria | 3731 |
| 469 | Ga0439433_0025210 | 3300041999 | Bacteria | 1342 |
| 470 | Ga0439445_0009847 | 3300042004 | Bacteria | 2256 |
| 471 | Ga0439432_034037 | 3300042006 | Bacteria | 1637 |
| 472 | Ga0439452_019969 | 3300042010 | Bacteria | 1763 |
| 473 | Ga0439462_0004131 | 3300042015 | Bacteria | 3527 |
| 474 | Ga0439462_0004645 | 3300042015 | Bacteria | 3358 |
| 475 | Ga0450911_000121 | 3300042115 | Bacteria | 31301 |
| 476 | Ga0450898_047755 | 3300042134 | Bacteria | 822 |
| 477 | Ga0439446_0078470 | 3300042156 | Bacteria | 1019 |
| 478 | Ga0450909_018858 | 3300042185 | Bacteria | 1026 |
| 479 | Ga0439464_0005973 | 3300042439 | Bacteria | 3165 |
| 480 | Ga0451577_0118620 | 3300042876 | Bacteria | 2370 |
| 481 | Ga0451577_0188749 | 3300042876 | Bacteria | 1859 |
| 482 | Ga0451577_0227421 | 3300042876 | Bacteria | 1687 |
| 483 | Ga0466969_0000177 | 3300044656 | Bacteria | 34210 |
| 484 | Ga0466969_0005025 | 3300044656 | Bacteria | 7038 |
| 485 | Ga0466973_0041228 | 3300044659 | Bacteria | 4347 |
| 486 | Ga0466965_0001523 | 3300044683 | Bacteria | 9405 |
| 487 | Ga0466965_0016395 | 3300044683 | Bacteria | 3525 |
| 488 | Ga0466966_0005905 | 3300044684 | Bacteria | 8077 |
| 489 | Ga0466961_0003013 | 3300044693 | Bacteria | 10444 |
| 490 | Ga0466961_0463443 | 3300044693 | Bacteria | 766 |
| 491 | Ga0466963_0003797 | 3300044694 | Bacteria | 8705 |
| 492 | Ga0466964_0004537 | 3300044706 | Bacteria | 5129 |
| 493 | Ga0453684_0000386 | 3300044712 | Bacteria | 180948 |
| 494 | Ga0453684_0104545 | 3300044712 | Bacteria | 3456 |
| 495 | Ga0453684_0453429 | 3300044712 | Bacteria | 1427 |
| 496 | Ga0466971_0005166 | 3300044719 | Bacteria | 5649 |
| 497 | Ga0466968_0045588 | 3300044735 | Bacteria | 1861 |
| 498 | Ga0466970_0020423 | 3300044765 | Bacteria | 3441 |
| 499 | Ga0466970_0024892 | 3300044765 | Bacteria | 3131 |
| 500 | Ga0466957_0000706 | 3300044842 | Bacteria | 17082 |
| 501 | Ga0466957_0030827 | 3300044842 | Bacteria | 3202 |
| 502 | Ga0466959_0036671 | 3300045049 | Bacteria | 3622 |
| 503 | Ga0466959_0071640 | 3300045049 | Bacteria | 2509 |
| 504 | Ga0466958_0028478 | 3300045836 | Bacteria | 3312 |
| 505 | Ga0466958_0444143 | 3300045836 | Bacteria | 839 |
| 506 | Ga0466967_0109733 | 3300045976 | Bacteria | 2533 |
| 507 | Ga0466967_0510581 | 3300045976 | Bacteria | 1180 |
| 508 | Ga0495629_0392544 | 3300046459 | Bacteria | 944 |
| 509 | Ga0495629_0444459 | 3300046459 | Bacteria | 878 |
| 510 | Ga0495638_0394567 | 3300046460 | Bacteria | 719 |
| 511 | Ga0495639_0001341 | 3300046475 | Bacteria | 11053 |
| 512 | Ga0495585_0011075 | 3300046492 | Bacteria | 5354 |
| 513 | Ga0495596_0000226 | 3300046500 | Bacteria | 38225 |
| 514 | Ga0495607_0029361 | 3300046501 | Bacteria | 3384 |
| 515 | Ga0495583_0011007 | 3300046506 | Bacteria | 5217 |
| 516 | Ga0495583_0103007 | 3300046506 | Bacteria | 1217 |
| 517 | Ga0495632_0110887 | 3300046519 | Bacteria | 1288 |
| 518 | Ga0495643_0000080 | 3300046522 | Bacteria | 161872 |
| 519 | Ga0495643_0008118 | 3300046522 | Bacteria | 6685 |
| 520 | Ga0495643_0298446 | 3300046522 | Bacteria | 735 |
| 521 | Ga0495642_0116254 | 3300046528 | Bacteria | 1146 |
| 522 | Ga0495609_0006369 | 3300046538 | Bacteria | 6024 |
| 523 | Ga0495597_0004256 | 3300046542 | Bacteria | 7917 |
| 524 | Ga0495645_0331592 | 3300046543 | Bacteria | 985 |
| 525 | Ga0495656_0000209 | 3300046615 | Bacteria | 20972 |
| 526 | Ga0495656_0300890 | 3300046615 | Bacteria | 822 |
| 527 | Ga0495668_0079721 | 3300046616 | Bacteria | 1797 |
| 528 | Ga0495611_0180948 | 3300046648 | Bacteria | 985 |
| 529 | Ga0495588_0024320 | 3300046674 | Bacteria | 3008 |
| 530 | Ga0495657_0502068 | 3300046675 | Bacteria | 707 |
| 531 | Ga0495599_0503703 | 3300046678 | Bacteria | 712 |
| 532 | Ga0495599_0619170 | 3300046678 | Bacteria | 629 |
| 533 | Ga0495670_0026417 | 3300046691 | Bacteria | 2874 |
| 534 | Ga0495670_0242765 | 3300046691 | Bacteria | 959 |
| 535 | Ga0495671_0033080 | 3300046692 | Bacteria | 2636 |
| 536 | Ga0495671_0066158 | 3300046692 | Bacteria | 1779 |
| 537 | Ga0495649_0118359 | 3300046694 | Bacteria | 1402 |
| 538 | Ga0495636_0054414 | 3300047318 | Bacteria | 1682 |
| 539 | Ga0495676_0036994 | 3300047321 | Bacteria | 4069 |
| 540 | Ga0495687_000128 | 3300047443 | Bacteria | 116626 |
| 541 | Ga0495677_0157552 | 3300047445 | Bacteria | 875 |
| 542 | Ga0495673_0182189 | 3300047469 | Bacteria | 795 |
| 543 | Ga0495681_0070693 | 3300047470 | Bacteria | 1582 |
| 544 | Ga0495593_0135857 | 3300047673 | Bacteria | 1247 |
| 545 | Ga0495626_0070790 | 3300048091 | Bacteria | 1568 |
| 546 | Ga0496101_0000958 | 3300048904 | Bacteria | 17056 |
| 547 | Ga0496101_0423793 | 3300048904 | Bacteria | 1049 |
| 548 | Ga0496101_0976634 | 3300048904 | Bacteria | 666 |
| 549 | Ga0496102_0002816 | 3300048905 | Bacteria | 14813 |
| 550 | Ga0496102_0009559 | 3300048905 | Bacteria | 8340 |
| 551 | Ga0496102_0014592 | 3300048905 | Bacteria | 6828 |
| 552 | Ga0496102_0492320 | 3300048905 | Bacteria | 1148 |
| 553 | Ga0496102_0870987 | 3300048905 | Bacteria | 823 |
| 554 | Ga0496103_0213946 | 3300048906 | Bacteria | 1239 |
| 555 | Ga0496104_0000688 | 3300048907 | Bacteria | 29108 |
| 556 | Ga0496104_0209342 | 3300048907 | Bacteria | 1862 |
| 557 | Ga0496104_0269814 | 3300048907 | Bacteria | 1614 |
| 558 | Ga0496105_0005944 | 3300048908 | Bacteria | 9312 |
| 559 | Ga0496105_0124317 | 3300048908 | Bacteria | 2127 |
| 560 | Ga0496105_0371651 | 3300048908 | Bacteria | 1139 |
| 561 | Ga0496106_0002769 | 3300048909 | Bacteria | 12994 |
| 562 | Ga0496106_0067516 | 3300048909 | Bacteria | 2726 |
| 563 | Ga0496107_0027449 | 3300048910 | Bacteria | 4042 |
| 564 | Ga0496107_0177045 | 3300048910 | Bacteria | 1584 |
| 565 | Ga0496108_0044917 | 3300048911 | Bacteria | 3689 |
| 566 | Ga0496109_0030792 | 3300048912 | Bacteria | 4810 |
| 567 | Ga0496109_0089162 | 3300048912 | Bacteria | 2851 |
| 568 | Ga0496109_0138057 | 3300048912 | Bacteria | 2279 |
| 569 | Ga0496109_0185917 | 3300048912 | Bacteria | 1952 |
| 570 | Ga0496110_0058288 | 3300048913 | Bacteria | 3401 |
| 571 | Ga0496110_0269330 | 3300048913 | Bacteria | 1551 |
| 572 | Ga0496110_0372599 | 3300048913 | Bacteria | 1301 |
| 573 | Ga0496113_0155268 | 3300048916 | Bacteria | 1807 |
| 574 | Ga0496114_0078913 | 3300048917 | Bacteria | 2778 |
| 575 | Ga0496114_0088470 | 3300048917 | Bacteria | 2627 |
| 576 | Ga0496117_0018952 | 3300048920 | Bacteria | 5673 |
| 577 | Ga0496117_0191115 | 3300048920 | Bacteria | 1166 |
| 578 | Ga0496118_0049833 | 3300048921 | Bacteria | 3220 |
| 579 | Ga0496121_0005075 | 3300048924 | Bacteria | 17179 |
| 580 | Ga0496121_0045777 | 3300048924 | Bacteria | 3756 |
| 581 | Ga0496124_0101737 | 3300048927 | Bacteria | 2327 |
| 582 | Ga0496124_0487440 | 3300048927 | Bacteria | 830 |
| 583 | Ga0496125_0004501 | 3300048928 | Bacteria | 16030 |
| 584 | Ga0496125_0010645 | 3300048928 | Bacteria | 9286 |
| 585 | Ga0496125_0014401 | 3300048928 | Bacteria | 7704 |
| 586 | Ga0496126_0302190 | 3300048929 | Bacteria | 1320 |
| 587 | Ga0496126_0357361 | 3300048929 | Bacteria | 1194 |
| 588 | Ga0501308_015991 | 3300049128 | Bacteria | 894 |
| 589 | Ga0501034_0188716 | 3300049571 | Bacteria | 2024 |
| 590 | Ga0501034_0345936 | 3300049571 | Bacteria | 1416 |
| 591 | Ga0501034_0471650 | 3300049571 | Bacteria | 1171 |
| 592 | Ga0501036_0234997 | 3300049572 | Bacteria | 1538 |
| 593 | Ga0501036_0289434 | 3300049572 | Bacteria | 1371 |
| 594 | Ga0501040_0564605 | 3300049576 | Bacteria | 822 |
| 595 | Ga0501041_0323891 | 3300049577 | Bacteria | 972 |
| 596 | Ga0501042_0259462 | 3300049578 | Bacteria | 1254 |
