F472986

General Info

Members Datasets Scaffolds Average Seq Length
656 366 655 184

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10060115|Ga0055531_100601152
Length 185
Sequence MSQLKIAVVIGSLRKDSLNRKLALALAQLAPSGVTFEHVRIDDLPHYDQDQDGNQAPEVRRLKNEISAADGVLFVTPEYNRSVPGVLKNAIDNASRPYDGQSAWAGKPAGVIGISVGAIGTALAQQHLRNTLAYLDMPTLGQPEAFVQNKEGLFDDKGHVAVEATREFLKGWVEKYVAWVKAHAK

Samples

Sample ID Description Type Environment
1 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
87 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
88 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
190 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
194 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
195 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
204 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
208 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
217 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
218 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
219 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
220 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
221 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
232 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
233 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
234 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
235 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
236 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
241 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
242 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
243 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
244 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
250 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
251 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
254 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
255 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
256 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
257 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
258 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
259 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
260 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
265 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
266 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
267 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
268 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
269 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
277 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
278 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
279 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
280 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
281 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
288 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
289 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
290 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
294 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
295 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
298 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
301 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
302 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
303 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
317 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
318 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
319 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
322 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
326 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
337 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
338 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
339 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
342 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
343 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
344 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
345 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
349 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
350 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
351 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
352 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
353 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
357 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
358 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
359 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
360 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
361 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
362 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.39
Metatranscriptomes 0.46
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.45
Nodule 0.15
Rhizoplane 5.64
Rhizosphere 78.96
Stem 0
Stem Tuber 0
Unclassified 5.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10010593 3300002075 Bacteria 2047
2 JGI25159J45721_1028197 3300002987 Bacteria 941
3 JGI25151J46595_10007367 3300003187 Bacteria 5405
4 rootH1_10053255 3300003323 Bacteria 3687
5 Ga0007416J51690_1045190 3300003577 Bacteria 1452
6 Ga0055525_1000046 3300003759 Bacteria 261587
7 Ga0055536_1038771 3300003781 Bacteria 1151
8 Ga0055534_1000830 3300003784 Bacteria 14273
9 Ga0055531_10001259 3300003794 Bacteria 19156
10 Ga0055531_10060115 3300003794 Bacteria 934
11 Ga0065714_10158578 3300005288 Bacteria 1064
12 Ga0065712_10488927 3300005290 Bacteria 657
13 Ga0065715_10246939 3300005293 Bacteria 1180
14 Ga0070658_10036341 3300005327 Bacteria 3970
15 Ga0070658_10163156 3300005327 Bacteria 1870
16 Ga0070676_10058519 3300005328 Bacteria 2284
17 Ga0070677_10003364 3300005333 Bacteria 5154
18 Ga0068869_100014018 3300005334 Bacteria 5348
19 Ga0070680_100020142 3300005336 Bacteria 5292
20 Ga0068868_100128778 3300005338 Bacteria 2070
21 Ga0068868_100613629 3300005338 Bacteria 965
22 Ga0070691_10010717 3300005341 Bacteria 4184
23 Ga0070687_100081552 3300005343 Bacteria 1766
24 Ga0070661_100150208 3300005344 Bacteria 1761
25 Ga0070692_10045832 3300005345 Bacteria 2257
26 Ga0070675_100007299 3300005354 Bacteria 8530
27 Ga0070675_100055685 3300005354 Bacteria 3256
28 Ga0070675_100767959 3300005354 Bacteria 880
29 Ga0070671_100176145 3300005355 Bacteria 1810
30 Ga0070671_100354747 3300005355 Unclassified 1252
31 Ga0070674_100019397 3300005356 Bacteria 4319
32 Ga0070674_100396412 3300005356 Unclassified 1127
33 Ga0070673_100005707 3300005364 Bacteria 8001
34 Ga0070673_100053999 3300005364 Bacteria 3159
35 Ga0070673_100172184 3300005364 Unclassified 1848
36 Ga0070688_100567641 3300005365 Unclassified 865
37 Ga0070659_100542326 3300005366 Bacteria 995
38 Ga0070667_100000126 3300005367 Bacteria 96729
39 Ga0070667_100017882 3300005367 Bacteria 5875
40 Ga0070667_100066632 3300005367 Bacteria 3060
41 Ga0070703_10002365 3300005406 Bacteria 5443
42 Ga0070713_100415619 3300005436 Bacteria 1258
43 Ga0070701_10013275 3300005438 Bacteria 3744