| 597 | Ga0501043_0186685 | 3300049579 | Bacteria | 1614 |
| 598 | Ga0501046_0130424 | 3300049580 | Bacteria | 1907 |
| 599 | Ga0501047_0454556 | 3300049581 | Bacteria | 1110 |
| 600 | Ga0501048_0142758 | 3300049582 | Bacteria | 1693 |
| 601 | Ga0501070_0232774 | 3300049586 | Bacteria | 1509 |
| 602 | Ga0501071_0252747 | 3300049587 | Bacteria | 1331 |
| 603 | Ga0501071_0276502 | 3300049587 | Bacteria | 1270 |
| 604 | Ga0501074_0117790 | 3300049590 | Bacteria | 1900 |
| 605 | Ga0501074_0361204 | 3300049590 | Bacteria | 1030 |
| 606 | Ga0501075_0058604 | 3300049591 | Bacteria | 2901 |
| 607 | Ga0501077_0091526 | 3300049593 | Bacteria | 1927 |
| 608 | Ga0501077_0277856 | 3300049593 | Bacteria | 1066 |
| 609 | Ga0501079_0036430 | 3300049741 | Bacteria | 3790 |
| 610 | Ga0501079_0167106 | 3300049741 | Bacteria | 1716 |
| 611 | Ga0501083_0312731 | 3300049744 | Bacteria | 1022 |
| 612 | Ga0501035_0068916 | 3300049822 | Bacteria | 3136 |
| 613 | Ga0501035_0790191 | 3300049822 | Bacteria | 759 |
| 614 | Ga0501044_0082733 | 3300049823 | Bacteria | 3247 |
| 615 | Ga0501044_0109666 | 3300049823 | Bacteria | 2769 |
| 616 | Ga0501044_0334543 | 3300049823 | Bacteria | 1436 |
| 617 | Ga0501045_0287247 | 3300049824 | Bacteria | 1224 |
| 618 | nmdc:mga03683_148240_c1 | 3300050489 | Bacteria | 1058 |
| 619 | nmdc:mga03683_153569_c1 | 3300050489 | Bacteria | 1040 |
| 620 | nmdc:mga03n38_386301_c1 | 3300050490 | Bacteria | 768 |
| 621 | nmdc:mga0yw44_136428_c1 | 3300050492 | Bacteria | 1592 |
| 622 | nmdc:mga0yw44_272037_c1 | 3300050492 | Bacteria | 1131 |
| 623 | nmdc:mga0k408_34186_c1 | 3300050493 | Bacteria | 2910 |
| 624 | nmdc:mga0k408_49986_c1 | 3300050493 | Bacteria | 2420 |
| 625 | nmdc:mga0k408_5220_c1 | 3300050493 | Bacteria | 3266 |
| 626 | nmdc:mga0k408_58645_c1 | 3300050493 | Bacteria | 2236 |
| 627 | nmdc:mga0k408_89092_c1 | 3300050493 | Bacteria | 1812 |
| 628 | nmdc:mga04h51_109530_c1 | 3300050495 | Bacteria | 1016 |
| 629 | nmdc:mga04h51_22089_c1 | 3300050495 | Bacteria | 1404 |
| 630 | nmdc:mga07m45_355052_c1 | 3300050496 | Bacteria | 852 |
| 631 | nmdc:mga07m45_5412_c1 | 3300050496 | Bacteria | 6350 |
| 632 | nmdc:mga05p37_423790_c1 | 3300050507 | Bacteria | 1548 |
| 633 | nmdc:mga09592_166675_c1 | 3300050508 | Bacteria | 1904 |
| 634 | nmdc:mga0qj67_362379_c1 | 3300050509 | Bacteria | 1171 |
| 635 | nmdc:mga06r32_209636_c1 | 3300050510 | Bacteria | 1936 |
| 636 | nmdc:mga06r32_875546_c1 | 3300050510 | Bacteria | 856 |
| 637 | nmdc:mga08y16_1293335_c1 | 3300050511 | Bacteria | 696 |
| 638 | nmdc:mga08y16_177827_c1 | 3300050511 | Bacteria | 2210 |
| 639 | nmdc:mga08y16_296372_c1 | 3300050511 | Bacteria | 1667 |
| 640 | nmdc:mga0n895_114187_c1 | 3300050512 | Bacteria | 2719 |
| 641 | nmdc:mga0a205_113760_c1 | 3300050515 | Bacteria | 2605 |
| 642 | Ga0500562_008842 | 3300053108 | Bacteria | 2543 |
| 643 | Ga0500593_001263 | 3300053117 | Bacteria | 9151 |
| 644 | Ga0500594_0193636 | 3300053118 | Bacteria | 666 |
| 645 | Ga0500618_035321 | 3300053125 | Bacteria | 1161 |
| 646 | Ga0500652_000673 | 3300053131 | Bacteria | 11601 |
| 647 | Ga0500559_0003620 | 3300053136 | Bacteria | 7556 |
| 648 | Ga0500559_0011876 | 3300053136 | Bacteria | 3712 |
| 649 | Ga0500616_0021040 | 3300053153 | Bacteria | 3662 |
| 650 | Ga0500645_005416 | 3300053730 | Bacteria | 4704 |
| 651 | Ga0501084_0107458 | 3300054114 | Bacteria | 2344 |
| 652 | Ga0501082_0050362 | 3300060353 | Bacteria | 3592 |
| 653 | Ga0501082_0281564 | 3300060353 | Bacteria | 1447 |
| 654 | Ga0466962_0074084 | 3300061719 | Bacteria | 1627 |
| 655 | Ga0530510_0316182 | 3300061734 | Bacteria | 1170 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003794 | Ga0055531_10001259 | Ga0055531_1000125912 | 173 |
| 2 | 3300025303 | Ga0209051_1000254 | Ga0209051_100025457 | 173 |
| 3 | 3300025304 | Ga0209257_1000012 | Ga0209257_1000012683 | 173 |
| 4 | 3300025304 | Ga0209257_1000045 | Ga0209257_100004589 | 173 |
| 5 | 3300025304 | Ga0209257_1000137 | Ga0209257_100013767 | 173 |
| 6 | 3300031911 | Ga0307412_10164970 | Ga0307412_101649701 | 174 |
| 7 | 3300032002 | Ga0307416_100497282 | Ga0307416_1004972821 | 174 |
| 8 | 3300035113 | Ga0373936_0057185 | Ga0373936_0057185_590_1177 | 176 |
| 9 | 3300006178 | Ga0075367_10097913 | Ga0075367_100979133 | 177 |
| 10 | 3300006847 | Ga0075431_100228668 | Ga0075431_1002286682 | 177 |
| 11 | 3300006852 | Ga0075433_10292612 | Ga0075433_102926122 | 177 |
| 12 | 3300009094 | Ga0111539_10319637 | Ga0111539_103196372 | 177 |
| 13 | 3300009147 | Ga0114129_11077473 | Ga0114129_110774732 | 177 |
| 14 | 3300014969 | Ga0157376_10277736 | Ga0157376_102777362 | 177 |
| 15 | 3300027907 | Ga0207428_10145559 | Ga0207428_101455593 | 177 |
| 16 | 3300034819 | Ga0373958_0019893 | Ga0373958_0019893_562_1104 | 177 |
| 17 | 3300035090 | Ga0373949_0009470 | Ga0373949_0009470_1038_1580 | 177 |
| 18 | 3300035091 | Ga0373951_0085048 | Ga0373951_0085048_41_583 | 177 |
| 19 | 3300035121 | Ga0373960_0110439 | Ga0373960_0110439_206_748 | 177 |
| 20 | 3300035242 | Ga0373962_0023463 | Ga0373962_0023463_423_965 | 177 |
| 21 | 3300035691 | Ga0373931_0000751 | Ga0373931_0000751_2139_2681 | 177 |
| 22 | 3300046694 | Ga0495649_0118359 | Ga0495649_0118359_816_1364 | 177 |
| 23 | 3300050510 | nmdc:mga06r32_209636_c1 | nmdc:mga06r32_209636_c1_677_1243 | 177 |
| 24 | 3300050512 | nmdc:mga0n895_114187_c1 | nmdc:mga0n895_114187_c1_14_580 | 177 |
| 25 | 3300050515 | nmdc:mga0a205_113760_c1 | nmdc:mga0a205_113760_c1_1681_2247 | 177 |
| 26 | iso_pu_bacteria | 2974320154 | 2974323229 | 177 |
| 27 | 3300005355 | Ga0070671_100176145 | Ga0070671_1001761452 | 178 |
| 28 | 3300005364 | Ga0070673_100005707 | Ga0070673_1000057073 | 178 |
| 29 | 3300005367 | Ga0070667_100000126 | Ga0070667_10000012632 | 178 |
| 30 | 3300005563 | Ga0068855_100828720 | Ga0068855_1008287202 | 178 |
| 31 | 3300005843 | Ga0068860_100113479 | Ga0068860_1001134793 | 178 |
| 32 | 3300014326 | Ga0157380_11486310 | Ga0157380_114863101 | 178 |
| 33 | 3300025909 | Ga0207705_10032130 | Ga0207705_100321302 | 178 |
| 34 | 3300025931 | Ga0207644_10020849 | Ga0207644_100208492 | 178 |
| 35 | 3300025949 | Ga0207667_10576672 | Ga0207667_105766722 | 178 |
| 36 | 3300025960 | Ga0207651_10137005 | Ga0207651_101370052 | 178 |
| 37 | 3300025986 | Ga0207658_10002969 | Ga0207658_100029698 | 178 |
| 38 | 3300028381 | Ga0268264_10091898 | Ga0268264_100918983 | 178 |
| 39 | 3300041491 | Ga0451833_0202489 | Ga0451833_0202489_558_1109 | 178 |
| 40 | 3300046492 | Ga0495585_0011075 | Ga0495585_0011075_1328_1879 | 178 |
| 41 | 3300046500 | Ga0495596_0000226 | Ga0495596_0000226_36969_37520 | 178 |
| 42 | 3300046501 | Ga0495607_0029361 | Ga0495607_0029361_504_1055 | 178 |
| 43 | 3300046506 | Ga0495583_0011007 | Ga0495583_0011007_3218_3769 | 178 |
| 44 | 3300046506 | Ga0495583_0103007 | Ga0495583_0103007_538_1089 | 178 |
| 45 | 3300046519 | Ga0495632_0110887 | Ga0495632_0110887_674_1225 | 178 |
| 46 | 3300046522 | Ga0495643_0000080 | Ga0495643_0000080_114431_114979 | 178 |
| 47 | 3300046522 | Ga0495643_0008118 | Ga0495643_0008118_3343_3894 | 178 |
| 48 | 3300046538 | Ga0495609_0006369 | Ga0495609_0006369_4909_5460 | 178 |
| 49 | 3300046616 | Ga0495668_0079721 | Ga0495668_0079721_673_1224 | 178 |
| 50 | 3300046692 | Ga0495671_0066158 | Ga0495671_0066158_288_839 | 178 |
| 51 | 3300047469 | Ga0495673_0182189 | Ga0495673_0182189_61_612 | 178 |
| 52 | 3300047470 | Ga0495681_0070693 | Ga0495681_0070693_781_1332 | 178 |
| 53 | 3300002987 | JGI25159J45721_1028197 | JGI25159J45721_10281972 | 179 |
| 54 | 3300003187 | JGI25151J46595_10007367 | JGI25151J46595_100073672 | 179 |
| 55 | 3300003323 | rootH1_10053255 | rootH1_100532554 | 179 |
| 56 | 3300003577 | Ga0007416J51690_1045190 | Ga0007416J51690_10451902 | 179 |
| 57 | 3300003759 | Ga0055525_1000046 | Ga0055525_1000046207 | 179 |
| 58 | 3300003781 | Ga0055536_1038771 | Ga0055536_10387712 | 179 |
| 59 | 3300003784 | Ga0055534_1000830 | Ga0055534_10008305 | 179 |
| 60 | 3300003794 | Ga0055531_10060115 | Ga0055531_100601152 | 179 |
| 61 | 3300005288 | Ga0065714_10158578 | Ga0065714_101585782 | 179 |
| 62 | 3300005290 | Ga0065712_10488927 | Ga0065712_104889271 | 179 |
| 63 | 3300005293 | Ga0065715_10246939 | Ga0065715_102469392 | 179 |
| 64 | 3300005327 | Ga0070658_10036341 | Ga0070658_100363412 | 179 |
| 65 | 3300005327 | Ga0070658_10163156 | Ga0070658_101631562 | 179 |
| 66 | 3300005328 | Ga0070676_10058519 | Ga0070676_100585192 | 179 |
| 67 | 3300005333 | Ga0070677_10003364 | Ga0070677_100033642 | 179 |
| 68 | 3300005334 | Ga0068869_100014018 | Ga0068869_1000140186 | 179 |
| 69 | 3300005336 | Ga0070680_100020142 | Ga0070680_1000201421 | 179 |
| 70 | 3300005338 | Ga0068868_100128778 | Ga0068868_1001287782 | 179 |
| 71 | 3300005338 | Ga0068868_100613629 | Ga0068868_1006136291 | 179 |
| 72 | 3300005341 | Ga0070691_10010717 | Ga0070691_100107173 | 179 |
| 73 | 3300005343 | Ga0070687_100081552 | Ga0070687_1000815522 | 179 |
| 74 | 3300005344 | Ga0070661_100150208 | Ga0070661_1001502082 | 179 |
| 75 | 3300005345 | Ga0070692_10045832 | Ga0070692_100458323 | 179 |
| 76 | 3300005354 | Ga0070675_100007299 | Ga0070675_1000072993 | 179 |
| 77 | 3300005354 | Ga0070675_100055685 | Ga0070675_1000556853 | 179 |
| 78 | 3300005355 | Ga0070671_100354747 | Ga0070671_1003547472 | 179 |
| 79 | 3300005356 | Ga0070674_100019397 | Ga0070674_1000193973 | 179 |
| 80 | 3300005356 | Ga0070674_100396412 | Ga0070674_1003964122 | 179 |
| 81 | 3300005364 | Ga0070673_100053999 | Ga0070673_1000539994 | 179 |
| 82 | 3300005364 | Ga0070673_100172184 | Ga0070673_1001721842 | 179 |
| 83 | 3300005365 | Ga0070688_100567641 | Ga0070688_1005676411 | 179 |
| 84 | 3300005366 | Ga0070659_100542326 | Ga0070659_1005423262 | 179 |
| 85 | 3300005367 | Ga0070667_100017882 | Ga0070667_1000178827 | 179 |
| 86 | 3300005367 | Ga0070667_100066632 | Ga0070667_1000666321 | 179 |
| 87 | 3300005406 | Ga0070703_10002365 | Ga0070703_100023653 | 179 |
| 88 | 3300005436 | Ga0070713_100415619 | Ga0070713_1004156191 | 179 |
| 89 | 3300005438 | Ga0070701_10013275 | Ga0070701_100132753 | 179 |
| 90 | 3300005438 | Ga0070701_10013492 | Ga0070701_100134921 | 179 |
| 91 | 3300005440 | Ga0070705_100000901 | Ga0070705_1000009018 | 179 |
| 92 | 3300005441 | Ga0070700_100001924 | Ga0070700_1000019246 | 179 |
| 93 | 3300005444 | Ga0070694_100001405 | Ga0070694_1000014058 | 179 |
| 94 | 3300005445 | Ga0070708_100016481 | Ga0070708_1000164813 | 179 |
| 95 | 3300005455 | Ga0070663_100135786 | Ga0070663_1001357862 | 179 |
| 96 | 3300005455 | Ga0070663_100489168 | Ga0070663_1004891681 | 179 |
| 97 | 3300005456 | Ga0070678_100155685 | Ga0070678_1001556853 | 179 |
| 98 | 3300005456 | Ga0070678_100170557 | Ga0070678_1001705571 | 179 |
| 99 | 3300005456 | Ga0070678_100283762 | Ga0070678_1002837623 | 179 |
| 100 | 3300005457 | Ga0070662_100004214 | Ga0070662_1000042149 | 179 |
| 101 | 3300005457 | Ga0070662_100405133 | Ga0070662_1004051332 | 179 |
| 102 | 3300005458 | Ga0070681_10134315 | Ga0070681_101343152 | 179 |
| 103 | 3300005458 | Ga0070681_10657371 | Ga0070681_106573712 | 179 |
| 104 | 3300005459 | Ga0068867_100006945 | Ga0068867_1000069452 | 179 |
| 105 | 3300005459 | Ga0068867_100327498 | Ga0068867_1003274982 | 179 |
| 106 | 3300005466 | Ga0070685_10782778 | Ga0070685_107827781 | 179 |
| 107 | 3300005467 | Ga0070706_100029463 | Ga0070706_1000294636 | 179 |
| 108 | 3300005471 | Ga0070698_100017908 | Ga0070698_1000179088 | 179 |
| 109 | 3300005518 | Ga0070699_100015194 | Ga0070699_1000151943 | 179 |
| 110 | 3300005530 | Ga0070679_100241151 | Ga0070679_1002411511 | 179 |
| 111 | 3300005530 | Ga0070679_100388884 | Ga0070679_1003888841 | 179 |
| 112 | 3300005530 | Ga0070679_100414668 | Ga0070679_1004146681 | 179 |
| 113 | 3300005536 | Ga0070697_100009532 | Ga0070697_1000095323 | 179 |
| 114 | 3300005543 | Ga0070672_100097790 | Ga0070672_1000977903 | 179 |
| 115 | 3300005543 | Ga0070672_100117463 | Ga0070672_1001174632 | 179 |
| 116 | 3300005545 | Ga0070695_100000158 | Ga0070695_10000015833 | 179 |
| 117 | 3300005546 | Ga0070696_100004561 | Ga0070696_1000045612 | 179 |
| 118 | 3300005547 | Ga0070693_100022136 | Ga0070693_1000221363 | 179 |
| 119 | 3300005548 | Ga0070665_100011192 | Ga0070665_1000111923 | 179 |
| 120 | 3300005548 | Ga0070665_100088712 | Ga0070665_1000887122 | 179 |
| 121 | 3300005548 | Ga0070665_100805428 | Ga0070665_1008054282 | 179 |
| 122 | 3300005549 | Ga0070704_100008256 | Ga0070704_1000082568 | 179 |
| 123 | 3300005549 | Ga0070704_100059348 | Ga0070704_1000593483 | 179 |
| 124 | 3300005563 | Ga0068855_100029598 | Ga0068855_1000295985 | 179 |
| 125 | 3300005563 | Ga0068855_100086706 | Ga0068855_1000867063 | 179 |
| 126 | 3300005564 | Ga0070664_100041366 | Ga0070664_1000413664 | 179 |
| 127 | 3300005564 | Ga0070664_101256036 | Ga0070664_1012560361 | 179 |
| 128 | 3300005577 | Ga0068857_100009560 | Ga0068857_1000095608 | 179 |
| 129 | 3300005578 | Ga0068854_100112572 | Ga0068854_1001125722 | 179 |
| 130 | 3300005578 | Ga0068854_100565227 | Ga0068854_1005652272 | 179 |
| 131 | 3300005615 | Ga0070702_100621617 | Ga0070702_1006216171 | 179 |
| 132 | 3300005616 | Ga0068852_100385929 | Ga0068852_1003859292 | 179 |
| 133 | 3300005616 | Ga0068852_100665084 | Ga0068852_1006650842 | 179 |
| 134 | 3300005617 | Ga0068859_100003502 | Ga0068859_1000035029 | 179 |
| 135 | 3300005617 | Ga0068859_100573091 | Ga0068859_1005730913 | 179 |
| 136 | 3300005618 | Ga0068864_100014556 | Ga0068864_1000145562 | 179 |
| 137 | 3300005618 | Ga0068864_100025178 | Ga0068864_1000251783 | 179 |
| 138 | 3300005618 | Ga0068864_100379845 | Ga0068864_1003798453 | 179 |
| 139 | 3300005718 | Ga0068866_10089975 | Ga0068866_100899752 | 179 |
| 140 | 3300005718 | Ga0068866_10391779 | Ga0068866_103917791 | 179 |
| 141 | 3300005719 | Ga0068861_100042905 | Ga0068861_1000429052 | 179 |
| 142 | 3300005719 | Ga0068861_100194215 | Ga0068861_1001942152 | 179 |
| 143 | 3300005719 | Ga0068861_100414923 | Ga0068861_1004149231 | 179 |
| 144 | 3300005840 | Ga0068870_10009503 | Ga0068870_100095035 | 179 |
| 145 | 3300005840 | Ga0068870_10018925 | Ga0068870_100189253 | 179 |
| 146 | 3300005841 | Ga0068863_100794612 | Ga0068863_1007946122 | 179 |
| 147 | 3300005842 | Ga0068858_100054191 | Ga0068858_1000541913 | 179 |
| 148 | 3300005843 | Ga0068860_100001841 | Ga0068860_10000184111 | 179 |
| 149 | 3300005844 | Ga0068862_100002731 | Ga0068862_1000027319 | 179 |
| 150 | 3300005844 | Ga0068862_100043810 | Ga0068862_1000438103 | 179 |
| 151 | 3300006042 | Ga0075368_10047295 | Ga0075368_100472952 | 179 |
| 152 | 3300006048 | Ga0075363_100110546 | Ga0075363_1001105463 | 179 |
| 153 | 3300006048 | Ga0075363_100192940 | Ga0075363_1001929402 | 179 |
| 154 | 3300006051 | Ga0075364_10068103 | Ga0075364_100681033 | 179 |
| 155 | 3300006173 | Ga0070716_100123171 | Ga0070716_1001231712 | 179 |
| 156 | 3300006173 | Ga0070716_100245128 | Ga0070716_1002451282 | 179 |
| 157 | 3300006177 | Ga0075362_10198653 | Ga0075362_101986531 | 179 |
| 158 | 3300006178 | Ga0075367_10244352 | Ga0075367_102443522 | 179 |
| 159 | 3300006195 | Ga0075366_10000371 | Ga0075366_100003713 | 179 |
| 160 | 3300006195 | Ga0075366_10014438 | Ga0075366_100144384 | 179 |