44 Ga0070701_10013492 3300005438 Bacteria 3719
45 Ga0070705_100000901 3300005440 Bacteria 16586
46 Ga0070700_100001924 3300005441 Bacteria 10504
47 Ga0070694_100001405 3300005444 Bacteria 14089
48 Ga0070708_100016481 3300005445 Bacteria 6134
49 Ga0070663_100135786 3300005455 Bacteria 1872
50 Ga0070663_100489168 3300005455 Bacteria 1020
51 Ga0070678_100155685 3300005456 Bacteria 1846
52 Ga0070678_100170557 3300005456 Bacteria 1772
53 Ga0070678_100283762 3300005456 Bacteria 1401
54 Ga0070662_100004214 3300005457 Bacteria 9058
55 Ga0070662_100084052 3300005457 Bacteria 2377
56 Ga0070662_100405133 3300005457 Bacteria 1126
57 Ga0070681_10134315 3300005458 Bacteria 2405
58 Ga0070681_10657371 3300005458 Bacteria 963
59 Ga0068867_100006945 3300005459 Bacteria 8010
60 Ga0068867_100327498 3300005459 Bacteria 1271
61 Ga0070685_10782778 3300005466 Bacteria 702
62 Ga0070706_100029463 3300005467 Bacteria 5057
63 Ga0070698_100017908 3300005471 Bacteria 7463
64 Ga0070699_100015194 3300005518 Bacteria 6615
65 Ga0070679_100241151 3300005530 Bacteria 1765
66 Ga0070679_100388884 3300005530 Bacteria 1341
67 Ga0070679_100414668 3300005530 Bacteria 1292
68 Ga0070697_100009532 3300005536 Bacteria 7588
69 Ga0070672_100097790 3300005543 Bacteria 2376
70 Ga0070672_100117463 3300005543 Bacteria 2175
71 Ga0070695_100000158 3300005545 Bacteria 32227
72 Ga0070696_100004561 3300005546 Bacteria 9246
73 Ga0070693_100022136 3300005547 Bacteria 3375
74 Ga0070665_100011192 3300005548 Bacteria 9072
75 Ga0070665_100088712 3300005548 Bacteria 3098
76 Ga0070665_100805428 3300005548 Bacteria 952
77 Ga0070704_100008256 3300005549 Bacteria 6233
78 Ga0070704_100059348 3300005549 Bacteria 2729
79 Ga0068855_100029598 3300005563 Bacteria 6546
80 Ga0068855_100086706 3300005563 Bacteria 3620
81 Ga0068855_100126864 3300005563 Bacteria 2917
82 Ga0068855_100828720 3300005563 Bacteria 981
83 Ga0070664_100041366 3300005564 Bacteria 3889
84 Ga0070664_101256036 3300005564 Bacteria 699
85 Ga0068857_100009560 3300005577 Bacteria 8420
86 Ga0068854_100112572 3300005578 Bacteria 2055
87 Ga0068854_100565227 3300005578 Bacteria 967
88 Ga0070702_100621617 3300005615 Unclassified 813
89 Ga0068852_100385929 3300005616 Bacteria 1375
90 Ga0068852_100665084 3300005616 Bacteria 1050
91 Ga0068859_100003502 3300005617 Bacteria 15988
92 Ga0068859_100573091 3300005617 Bacteria 1223
93 Ga0068864_100014556 3300005618 Bacteria 6536
94 Ga0068864_100025178 3300005618 Bacteria 5009
95 Ga0068864_100379845 3300005618 Bacteria 1339
96 Ga0068866_10089975 3300005718 Bacteria 1669
97 Ga0068866_10391779 3300005718 Bacteria 894
98 Ga0068861_100042905 3300005719 Bacteria 3392
99 Ga0068861_100194215 3300005719 Bacteria 1699
100 Ga0068861_100414923 3300005719 Unclassified 1198
101 Ga0068870_10009503 3300005840 Bacteria 4428
102 Ga0068870_10018925 3300005840 Bacteria 3334
103 Ga0068863_100794612 3300005841 Bacteria 944
104 Ga0068858_100054191 3300005842 Bacteria 3708
105 Ga0068860_100001841 3300005843 Bacteria 22590
106 Ga0068860_100113479 3300005843 Bacteria 2591
107 Ga0068862_100002731 3300005844 Bacteria 15492
108 Ga0068862_100043810 3300005844 Bacteria 3815
109 Ga0075368_10047295 3300006042 Bacteria 1703
110 Ga0075363_100110546 3300006048 Bacteria 1527
111 Ga0075363_100192940 3300006048 Bacteria 1162
112 Ga0075364_10068103 3300006051 Bacteria 2340
113 Ga0070716_100123171 3300006173 Bacteria 1627
114 Ga0070716_100245128 3300006173 Bacteria 1217