| 161 | 3300006195 | Ga0075366_10015834 | Ga0075366_100158343 | 179 |
| 162 | 3300006195 | Ga0075366_10048208 | Ga0075366_100482083 | 179 |
| 163 | 3300006237 | Ga0097621_100031472 | Ga0097621_1000314726 | 179 |
| 164 | 3300006237 | Ga0097621_100073271 | Ga0097621_1000732713 | 179 |
| 165 | 3300006237 | Ga0097621_100086234 | Ga0097621_1000862342 | 179 |
| 166 | 3300006237 | Ga0097621_100204124 | Ga0097621_1002041243 | 179 |
| 167 | 3300006353 | Ga0075370_10009692 | Ga0075370_100096924 | 179 |
| 168 | 3300006353 | Ga0075370_10040097 | Ga0075370_100400973 | 179 |
| 169 | 3300006353 | Ga0075370_10169388 | Ga0075370_101693882 | 179 |
| 170 | 3300006353 | Ga0075370_10397692 | Ga0075370_103976921 | 179 |
| 171 | 3300006358 | Ga0068871_100027904 | Ga0068871_1000279046 | 179 |
| 172 | 3300006358 | Ga0068871_100185732 | Ga0068871_1001857322 | 179 |
| 173 | 3300006358 | Ga0068871_100330282 | Ga0068871_1003302821 | 179 |
| 174 | 3300006358 | Ga0068871_100796591 | Ga0068871_1007965911 | 179 |
| 175 | 3300006846 | Ga0075430_100074103 | Ga0075430_1000741032 | 179 |
| 176 | 3300006880 | Ga0075429_100386532 | Ga0075429_1003865322 | 179 |
| 177 | 3300006881 | Ga0068865_100157758 | Ga0068865_1001577583 | 179 |
| 178 | 3300006881 | Ga0068865_100384230 | Ga0068865_1003842302 | 179 |
| 179 | 3300006931 | Ga0097620_100003500 | Ga0097620_1000035009 | 179 |
| 180 | 3300006931 | Ga0097620_100573063 | Ga0097620_1005730633 | 179 |
| 181 | 3300006948 | Ga0099826_10100537 | Ga0099826_101005373 | 179 |
| 182 | 3300007788 | Ga0099795_10022813 | Ga0099795_100228133 | 179 |
| 183 | 3300009036 | Ga0105244_10006285 | Ga0105244_100062855 | 179 |
| 184 | 3300009093 | Ga0105240_10002809 | Ga0105240_1000280925 | 179 |
| 185 | 3300009093 | Ga0105240_10264560 | Ga0105240_102645602 | 179 |
| 186 | 3300009093 | Ga0105240_10315421 | Ga0105240_103154212 | 179 |
| 187 | 3300009093 | Ga0105240_10422603 | Ga0105240_104226032 | 179 |
| 188 | 3300009093 | Ga0105240_10829872 | Ga0105240_108298722 | 179 |
| 189 | 3300009094 | Ga0111539_10007314 | Ga0111539_100073147 | 179 |
| 190 | 3300009094 | Ga0111539_10346507 | Ga0111539_103465072 | 179 |
| 191 | 3300009094 | Ga0111539_10382640 | Ga0111539_103826402 | 179 |
| 192 | 3300009098 | Ga0105245_10227463 | Ga0105245_102274632 | 179 |
| 193 | 3300009101 | Ga0105247_10630404 | Ga0105247_106304041 | 179 |
| 194 | 3300009147 | Ga0114129_11537441 | Ga0114129_115374412 | 179 |
| 195 | 3300009148 | Ga0105243_10014281 | Ga0105243_100142813 | 179 |
| 196 | 3300009148 | Ga0105243_10020340 | Ga0105243_100203403 | 179 |
| 197 | 3300009148 | Ga0105243_11599670 | Ga0105243_115996701 | 179 |
| 198 | 3300009174 | Ga0105241_10279185 | Ga0105241_102791851 | 179 |
| 199 | 3300009174 | Ga0105241_11588154 | Ga0105241_115881541 | 179 |
| 200 | 3300009176 | Ga0105242_10135094 | Ga0105242_101350942 | 179 |
| 201 | 3300009176 | Ga0105242_10457450 | Ga0105242_104574501 | 179 |
| 202 | 3300009176 | Ga0105242_10475924 | Ga0105242_104759242 | 179 |
| 203 | 3300009176 | Ga0105242_11013213 | Ga0105242_110132131 | 179 |
| 204 | 3300009177 | Ga0105248_10097185 | Ga0105248_100971852 | 179 |
| 205 | 3300009545 | Ga0105237_10006964 | Ga0105237_100069647 | 179 |
| 206 | 3300009545 | Ga0105237_10122282 | Ga0105237_101222822 | 179 |
| 207 | 3300009545 | Ga0105237_10255533 | Ga0105237_102555331 | 179 |
| 208 | 3300009551 | Ga0105238_10218757 | Ga0105238_102187572 | 179 |
| 209 | 3300009551 | Ga0105238_10277921 | Ga0105238_102779212 | 179 |
| 210 | 3300009551 | Ga0105238_10452207 | Ga0105238_104522072 | 179 |
| 211 | 3300009551 | Ga0105238_10785937 | Ga0105238_107859371 | 179 |
| 212 | 3300009553 | Ga0105249_10046892 | Ga0105249_100468926 | 179 |
| 213 | 3300009553 | Ga0105249_10184246 | Ga0105249_101842462 | 179 |
| 214 | 3300010159 | Ga0099796_10009871 | Ga0099796_100098713 | 179 |
| 215 | 3300010375 | Ga0105239_10001353 | Ga0105239_1000135323 | 179 |
| 216 | 3300010375 | Ga0105239_10206651 | Ga0105239_102066513 | 179 |
| 217 | 3300010375 | Ga0105239_10494175 | Ga0105239_104941752 | 179 |
| 218 | 3300011119 | Ga0105246_10019026 | Ga0105246_100190262 | 179 |
| 219 | 3300011119 | Ga0105246_10097776 | Ga0105246_100977763 | 179 |
| 220 | 3300013100 | Ga0157373_10178389 | Ga0157373_101783892 | 179 |
| 221 | 3300013104 | Ga0157370_10034191 | Ga0157370_100341914 | 179 |
| 222 | 3300013104 | Ga0157370_10034844 | Ga0157370_100348446 | 179 |
| 223 | 3300013104 | Ga0157370_10157913 | Ga0157370_101579132 | 179 |
| 224 | 3300013104 | Ga0157370_10788032 | Ga0157370_107880322 | 179 |
| 225 | 3300013104 | Ga0157370_11352092 | Ga0157370_113520921 | 179 |
| 226 | 3300013297 | Ga0157378_10075339 | Ga0157378_100753394 | 179 |
| 227 | 3300013306 | Ga0163162_10204769 | Ga0163162_102047692 | 179 |
| 228 | 3300013306 | Ga0163162_10207189 | Ga0163162_102071892 | 179 |
| 229 | 3300013308 | Ga0157375_10005559 | Ga0157375_100055599 | 179 |
| 230 | 3300013308 | Ga0157375_10664819 | Ga0157375_106648192 | 179 |
| 231 | 3300013308 | Ga0157375_11238975 | Ga0157375_112389752 | 179 |
| 232 | 3300014325 | Ga0163163_10087001 | Ga0163163_100870012 | 179 |
| 233 | 3300014325 | Ga0163163_10270276 | Ga0163163_102702762 | 179 |
| 234 | 3300014326 | Ga0157380_10017946 | Ga0157380_100179465 | 179 |
| 235 | 3300014326 | Ga0157380_10039990 | Ga0157380_100399903 | 179 |
| 236 | 3300014326 | Ga0157380_10043724 | Ga0157380_100437242 | 179 |
| 237 | 3300014326 | Ga0157380_10081240 | Ga0157380_100812402 | 179 |
| 238 | 3300014326 | Ga0157380_10091942 | Ga0157380_100919423 | 179 |
| 239 | 3300014326 | Ga0157380_10492242 | Ga0157380_104922422 | 179 |
| 240 | 3300014497 | Ga0182008_10000190 | Ga0182008_1000019028 | 179 |
| 241 | 3300014497 | Ga0182008_10001821 | Ga0182008_100018213 | 179 |
| 242 | 3300014497 | Ga0182008_10012122 | Ga0182008_100121226 | 179 |
| 243 | 3300014497 | Ga0182008_10055900 | Ga0182008_100559002 | 179 |
| 244 | 3300014745 | Ga0157377_10158844 | Ga0157377_101588442 | 179 |
| 245 | 3300014969 | Ga0157376_10104459 | Ga0157376_101044592 | 179 |
| 246 | 3300014969 | Ga0157376_10529909 | Ga0157376_105299091 | 179 |
| 247 | 3300014969 | Ga0157376_10571101 | Ga0157376_105711012 | 179 |
| 248 | 3300014969 | Ga0157376_10848076 | Ga0157376_108480761 | 179 |
| 249 | 3300014969 | Ga0157376_10935923 | Ga0157376_109359232 | 179 |
| 250 | 3300015261 | Ga0182006_1001217 | Ga0182006_100121715 | 179 |
| 251 | 3300015262 | Ga0182007_10000916 | Ga0182007_100009167 | 179 |
| 252 | 3300015262 | Ga0182007_10001403 | Ga0182007_100014039 | 179 |
| 253 | 3300015265 | Ga0182005_1021950 | Ga0182005_10219502 | 179 |
| 254 | 3300017792 | Ga0163161_10000092 | Ga0163161_1000009269 | 179 |
| 255 | 3300017792 | Ga0163161_10048563 | Ga0163161_100485632 | 179 |
| 256 | 3300017792 | Ga0163161_10048941 | Ga0163161_100489413 | 179 |
| 257 | 3300017792 | Ga0163161_10070504 | Ga0163161_100705044 | 179 |
| 258 | 3300017792 | Ga0163161_10087775 | Ga0163161_100877753 | 179 |
| 259 | 3300017792 | Ga0163161_10194495 | Ga0163161_101944951 | 179 |
| 260 | 3300020070 | Ga0206356_11249086 | Ga0206356_112490861 | 179 |
| 261 | 3300025230 | Ga0209563_100005 | Ga0209563_100005944 | 179 |
| 262 | 3300025254 | Ga0209148_1000501 | Ga0209148_100050112 | 179 |
| 263 | 3300025271 | Ga0207666_1033809 | Ga0207666_10338091 | 179 |
| 264 | 3300025272 | Ga0209455_1003800 | Ga0209455_10038003 | 179 |
| 265 | 3300025273 | Ga0209673_1041890 | Ga0209673_10418902 | 179 |
| 266 | 3300025284 | Ga0209130_1004992 | Ga0209130_10049925 | 179 |
| 267 | 3300025291 | Ga0209675_1004723 | Ga0209675_10047237 | 179 |
| 268 | 3300025292 | Ga0209676_1001468 | Ga0209676_100146820 | 179 |
| 269 | 3300025292 | Ga0209676_1025600 | Ga0209676_10256002 | 179 |
| 270 | 3300025294 | Ga0209025_1000073 | Ga0209025_1000073132 | 179 |
| 271 | 3300025295 | Ga0209564_1041276 | Ga0209564_10412762 | 179 |
| 272 | 3300025303 | Ga0209051_1020090 | Ga0209051_10200902 | 179 |
| 273 | 3300025304 | Ga0209257_1010252 | Ga0209257_10102524 | 179 |
| 274 | 3300025728 | Ga0207655_1010441 | Ga0207655_10104415 | 179 |
| 275 | 3300025885 | Ga0207653_10002878 | Ga0207653_100028782 | 179 |
| 276 | 3300025893 | Ga0207682_10002252 | Ga0207682_100022528 | 179 |
| 277 | 3300025898 | Ga0207692_10043374 | Ga0207692_100433743 | 179 |
| 278 | 3300025899 | Ga0207642_10102332 | Ga0207642_101023322 | 179 |
| 279 | 3300025899 | Ga0207642_10266882 | Ga0207642_102668821 | 179 |
| 280 | 3300025901 | Ga0207688_10254502 | Ga0207688_102545021 | 179 |
| 281 | 3300025905 | Ga0207685_10120601 | Ga0207685_101206011 | 179 |
| 282 | 3300025907 | Ga0207645_10166886 | Ga0207645_101668862 | 179 |
| 283 | 3300025908 | Ga0207643_10045292 | Ga0207643_100452922 | 179 |
| 284 | 3300025908 | Ga0207643_10124418 | Ga0207643_101244182 | 179 |
| 285 | 3300025909 | Ga0207705_10058067 | Ga0207705_100580673 | 179 |
| 286 | 3300025911 | Ga0207654_10230518 | Ga0207654_102305181 | 179 |
| 287 | 3300025911 | Ga0207654_10925928 | Ga0207654_109259281 | 179 |
| 288 | 3300025912 | Ga0207707_10152090 | Ga0207707_101520901 | 179 |
| 289 | 3300025912 | Ga0207707_11048495 | Ga0207707_110484951 | 179 |
| 290 | 3300025913 | Ga0207695_10005251 | Ga0207695_100052513 | 179 |
| 291 | 3300025913 | Ga0207695_10565174 | Ga0207695_105651742 | 179 |
| 292 | 3300025914 | Ga0207671_10001552 | Ga0207671_1000155222 | 179 |
| 293 | 3300025914 | Ga0207671_10545140 | Ga0207671_105451401 | 179 |
| 294 | 3300025917 | Ga0207660_10004296 | Ga0207660_100042963 | 179 |
| 295 | 3300025918 | Ga0207662_10100667 | Ga0207662_101006671 | 179 |
| 296 | 3300025920 | Ga0207649_10115897 | Ga0207649_101158972 | 179 |
| 297 | 3300025921 | Ga0207652_10322397 | Ga0207652_103223971 | 179 |
| 298 | 3300025921 | Ga0207652_10339037 | Ga0207652_103390372 | 179 |
| 299 | 3300025924 | Ga0207694_10102739 | Ga0207694_101027392 | 179 |
| 300 | 3300025925 | Ga0207650_10100860 | Ga0207650_101008603 | 179 |
| 301 | 3300025926 | Ga0207659_10010491 | Ga0207659_100104913 | 179 |
| 302 | 3300025926 | Ga0207659_10040540 | Ga0207659_100405402 | 179 |
| 303 | 3300025931 | Ga0207644_10051468 | Ga0207644_100514684 | 179 |
| 304 | 3300025931 | Ga0207644_10311665 | Ga0207644_103116652 | 179 |
| 305 | 3300025931 | Ga0207644_10801337 | Ga0207644_108013372 | 179 |
| 306 | 3300025932 | Ga0207690_10291234 | Ga0207690_102912342 | 179 |
| 307 | 3300025933 | Ga0207706_10015206 | Ga0207706_100152063 | 179 |
| 308 | 3300025933 | Ga0207706_10028972 | Ga0207706_100289722 | 179 |
| 309 | 3300025934 | Ga0207686_10306372 | Ga0207686_103063722 | 179 |
| 310 | 3300025935 | Ga0207709_10001793 | Ga0207709_100017936 | 179 |
| 311 | 3300025935 | Ga0207709_10051052 | Ga0207709_100510524 | 179 |
| 312 | 3300025935 | Ga0207709_10266285 | Ga0207709_102662851 | 179 |
| 313 | 3300025936 | Ga0207670_10095863 | Ga0207670_100958632 | 179 |
| 314 | 3300025936 | Ga0207670_10396956 | Ga0207670_103969561 | 179 |
| 315 | 3300025937 | Ga0207669_10017639 | Ga0207669_100176393 | 179 |
| 316 | 3300025937 | Ga0207669_10164764 | Ga0207669_101647641 | 179 |
| 317 | 3300025938 | Ga0207704_10206810 | Ga0207704_102068103 | 179 |
| 318 | 3300025938 | Ga0207704_10246637 | Ga0207704_102466372 | 179 |
| 319 | 3300025938 | Ga0207704_10525551 | Ga0207704_105255512 | 179 |
| 320 | 3300025939 | Ga0207665_10291509 | Ga0207665_102915092 | 179 |
| 321 | 3300025940 | Ga0207691_10005068 | Ga0207691_100050688 | 179 |
| 322 | 3300025940 | Ga0207691_10005116 | Ga0207691_100051169 | 179 |
| 323 | 3300025940 | Ga0207691_10019129 | Ga0207691_100191298 | 179 |
| 324 | 3300025940 | Ga0207691_10031346 | Ga0207691_100313465 | 179 |
| 325 | 3300025940 | Ga0207691_10167489 | Ga0207691_101674892 | 179 |
| 326 | 3300025941 | Ga0207711_10093072 | Ga0207711_100930722 | 179 |
| 327 | 3300025942 | Ga0207689_10113048 | Ga0207689_101130482 | 179 |
| 328 | 3300025942 | Ga0207689_10146016 | Ga0207689_101460162 | 179 |
| 329 | 3300025945 | Ga0207679_10260614 | Ga0207679_102606142 | 179 |
| 330 | 3300025945 | Ga0207679_11161028 | Ga0207679_111610281 | 179 |
| 331 | 3300025949 | Ga0207667_10038744 | Ga0207667_100387446 | 179 |
| 332 | 3300025949 | Ga0207667_10646545 | Ga0207667_106465451 | 179 |
| 333 | 3300025960 | Ga0207651_10101407 | Ga0207651_101014073 | 179 |
| 334 | 3300025960 | Ga0207651_10149439 | Ga0207651_101494392 | 179 |
| 335 | 3300025960 | Ga0207651_10477916 | Ga0207651_104779161 | 179 |
| 336 | 3300025961 | Ga0207712_10023018 | Ga0207712_100230186 | 179 |
| 337 | 3300025972 | Ga0207668_10553714 | Ga0207668_105537141 | 179 |
| 338 | 3300025981 | Ga0207640_10276794 | Ga0207640_102767942 | 179 |
| 339 | 3300025981 | Ga0207640_10464726 | Ga0207640_104647261 | 179 |
| 340 | 3300025981 | Ga0207640_10507485 | Ga0207640_105074852 | 179 |
| 341 | 3300025986 | Ga0207658_10079468 | Ga0207658_100794684 | 179 |
| 342 | 3300025986 | Ga0207658_10099340 | Ga0207658_100993402 | 179 |
| 343 | 3300025986 | Ga0207658_10690327 | Ga0207658_106903272 | 179 |
| 344 | 3300026041 | Ga0207639_10089228 | Ga0207639_100892282 | 179 |
| 345 | 3300026041 | Ga0207639_10602943 | Ga0207639_106029432 | 179 |
| 346 | 3300026067 | Ga0207678_10043388 | Ga0207678_100433883 | 179 |
| 347 | 3300026067 | Ga0207678_10044918 | Ga0207678_100449182 | 179 |
| 348 | 3300026067 | Ga0207678_10312314 | Ga0207678_103123142 | 179 |
| 349 | 3300026067 | Ga0207678_10720167 | Ga0207678_107201672 | 179 |
| 350 | 3300026075 | Ga0207708_10001399 | Ga0207708_100013999 | 179 |
| 351 | 3300026075 | Ga0207708_11189846 | Ga0207708_111898462 | 179 |
| 352 | 3300026088 | Ga0207641_10262314 | Ga0207641_102623143 | 179 |
| 353 | 3300026089 | Ga0207648_10009613 | Ga0207648_100096138 | 179 |
| 354 | 3300026089 | Ga0207648_10015126 | Ga0207648_100151266 | 179 |
| 355 | 3300026095 | Ga0207676_10003912 | Ga0207676_100039126 | 179 |
| 356 | 3300026095 | Ga0207676_10122475 | Ga0207676_101224754 | 179 |
| 357 | 3300026095 | Ga0207676_10442844 | Ga0207676_104428442 | 179 |
| 358 | 3300026116 | Ga0207674_10001143 | Ga0207674_100011432 | 179 |
| 359 | 3300026118 | Ga0207675_100020669 | Ga0207675_1000206693 | 179 |
| 360 | 3300026118 | Ga0207675_100041267 | Ga0207675_1000412675 | 179 |
| 361 | 3300026118 | Ga0207675_100237744 | Ga0207675_1002377442 | 179 |
| 362 | 3300026121 | Ga0207683_10012443 | Ga0207683_100124435 | 179 |
| 363 | 3300026121 | Ga0207683_10049675 | Ga0207683_100496753 | 179 |
| 364 | 3300026121 | Ga0207683_10207785 | Ga0207683_102077851 | 179 |
| 365 | 3300026121 | Ga0207683_10359743 | Ga0207683_103597432 | 179 |
| 366 | 3300026142 | Ga0207698_10365826 | Ga0207698_103658262 | 179 |
| 367 | 3300026142 | Ga0207698_10469407 | Ga0207698_104694071 | 179 |
| 368 | 3300026142 | Ga0207698_11126418 | Ga0207698_111264181 | 179 |
| 369 | 3300027512 | Ga0209179_1014804 | Ga0209179_10148041 | 179 |
| 370 | 3300027682 | Ga0209971_1008275 | Ga0209971_10082752 | 179 |
| 371 | 3300027866 | Ga0209813_10045836 | Ga0209813_100458361 | 179 |
| 372 | 3300028379 | Ga0268266_10014965 | Ga0268266_100149656 | 179 |
| 373 | 3300028379 | Ga0268266_10051532 | Ga0268266_100515324 | 179 |
| 374 | 3300028379 | Ga0268266_10087997 | Ga0268266_100879972 | 179 |
| 375 | 3300028379 | Ga0268266_10229649 | Ga0268266_102296492 | 179 |
| 376 | 3300028379 | Ga0268266_10645387 | Ga0268266_106453871 | 179 |