115 Ga0075362_10198653 3300006177 Bacteria 976
116 Ga0075367_10097913 3300006178 Bacteria 1790
117 Ga0075367_10244352 3300006178 Bacteria 1125
118 Ga0075366_10000371 3300006195 Bacteria 20821
119 Ga0075366_10014438 3300006195 Bacteria 4511
120 Ga0075366_10015834 3300006195 Bacteria 4329
121 Ga0075366_10048208 3300006195 Bacteria 2525
122 Ga0097621_100031472 3300006237 Bacteria 4211
123 Ga0097621_100073271 3300006237 Bacteria 2835
124 Ga0097621_100086234 3300006237 Bacteria 2620
125 Ga0097621_100204124 3300006237 Bacteria 1717
126 Ga0097621_100295183 3300006237 Bacteria 1430
127 Ga0075370_10009692 3300006353 Bacteria 5013
128 Ga0075370_10040097 3300006353 Bacteria 2641
129 Ga0075370_10169388 3300006353 Bacteria 1283
130 Ga0075370_10397692 3300006353 Bacteria 826
131 Ga0068871_100027904 3300006358 Bacteria 4421
132 Ga0068871_100185732 3300006358 Bacteria 1788
133 Ga0068871_100330282 3300006358 Bacteria 1345
134 Ga0068871_100796591 3300006358 Bacteria 871
135 Ga0075430_100074103 3300006846 Bacteria 2854
136 Ga0075431_100228668 3300006847 Bacteria 1896
137 Ga0075433_10292612 3300006852 Bacteria 1442
138 Ga0075429_100386532 3300006880 Bacteria 1225
139 Ga0068865_100157758 3300006881 Bacteria 1728
140 Ga0068865_100384230 3300006881 Bacteria 1146
141 Ga0097620_100003500 3300006931 Bacteria 15988
142 Ga0097620_100573063 3300006931 Bacteria 1223
143 Ga0099826_10100537 3300006948 Bacteria 1745
144 Ga0099795_10022813 3300007788 Bacteria 2070
145 Ga0105244_10006285 3300009036 Bacteria 7731
146 Ga0105240_10002809 3300009093 Bacteria 27496
147 Ga0105240_10264560 3300009093 Bacteria 1983
148 Ga0105240_10315421 3300009093 Bacteria 1784
149 Ga0105240_10422603 3300009093 Bacteria 1497
150 Ga0105240_10829872 3300009093 Bacteria 999
151 Ga0111539_10007314 3300009094 Bacteria 14138
152 Ga0111539_10319637 3300009094 Bacteria 1806
153 Ga0111539_10346507 3300009094 Bacteria 1729
154 Ga0111539_10382640 3300009094 Bacteria 1638
155 Ga0105245_10227463 3300009098 Bacteria 1802
156 Ga0105247_10630404 3300009101 Bacteria 798
157 Ga0114129_11077473 3300009147 Bacteria 1007
158 Ga0114129_11537441 3300009147 Bacteria 816
159 Ga0105243_10014281 3300009148 Bacteria 6009
160 Ga0105243_10020340 3300009148 Bacteria 5034
161 Ga0105243_11599670 3300009148 Bacteria 678
162 Ga0105241_10279185 3300009174 Bacteria 1426
163 Ga0105241_11588154 3300009174 Unclassified 632
164 Ga0105242_10135094 3300009176 Bacteria 2134
165 Ga0105242_10457450 3300009176 Bacteria 1204
166 Ga0105242_10475924 3300009176 Bacteria 1183
167 Ga0105242_11013213 3300009176 Bacteria 839
168 Ga0105248_10097185 3300009177 Bacteria 3318
169 Ga0105237_10006964 3300009545 Bacteria 12461
170 Ga0105237_10122282 3300009545 Bacteria 2597
171 Ga0105237_10255533 3300009545 Bacteria 1754
172 Ga0105238_10218757 3300009551 Bacteria 1880
173 Ga0105238_10277921 3300009551 Bacteria 1655
174 Ga0105238_10452207 3300009551 Bacteria 1281
175 Ga0105238_10785937 3300009551 Bacteria 967
176 Ga0105249_10046892 3300009553 Bacteria 3935
177 Ga0105249_10184246 3300009553 Bacteria 2033
178 Ga0099796_10009871 3300010159 Bacteria 2602
179 Ga0105239_10001353 3300010375 Bacteria 32991
180 Ga0105239_10206651 3300010375 Bacteria 2200
181 Ga0105239_10494175 3300010375 Bacteria 1391
182 Ga0105246_10000896 3300011119 Bacteria 17101
183 Ga0105246_10019026 3300011119 Bacteria 4381
184 Ga0105246_10097776 3300011119 Bacteria 2131
185 Ga0157373_10064951 3300013100 Bacteria 2583
186 Ga0157373_10178389 3300013100 Bacteria 1495