| 377 | 3300028380 | Ga0268265_10000626 | Ga0268265_1000062635 | 179 |
| 378 | 3300028380 | Ga0268265_10701674 | Ga0268265_107016741 | 179 |
| 379 | 3300028381 | Ga0268264_10003320 | Ga0268264_100033207 | 179 |
| 380 | 3300028573 | Ga0265334_10000420 | Ga0265334_1000042023 | 179 |
| 381 | 3300028666 | Ga0265336_10000405 | Ga0265336_1000040521 | 179 |
| 382 | 3300028794 | Ga0307515_10000137 | Ga0307515_10000137109 | 179 |
| 383 | 3300028794 | Ga0307515_10000267 | Ga0307515_1000026716 | 179 |
| 384 | 3300028794 | Ga0307515_10217636 | Ga0307515_102176362 | 179 |
| 385 | 3300028794 | Ga0307515_10443672 | Ga0307515_104436722 | 179 |
| 386 | 3300028800 | Ga0265338_10050863 | Ga0265338_100508633 | 179 |
| 387 | 3300028800 | Ga0265338_10710892 | Ga0265338_107108921 | 179 |
| 388 | 3300029957 | Ga0265324_10000005 | Ga0265324_10000005350 | 179 |
| 389 | 3300029957 | Ga0265324_10001798 | Ga0265324_1000179810 | 179 |
| 390 | 3300029957 | Ga0265324_10042811 | Ga0265324_100428112 | 179 |
| 391 | 3300030522 | Ga0307512_10283918 | Ga0307512_102839181 | 179 |
| 392 | 3300031235 | Ga0265330_10000076 | Ga0265330_1000007647 | 179 |
| 393 | 3300031235 | Ga0265330_10007256 | Ga0265330_100072567 | 179 |
| 394 | 3300031238 | Ga0265332_10000002 | Ga0265332_10000002443 | 179 |
| 395 | 3300031239 | Ga0265328_10000558 | Ga0265328_100005587 | 179 |
| 396 | 3300031239 | Ga0265328_10013762 | Ga0265328_100137624 | 179 |
| 397 | 3300031241 | Ga0265325_10001692 | Ga0265325_100016925 | 179 |
| 398 | 3300031241 | Ga0265325_10005064 | Ga0265325_100050647 | 179 |
| 399 | 3300031241 | Ga0265325_10040154 | Ga0265325_100401542 | 179 |
| 400 | 3300031241 | Ga0265325_10040248 | Ga0265325_100402482 | 179 |
| 401 | 3300031242 | Ga0265329_10010276 | Ga0265329_100102762 | 179 |
| 402 | 3300031247 | Ga0265340_10100631 | Ga0265340_101006311 | 179 |
| 403 | 3300031247 | Ga0265340_10112049 | Ga0265340_101120492 | 179 |
| 404 | 3300031249 | Ga0265339_10010065 | Ga0265339_100100655 | 179 |
| 405 | 3300031250 | Ga0265331_10000030 | Ga0265331_10000030192 | 179 |
| 406 | 3300031250 | Ga0265331_10000704 | Ga0265331_100007047 | 179 |
| 407 | 3300031250 | Ga0265331_10000818 | Ga0265331_100008184 | 179 |
| 408 | 3300031251 | Ga0265327_10000072 | Ga0265327_10000072193 | 179 |
| 409 | 3300031251 | Ga0265327_10000374 | Ga0265327_1000037479 | 179 |
| 410 | 3300031251 | Ga0265327_10020293 | Ga0265327_100202932 | 179 |
| 411 | 3300031251 | Ga0265327_10021128 | Ga0265327_100211283 | 179 |
| 412 | 3300031251 | Ga0265327_10076465 | Ga0265327_100764651 | 179 |
| 413 | 3300031344 | Ga0265316_10019208 | Ga0265316_100192081 | 179 |
| 414 | 3300031344 | Ga0265316_10069636 | Ga0265316_100696362 | 179 |
| 415 | 3300031344 | Ga0265316_10096020 | Ga0265316_100960202 | 179 |
| 416 | 3300031344 | Ga0265316_10237000 | Ga0265316_102370002 | 179 |
| 417 | 3300031456 | Ga0307513_10007611 | Ga0307513_100076119 | 179 |
| 418 | 3300031456 | Ga0307513_10105537 | Ga0307513_101055374 | 179 |
| 419 | 3300031456 | Ga0307513_10109605 | Ga0307513_101096056 | 179 |
| 420 | 3300031456 | Ga0307513_10232176 | Ga0307513_102321762 | 179 |
| 421 | 3300031456 | Ga0307513_10371905 | Ga0307513_103719052 | 179 |
| 422 | 3300031548 | Ga0307408_100154028 | Ga0307408_1001540282 | 179 |
| 423 | 3300031548 | Ga0307408_100252592 | Ga0307408_1002525922 | 179 |
| 424 | 3300031649 | Ga0307514_10000806 | Ga0307514_1000080634 | 179 |
| 425 | 3300031711 | Ga0265314_10000066 | Ga0265314_1000006699 | 179 |
| 426 | 3300031711 | Ga0265314_10002543 | Ga0265314_100025439 | 179 |
| 427 | 3300031711 | Ga0265314_10004160 | Ga0265314_1000416010 | 179 |
| 428 | 3300031712 | Ga0265342_10064404 | Ga0265342_100644042 | 179 |
| 429 | 3300031730 | Ga0307516_10018058 | Ga0307516_100180589 | 179 |
| 430 | 3300031731 | Ga0307405_10100499 | Ga0307405_101004992 | 179 |
| 431 | 3300031731 | Ga0307405_10541310 | Ga0307405_105413102 | 179 |
| 432 | 3300031824 | Ga0307413_10735315 | Ga0307413_107353151 | 179 |
| 433 | 3300031852 | Ga0307410_10069663 | Ga0307410_100696632 | 179 |
| 434 | 3300031903 | Ga0307407_10702163 | Ga0307407_107021632 | 179 |
| 435 | 3300031911 | Ga0307412_10036938 | Ga0307412_100369384 | 179 |
| 436 | 3300031911 | Ga0307412_10101480 | Ga0307412_101014802 | 179 |
| 437 | 3300031911 | Ga0307412_10211383 | Ga0307412_102113832 | 179 |
| 438 | 3300031911 | Ga0307412_10262918 | Ga0307412_102629182 | 179 |
| 439 | 3300031911 | Ga0307412_11487217 | Ga0307412_114872171 | 179 |
| 440 | 3300031995 | Ga0307409_100003240 | Ga0307409_1000032409 | 179 |
| 441 | 3300032002 | Ga0307416_100137401 | Ga0307416_1001374012 | 179 |
| 442 | 3300032002 | Ga0307416_100263104 | Ga0307416_1002631043 | 179 |
| 443 | 3300032004 | Ga0307414_10010665 | Ga0307414_100106656 | 179 |
| 444 | 3300032004 | Ga0307414_10390534 | Ga0307414_103905342 | 179 |
| 445 | 3300032004 | Ga0307414_11050451 | Ga0307414_110504511 | 179 |
| 446 | 3300035112 | Ga0373932_0013561 | Ga0373932_0013561_156_707 | 179 |
| 447 | 3300035172 | Ga0373955_0262999 | Ga0373955_0262999_174_731 | 179 |
| 448 | 3300035691 | Ga0373931_0439959 | Ga0373931_0439959_212_763 | 179 |
| 449 | 3300037471 | Ga0395905_0038725 | Ga0395905_0038725_1239_1796 | 179 |
| 450 | 3300037471 | Ga0395905_0507613 | Ga0395905_0507613_149_700 | 179 |
| 451 | 3300038443 | Ga0395901_1294051 | Ga0395901_1294051_52_603 | 179 |
| 452 | 3300039450 | Ga0436363_0022589 | Ga0436363_0022589_90_641 | 179 |
| 453 | 3300041404 | Ga0439436_0032533 | Ga0439436_0032533_664_1221 | 179 |
| 454 | 3300041406 | Ga0439439_0010182 | Ga0439439_0010182_1086_1643 | 179 |
| 455 | 3300041407 | Ga0439447_047573 | Ga0439447_047573_222_785 | 179 |
| 456 | 3300041411 | Ga0439466_0087474 | Ga0439466_0087474_215_781 | 179 |
| 457 | 3300041413 | Ga0439465_0198302 | Ga0439465_0198302_121_678 | 179 |
| 458 | 3300041451 | Ga0451791_0373605 | Ga0451791_0373605_283_834 | 179 |
| 459 | 3300041452 | Ga0451793_0612856 | Ga0451793_0612856_1033_1596 | 179 |
| 460 | 3300041453 | Ga0451797_1533881 | Ga0451797_1533881_51_605 | 179 |
| 461 | 3300041486 | Ga0451807_0569212 | Ga0451807_0569212_63_614 | 179 |
| 462 | 3300041486 | Ga0451807_1298242 | Ga0451807_1298242_600_1160 | 179 |
| 463 | 3300041486 | Ga0451807_1494639 | Ga0451807_1494639_1685_2236 | 179 |
| 464 | 3300041486 | Ga0451807_2154701 | Ga0451807_2154701_477_1031 | 179 |
| 465 | 3300041491 | Ga0451833_1346353 | Ga0451833_1346353_1135_1692 | 179 |
| 466 | 3300041494 | Ga0451837_0937937 | Ga0451837_0937937_443_997 | 179 |
| 467 | 3300041498 | Ga0451841_0961435 | Ga0451841_0961435_215_772 | 179 |
| 468 | 3300041501 | Ga0451845_0394193 | Ga0451845_0394193_293_850 | 179 |
| 469 | 3300041507 | Ga0451851_0805390 | Ga0451851_0805390_54_605 | 179 |
| 470 | 3300041509 | Ga0451843_0549395 | Ga0451843_0549395_114_668 | 179 |
| 471 | 3300041509 | Ga0451843_0995758 | Ga0451843_0995758_606_1163 | 179 |
| 472 | 3300041512 | Ga0451853_1991779 | Ga0451853_1991779_216_773 | 179 |
| 473 | 3300041999 | Ga0439433_0025210 | Ga0439433_0025210_57_623 | 179 |
| 474 | 3300042004 | Ga0439445_0009847 | Ga0439445_0009847_1145_1699 | 179 |
| 475 | 3300042006 | Ga0439432_034037 | Ga0439432_034037_523_1077 | 179 |
| 476 | 3300042010 | Ga0439452_019969 | Ga0439452_019969_183_740 | 179 |
| 477 | 3300042015 | Ga0439462_0004131 | Ga0439462_0004131_1834_2400 | 179 |
| 478 | 3300042015 | Ga0439462_0004645 | Ga0439462_0004645_2445_3002 | 179 |
| 479 | 3300042115 | Ga0450911_000121 | Ga0450911_000121_11065_11619 | 179 |
| 480 | 3300042134 | Ga0450898_047755 | Ga0450898_047755_84_635 | 179 |
| 481 | 3300042156 | Ga0439446_0078470 | Ga0439446_0078470_358_915 | 179 |
| 482 | 3300042185 | Ga0450909_018858 | Ga0450909_018858_88_645 | 179 |
| 483 | 3300042439 | Ga0439464_0005973 | Ga0439464_0005973_2237_2803 | 179 |
| 484 | 3300042876 | Ga0451577_0118620 | Ga0451577_0118620_813_1364 | 179 |
| 485 | 3300042876 | Ga0451577_0188749 | Ga0451577_0188749_97_648 | 179 |
| 486 | 3300042876 | Ga0451577_0227421 | Ga0451577_0227421_430_981 | 179 |
| 487 | 3300044656 | Ga0466969_0000177 | Ga0466969_0000177_9107_9661 | 179 |
| 488 | 3300044656 | Ga0466969_0005025 | Ga0466969_0005025_182_733 | 179 |
| 489 | 3300044659 | Ga0466973_0041228 | Ga0466973_0041228_2895_3449 | 179 |
| 490 | 3300044683 | Ga0466965_0001523 | Ga0466965_0001523_8686_9240 | 179 |
| 491 | 3300044683 | Ga0466965_0016395 | Ga0466965_0016395_2322_2873 | 179 |
| 492 | 3300044684 | Ga0466966_0005905 | Ga0466966_0005905_1653_2204 | 179 |
| 493 | 3300044693 | Ga0466961_0003013 | Ga0466961_0003013_7844_8398 | 179 |
| 494 | 3300044693 | Ga0466961_0463443 | Ga0466961_0463443_137_688 | 179 |
| 495 | 3300044694 | Ga0466963_0003797 | Ga0466963_0003797_7971_8525 | 179 |
| 496 | 3300044706 | Ga0466964_0004537 | Ga0466964_0004537_1148_1699 | 179 |
| 497 | 3300044712 | Ga0453684_0000386 | Ga0453684_0000386_28291_28842 | 179 |
| 498 | 3300044712 | Ga0453684_0104545 | Ga0453684_0104545_163_714 | 179 |
| 499 | 3300044712 | Ga0453684_0453429 | Ga0453684_0453429_714_1262 | 179 |
| 500 | 3300044719 | Ga0466971_0005166 | Ga0466971_0005166_1319_1870 | 179 |
| 501 | 3300044735 | Ga0466968_0045588 | Ga0466968_0045588_1289_1840 | 179 |
| 502 | 3300044765 | Ga0466970_0020423 | Ga0466970_0020423_1786_2337 | 179 |
| 503 | 3300044765 | Ga0466970_0024892 | Ga0466970_0024892_2270_2824 | 179 |
| 504 | 3300044842 | Ga0466957_0000706 | Ga0466957_0000706_12876_13430 | 179 |
| 505 | 3300044842 | Ga0466957_0030827 | Ga0466957_0030827_2007_2558 | 179 |
| 506 | 3300045049 | Ga0466959_0036671 | Ga0466959_0036671_1714_2268 | 179 |
| 507 | 3300045049 | Ga0466959_0071640 | Ga0466959_0071640_1911_2462 | 179 |
| 508 | 3300045836 | Ga0466958_0028478 | Ga0466958_0028478_584_1138 | 179 |
| 509 | 3300045836 | Ga0466958_0444143 | Ga0466958_0444143_277_828 | 179 |
| 510 | 3300045976 | Ga0466967_0109733 | Ga0466967_0109733_296_847 | 179 |
| 511 | 3300045976 | Ga0466967_0510581 | Ga0466967_0510581_574_1125 | 179 |
| 512 | 3300046459 | Ga0495629_0392544 | Ga0495629_0392544_32_589 | 179 |
| 513 | 3300046459 | Ga0495629_0444459 | Ga0495629_0444459_290_844 | 179 |
| 514 | 3300046460 | Ga0495638_0394567 | Ga0495638_0394567_76_636 | 179 |
| 515 | 3300046475 | Ga0495639_0001341 | Ga0495639_0001341_6813_7367 | 179 |
| 516 | 3300046522 | Ga0495643_0298446 | Ga0495643_0298446_132_686 | 179 |
| 517 | 3300046528 | Ga0495642_0116254 | Ga0495642_0116254_414_968 | 179 |
| 518 | 3300046542 | Ga0495597_0004256 | Ga0495597_0004256_1378_1929 | 179 |
| 519 | 3300046543 | Ga0495645_0331592 | Ga0495645_0331592_45_599 | 179 |
| 520 | 3300046615 | Ga0495656_0000209 | Ga0495656_0000209_3797_4348 | 179 |
| 521 | 3300046615 | Ga0495656_0300890 | Ga0495656_0300890_13_567 | 179 |
| 522 | 3300046648 | Ga0495611_0180948 | Ga0495611_0180948_385_936 | 179 |
| 523 | 3300046674 | Ga0495588_0024320 | Ga0495588_0024320_1132_1686 | 179 |
| 524 | 3300046675 | Ga0495657_0502068 | Ga0495657_0502068_131_685 | 179 |
| 525 | 3300046678 | Ga0495599_0503703 | Ga0495599_0503703_40_591 | 179 |
| 526 | 3300046678 | Ga0495599_0619170 | Ga0495599_0619170_11_565 | 179 |
| 527 | 3300046691 | Ga0495670_0026417 | Ga0495670_0026417_403_960 | 179 |
| 528 | 3300046691 | Ga0495670_0242765 | Ga0495670_0242765_366_917 | 179 |
| 529 | 3300046692 | Ga0495671_0033080 | Ga0495671_0033080_1951_2502 | 179 |
| 530 | 3300047318 | Ga0495636_0054414 | Ga0495636_0054414_492_1043 | 179 |
| 531 | 3300047321 | Ga0495676_0036994 | Ga0495676_0036994_1350_1907 | 179 |
| 532 | 3300047443 | Ga0495687_000128 | Ga0495687_000128_98716_99267 | 179 |
| 533 | 3300047445 | Ga0495677_0157552 | Ga0495677_0157552_204_755 | 179 |
| 534 | 3300047673 | Ga0495593_0135857 | Ga0495593_0135857_467_1021 | 179 |
| 535 | 3300048091 | Ga0495626_0070790 | Ga0495626_0070790_514_1065 | 179 |
| 536 | 3300048904 | Ga0496101_0000958 | Ga0496101_0000958_11270_11824 | 179 |
| 537 | 3300048904 | Ga0496101_0423793 | Ga0496101_0423793_276_827 | 179 |
| 538 | 3300048904 | Ga0496101_0976634 | Ga0496101_0976634_51_605 | 179 |
| 539 | 3300048905 | Ga0496102_0002816 | Ga0496102_0002816_7958_8509 | 179 |
| 540 | 3300048905 | Ga0496102_0009559 | Ga0496102_0009559_3660_4211 | 179 |
| 541 | 3300048905 | Ga0496102_0014592 | Ga0496102_0014592_3656_4210 | 179 |
| 542 | 3300048905 | Ga0496102_0492320 | Ga0496102_0492320_327_881 | 179 |
| 543 | 3300048905 | Ga0496102_0870987 | Ga0496102_0870987_152_703 | 179 |
| 544 | 3300048906 | Ga0496103_0213946 | Ga0496103_0213946_238_789 | 179 |
| 545 | 3300048907 | Ga0496104_0000688 | Ga0496104_0000688_21994_22548 | 179 |
| 546 | 3300048907 | Ga0496104_0209342 | Ga0496104_0209342_242_793 | 179 |
| 547 | 3300048907 | Ga0496104_0269814 | Ga0496104_0269814_576_1139 | 179 |
| 548 | 3300048908 | Ga0496105_0005944 | Ga0496105_0005944_8569_9123 | 179 |
| 549 | 3300048908 | Ga0496105_0124317 | Ga0496105_0124317_1133_1684 | 179 |
| 550 | 3300048908 | Ga0496105_0371651 | Ga0496105_0371651_492_1055 | 179 |
| 551 | 3300048909 | Ga0496106_0002769 | Ga0496106_0002769_11466_12017 | 179 |
| 552 | 3300048909 | Ga0496106_0067516 | Ga0496106_0067516_1811_2365 | 179 |
| 553 | 3300048910 | Ga0496107_0027449 | Ga0496107_0027449_858_1409 | 179 |
| 554 | 3300048910 | Ga0496107_0177045 | Ga0496107_0177045_551_1105 | 179 |
| 555 | 3300048911 | Ga0496108_0044917 | Ga0496108_0044917_2003_2557 | 179 |
| 556 | 3300048912 | Ga0496109_0030792 | Ga0496109_0030792_1345_1899 | 179 |
| 557 | 3300048912 | Ga0496109_0089162 | Ga0496109_0089162_1899_2453 | 179 |
| 558 | 3300048912 | Ga0496109_0138057 | Ga0496109_0138057_884_1435 | 179 |
| 559 | 3300048912 | Ga0496109_0185917 | Ga0496109_0185917_1228_1782 | 179 |
| 560 | 3300048913 | Ga0496110_0058288 | Ga0496110_0058288_920_1474 | 179 |
| 561 | 3300048913 | Ga0496110_0269330 | Ga0496110_0269330_192_743 | 179 |
| 562 | 3300048913 | Ga0496110_0372599 | Ga0496110_0372599_131_688 | 179 |
| 563 | 3300048916 | Ga0496113_0155268 | Ga0496113_0155268_873_1427 | 179 |
| 564 | 3300048917 | Ga0496114_0078913 | Ga0496114_0078913_2206_2760 | 179 |
| 565 | 3300048917 | Ga0496114_0088470 | Ga0496114_0088470_1914_2468 | 179 |
| 566 | 3300048920 | Ga0496117_0018952 | Ga0496117_0018952_1855_2409 | 179 |
| 567 | 3300048920 | Ga0496117_0191115 | Ga0496117_0191115_597_1151 | 179 |
| 568 | 3300048921 | Ga0496118_0049833 | Ga0496118_0049833_1163_1717 | 179 |
| 569 | 3300048924 | Ga0496121_0005075 | Ga0496121_0005075_5604_6158 | 179 |
| 570 | 3300048924 | Ga0496121_0045777 | Ga0496121_0045777_530_1084 | 179 |
| 571 | 3300048927 | Ga0496124_0101737 | Ga0496124_0101737_771_1325 | 179 |
| 572 | 3300048927 | Ga0496124_0487440 | Ga0496124_0487440_22_576 | 179 |
| 573 | 3300048928 | Ga0496125_0004501 | Ga0496125_0004501_10363_10917 | 179 |
| 574 | 3300048928 | Ga0496125_0010645 | Ga0496125_0010645_5211_5765 | 179 |
| 575 | 3300048928 | Ga0496125_0014401 | Ga0496125_0014401_4949_5503 | 179 |
| 576 | 3300048929 | Ga0496126_0302190 | Ga0496126_0302190_297_851 | 179 |
| 577 | 3300048929 | Ga0496126_0357361 | Ga0496126_0357361_43_597 | 179 |
| 578 | 3300049128 | Ga0501308_015991 | Ga0501308_015991_63_617 | 179 |
| 579 | 3300049571 | Ga0501034_0188716 | Ga0501034_0188716_141_692 | 179 |
| 580 | 3300049571 | Ga0501034_0345936 | Ga0501034_0345936_557_1108 | 179 |