187 Ga0157370_10034191 3300013104 Bacteria 4952
188 Ga0157370_10034844 3300013104 Bacteria 4898
189 Ga0157370_10157913 3300013104 Bacteria 2110
190 Ga0157370_10788032 3300013104 Bacteria 865
191 Ga0157370_11352092 3300013104 Bacteria 641
192 Ga0157378_10075339 3300013297 Bacteria 3038
193 Ga0163162_10204769 3300013306 Bacteria 2102
194 Ga0163162_10207189 3300013306 Bacteria 2090
195 Ga0157372_10816511 3300013307 Bacteria 1083
196 Ga0157375_10005559 3300013308 Bacteria 10970
197 Ga0157375_10664819 3300013308 Bacteria 1197
198 Ga0157375_11238975 3300013308 Bacteria 876
199 Ga0163163_10087001 3300014325 Bacteria 3135
200 Ga0163163_10270276 3300014325 Bacteria 1751
201 Ga0157380_10017946 3300014326 Bacteria 5246
202 Ga0157380_10039990 3300014326 Bacteria 3650
203 Ga0157380_10043724 3300014326 Bacteria 3508
204 Ga0157380_10081240 3300014326 Bacteria 2651
205 Ga0157380_10091942 3300014326 Unclassified 2506
206 Ga0157380_10492242 3300014326 Unclassified 1189
207 Ga0157380_11486310 3300014326 Bacteria 730
208 Ga0182008_10000190 3300014497 Bacteria 48677
209 Ga0182008_10001821 3300014497 Bacteria 13892
210 Ga0182008_10012122 3300014497 Bacteria 4560
211 Ga0182008_10055900 3300014497 Bacteria 1951
212 Ga0157377_10158844 3300014745 Bacteria 1404
213 Ga0157377_10333239 3300014745 Bacteria 1012
214 Ga0157376_10104459 3300014969 Bacteria 2482
215 Ga0157376_10277736 3300014969 Bacteria 1576
216 Ga0157376_10529909 3300014969 Bacteria 1162
217 Ga0157376_10571101 3300014969 Bacteria 1122
218 Ga0157376_10848076 3300014969 Bacteria 929
219 Ga0157376_10935923 3300014969 Bacteria 886
220 Ga0182006_1001217 3300015261 Bacteria 16063
221 Ga0182007_10000916 3300015262 Bacteria 16314
222 Ga0182007_10001403 3300015262 Bacteria 12974
223 Ga0182005_1021950 3300015265 Bacteria 1749
224 Ga0163161_10000092 3300017792 Bacteria 90636
225 Ga0163161_10048563 3300017792 Bacteria 3065
226 Ga0163161_10048941 3300017792 Bacteria 3053
227 Ga0163161_10070504 3300017792 Bacteria 2555
228 Ga0163161_10087775 3300017792 Bacteria 2298
229 Ga0163161_10194495 3300017792 Bacteria 1560
230 Ga0206356_11249086 3300020070 Bacteria 837
231 Ga0209563_100005 3300025230 Bacteria 1774893
232 Ga0209148_1000501 3300025254 Bacteria 39942
233 Ga0207666_1033809 3300025271 Bacteria 789
234 Ga0209455_1003800 3300025272 Bacteria 5184
235 Ga0209673_1041890 3300025273 Bacteria 1294
236 Ga0209130_1004992 3300025284 Bacteria 4791
237 Ga0209675_1004723 3300025291 Bacteria 5948
238 Ga0209676_1001468 3300025292 Bacteria 21920
239 Ga0209676_1025600 3300025292 Bacteria 1889
240 Ga0209025_1000073 3300025294 Bacteria 282133
241 Ga0209564_1041276 3300025295 Bacteria 1240
242 Ga0209051_1000254 3300025303 Bacteria 90411
243 Ga0209051_1020090 3300025303 Bacteria 2890
244 Ga0209257_1000012 3300025304 Bacteria 1111138
245 Ga0209257_1000045 3300025304 Bacteria 484429
246 Ga0209257_1000137 3300025304 Bacteria 204210
247 Ga0209257_1010252 3300025304 Bacteria 4792
248 Ga0207655_1010441 3300025728 Bacteria 5629
249 Ga0207653_10002878 3300025885 Bacteria 5463
250 Ga0207682_10002252 3300025893 Bacteria 8707
251 Ga0207692_10043374 3300025898 Bacteria 2238
252 Ga0207642_10102332 3300025899 Bacteria 1441
253 Ga0207642_10266882 3300025899 Bacteria 978
254 Ga0207688_10254502 3300025901 Bacteria 1064
255 Ga0207685_10120601 3300025905 Bacteria 1150
256 Ga0207645_10166886 3300025907 Bacteria 1442
257 Ga0207643_10045292 3300025908 Bacteria 2484
258 Ga0207643_10124418 3300025908 Bacteria 1530
259 Ga0207705_10032130 3300025909 Bacteria 3750
260 Ga0207705_10058067 3300025909 Bacteria 2791
261 Ga0207654_10230518 3300025911 Bacteria 1233
262 Ga0207654_10925928 3300025911 Bacteria 632
263 Ga0207707_10152090 3300025912 Bacteria 2023
264 Ga0207707_11048495 3300025912 Bacteria 667
265 Ga0207695_10005251 3300025913 Bacteria 17291
266 Ga0207695_10565174 3300025913 Bacteria 1019
267 Ga0207671_10001552 3300025914 Bacteria 26284
268 Ga0207671_10545140 3300025914 Bacteria 925
269 Ga0207660_10004296 3300025917 Bacteria 9297
270 Ga0207662_10100667 3300025918 Bacteria 1790
271 Ga0207649_10115897 3300025920 Bacteria 1798
272 Ga0207652_10322397 3300025921 Bacteria 1395
273 Ga0207652_10339037 3300025921 Bacteria 1357
274 Ga0207694_10102739 3300025924 Bacteria 2267
275 Ga0207650_10100860 3300025925 Bacteria 2221
276 Ga0207659_10010491 3300025926 Bacteria 5824
277 Ga0207659_10040540 3300025926 Bacteria 3256
278 Ga0207659_11071081 3300025926 Bacteria 694
279 Ga0207644_10020849 3300025931 Bacteria 4459
280 Ga0207644_10051468 3300025931 Bacteria 2956
281 Ga0207644_10311665 3300025931 Unclassified 1271
282 Ga0207644_10801337 3300025931 Bacteria 788
283 Ga0207690_10291234 3300025932 Bacteria 1274
284 Ga0207706_10015206 3300025933 Bacteria 6964
285 Ga0207706_10028972 3300025933 Bacteria 4943
286 Ga0207706_10041291 3300025933 Bacteria 4090
287 Ga0207686_10306372 3300025934 Bacteria 1181
288 Ga0207709_10001793 3300025935 Bacteria 14391
289 Ga0207709_10051052 3300025935 Bacteria 2533
290 Ga0207709_10266285 3300025935 Bacteria 1259
291 Ga0207670_10095863 3300025936 Bacteria 2108
292 Ga0207670_10396956 3300025936 Bacteria 1102
293 Ga0207669_10017639 3300025937 Bacteria 3668
294 Ga0207669_10164764 3300025937 Bacteria 1570
295 Ga0207704_10206810 3300025938 Bacteria 1441
296 Ga0207704_10246637 3300025938 Bacteria 1338
297 Ga0207704_10525551 3300025938 Bacteria 958
298 Ga0207665_10291509 3300025939 Bacteria 1217
299 Ga0207691_10005068 3300025940 Bacteria 12713
300 Ga0207691_10005116 3300025940 Bacteria 12652
301 Ga0207691_10019129 3300025940 Bacteria 6483
302 Ga0207691_10031346 3300025940 Unclassified 4962
303 Ga0207691_10167489 3300025940 Bacteria 1925
304 Ga0207711_10093072 3300025941 Bacteria 2654
305 Ga0207689_10113048 3300025942 Bacteria 2232
306 Ga0207689_10146016 3300025942 Bacteria 1949
307 Ga0207679_10260614 3300025945 Bacteria 1478
308 Ga0207679_11161028 3300025945 Bacteria 709
309 Ga0207667_10022875 3300025949 Bacteria 6891
310 Ga0207667_10038744 3300025949 Bacteria 5085
311 Ga0207667_10576672 3300025949 Bacteria 1136
312 Ga0207667_10646545 3300025949 Bacteria 1063
313 Ga0207651_10101407 3300025960 Unclassified 2137
314 Ga0207651_10137005 3300025960 Bacteria 1884
315 Ga0207651_10149439 3300025960 Bacteria 1816
316 Ga0207651_10477916 3300025960 Bacteria 1073
317 Ga0207712_10023018 3300025961 Bacteria 4108
318 Ga0207668_10553714 3300025972 Bacteria 997
319 Ga0207640_10276794 3300025981 Bacteria 1316
320 Ga0207640_10464726 3300025981 Bacteria 1046
321 Ga0207640_10507485 3300025981 Bacteria 1005
322 Ga0207658_10002969 3300025986 Bacteria 12134
323 Ga0207658_10079468 3300025986 Bacteria 2509
324 Ga0207658_10099340 3300025986 Bacteria 2276
325 Ga0207658_10690327 3300025986 Bacteria 922
326 Ga0207639_10089228 3300026041 Bacteria 2463
327 Ga0207639_10602943 3300026041 Bacteria 1013
328 Ga0207678_10043388 3300026067 Bacteria 3892
329 Ga0207678_10044918 3300026067 Bacteria 3821
330 Ga0207678_10312314 3300026067 