| 581 | 3300049571 | Ga0501034_0471650 | Ga0501034_0471650_550_1101 | 179 |
| 582 | 3300049572 | Ga0501036_0289434 | Ga0501036_0289434_669_1229 | 179 |
| 583 | 3300049576 | Ga0501040_0564605 | Ga0501040_0564605_67_615 | 179 |
| 584 | 3300049577 | Ga0501041_0323891 | Ga0501041_0323891_38_586 | 179 |
| 585 | 3300049578 | Ga0501042_0259462 | Ga0501042_0259462_373_924 | 179 |
| 586 | 3300049579 | Ga0501043_0186685 | Ga0501043_0186685_817_1383 | 179 |
| 587 | 3300049580 | Ga0501046_0130424 | Ga0501046_0130424_1120_1671 | 179 |
| 588 | 3300049581 | Ga0501047_0454556 | Ga0501047_0454556_530_1096 | 179 |
| 589 | 3300049582 | Ga0501048_0142758 | Ga0501048_0142758_386_937 | 179 |
| 590 | 3300049586 | Ga0501070_0232774 | Ga0501070_0232774_834_1385 | 179 |
| 591 | 3300049587 | Ga0501071_0252747 | Ga0501071_0252747_426_977 | 179 |
| 592 | 3300049587 | Ga0501071_0276502 | Ga0501071_0276502_423_974 | 179 |
| 593 | 3300049590 | Ga0501074_0117790 | Ga0501074_0117790_790_1341 | 179 |
| 594 | 3300049590 | Ga0501074_0361204 | Ga0501074_0361204_259_807 | 179 |
| 595 | 3300049591 | Ga0501075_0058604 | Ga0501075_0058604_2241_2792 | 179 |
| 596 | 3300049593 | Ga0501077_0091526 | Ga0501077_0091526_1134_1685 | 179 |
| 597 | 3300049593 | Ga0501077_0277856 | Ga0501077_0277856_22_570 | 179 |
| 598 | 3300049741 | Ga0501079_0036430 | Ga0501079_0036430_2394_2945 | 179 |
| 599 | 3300049741 | Ga0501079_0167106 | Ga0501079_0167106_104_652 | 179 |
| 600 | 3300049744 | Ga0501083_0312731 | Ga0501083_0312731_334_882 | 179 |
| 601 | 3300049822 | Ga0501035_0068916 | Ga0501035_0068916_310_876 | 179 |
| 602 | 3300049822 | Ga0501035_0790191 | Ga0501035_0790191_32_586 | 179 |
| 603 | 3300049823 | Ga0501044_0082733 | Ga0501044_0082733_151_717 | 179 |
| 604 | 3300049823 | Ga0501044_0334543 | Ga0501044_0334543_755_1306 | 179 |
| 605 | 3300049824 | Ga0501045_0287247 | Ga0501045_0287247_616_1167 | 179 |
| 606 | 3300050489 | nmdc:mga03683_148240_c1 | nmdc:mga03683_148240_c1_415_966 | 179 |
| 607 | 3300050489 | nmdc:mga03683_153569_c1 | nmdc:mga03683_153569_c1_317_868 | 179 |
| 608 | 3300050490 | nmdc:mga03n38_386301_c1 | nmdc:mga03n38_386301_c1_37_594 | 179 |
| 609 | 3300050492 | nmdc:mga0yw44_136428_c1 | nmdc:mga0yw44_136428_c1_263_817 | 179 |
| 610 | 3300050492 | nmdc:mga0yw44_272037_c1 | nmdc:mga0yw44_272037_c1_84_635 | 179 |
| 611 | 3300050493 | nmdc:mga0k408_34186_c1 | nmdc:mga0k408_34186_c1_535_1092 | 179 |
| 612 | 3300050493 | nmdc:mga0k408_49986_c1 | nmdc:mga0k408_49986_c1_939_1490 | 179 |
| 613 | 3300050493 | nmdc:mga0k408_5220_c1 | nmdc:mga0k408_5220_c1_640_1191 | 179 |
| 614 | 3300050493 | nmdc:mga0k408_58645_c1 | nmdc:mga0k408_58645_c1_581_1147 | 179 |
| 615 | 3300050493 | nmdc:mga0k408_89092_c1 | nmdc:mga0k408_89092_c1_182_739 | 179 |
| 616 | 3300050495 | nmdc:mga04h51_109530_c1 | nmdc:mga04h51_109530_c1_120_701 | 179 |
| 617 | 3300050495 | nmdc:mga04h51_22089_c1 | nmdc:mga04h51_22089_c1_577_1134 | 179 |
| 618 | 3300050496 | nmdc:mga07m45_355052_c1 | nmdc:mga07m45_355052_c1_275_826 | 179 |
| 619 | 3300050496 | nmdc:mga07m45_5412_c1 | nmdc:mga07m45_5412_c1_3825_4382 | 179 |
| 620 | 3300050507 | nmdc:mga05p37_423790_c1 | nmdc:mga05p37_423790_c1_219_773 | 179 |
| 621 | 3300050508 | nmdc:mga09592_166675_c1 | nmdc:mga09592_166675_c1_926_1480 | 179 |
| 622 | 3300050509 | nmdc:mga0qj67_362379_c1 | nmdc:mga0qj67_362379_c1_183_734 | 179 |
| 623 | 3300050510 | nmdc:mga06r32_875546_c1 | nmdc:mga06r32_875546_c1_142_696 | 179 |
| 624 | 3300050511 | nmdc:mga08y16_1293335_c1 | nmdc:mga08y16_1293335_c1_125_676 | 179 |
| 625 | 3300050511 | nmdc:mga08y16_177827_c1 | nmdc:mga08y16_177827_c1_1346_1897 | 179 |
| 626 | 3300050511 | nmdc:mga08y16_296372_c1 | nmdc:mga08y16_296372_c1_323_871 | 179 |
| 627 | 3300053108 | Ga0500562_008842 | Ga0500562_008842_1567_2118 | 179 |
| 628 | 3300053117 | Ga0500593_001263 | Ga0500593_001263_276_827 | 179 |
| 629 | 3300053118 | Ga0500594_0193636 | Ga0500594_0193636_80_634 | 179 |
| 630 | 3300053125 | Ga0500618_035321 | Ga0500618_035321_568_1116 | 179 |
| 631 | 3300053131 | Ga0500652_000673 | Ga0500652_000673_5546_6097 | 179 |
| 632 | 3300053136 | Ga0500559_0003620 | Ga0500559_0003620_5619_6167 | 179 |
| 633 | 3300053136 | Ga0500559_0011876 | Ga0500559_0011876_1468_2022 | 179 |
| 634 | 3300053153 | Ga0500616_0021040 | Ga0500616_0021040_1592_2143 | 179 |
| 635 | 3300053730 | Ga0500645_005416 | Ga0500645_005416_3347_3898 | 179 |
| 636 | 3300054114 | Ga0501084_0107458 | Ga0501084_0107458_306_857 | 179 |
| 637 | 3300060353 | Ga0501082_0050362 | Ga0501082_0050362_909_1460 | 179 |
| 638 | 3300060353 | Ga0501082_0281564 | Ga0501082_0281564_811_1359 | 179 |
| 639 | 3300061719 | Ga0466962_0074084 | Ga0466962_0074084_875_1426 | 179 |
| 640 | 3300061734 | Ga0530510_0316182 | Ga0530510_0316182_102_650 | 179 |
| 641 | 3300041496 | Ga0451839_0661452 | Ga0451839_0661452_29_571 | 180 |
| 642 | 3300002075 | JGI24738J21930_10010593 | JGI24738J21930_100105932 | 181 |
| 643 | 3300005354 | Ga0070675_100767959 | Ga0070675_1007679591 | 181 |
| 644 | 3300005457 | Ga0070662_100084052 | Ga0070662_1000840523 | 181 |
| 645 | 3300005563 | Ga0068855_100126864 | Ga0068855_1001268643 | 181 |
| 646 | 3300006237 | Ga0097621_100295183 | Ga0097621_1002951832 | 181 |
| 647 | 3300011119 | Ga0105246_10000896 | Ga0105246_100008966 | 181 |
| 648 | 3300013100 | Ga0157373_10064951 | Ga0157373_100649513 | 181 |
| 649 | 3300013307 | Ga0157372_10816511 | Ga0157372_108165112 | 181 |
| 650 | 3300014745 | Ga0157377_10333239 | Ga0157377_103332391 | 181 |
| 651 | 3300025926 | Ga0207659_11071081 | Ga0207659_110710811 | 181 |
| 652 | 3300025933 | Ga0207706_10041291 | Ga0207706_100412914 | 181 |
| 653 | 3300025949 | Ga0207667_10022875 | Ga0207667_100228755 | 181 |
| 654 | 3300031824 | Ga0307413_11163037 | Ga0307413_111630371 | 181 |
| 655 | 3300049572 | Ga0501036_0234997 | Ga0501036_0234997_370_927 | 181 |
| 656 | 3300049823 | Ga0501044_0109666 | Ga0501044_0109666_1059_1616 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3u7r-assembly1.cif.gz_A | ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans | 0.9249 | 1 | 179 |
| 3u7r-assembly1.cif.gz_A | ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans | 0.9151 | 1 | 179 |
| 3s2y-assembly1.cif.gz_A | crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii | 0.8772 | 2 | 180 |
| 4hs4-assembly1.cif.gz_G-1 | crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. | 0.8759 | 2 | 180 |
| 4h6p-assembly1.cif.gz_A | crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. | 0.8749 | 2 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u7rB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9204 | 1 | 179 | 3.40.50.360 |
| 3u7rB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.9055 | 1 | 179 | 3.40.50.360 |
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8722 | 3 | 173 | 3.40.50.360 |
| 3svlA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8544 | 1 | 176 | 3.40.50.360 |
| 1x77B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.8538 | 3 | 173 | 3.40.50.360 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J8VW18-F1-model_v4 | deleted | 0.974 | 1 | 180 |
|
| AF-G6EC80-F1-model_v4 | NADPH-dependent FMN reductase | 0.97 | 2 | 179 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-J8VW18-F1-model_v4 | deleted | 0.9687 | 1 | 180 |
|
| AF-A0A257PSN8-F1-model_v4 | NADPH-dependent FMN reductase | 0.9668 | 1 | 115 |
GO:0005829
GO:0010181 GO:0016491 |
| AF-A0A0A0EWY9-F1-model_v4 | NADPH-dependent FMN reductase | 0.9618 | 1 | 180 |
GO:0005829
GO:0010181 GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar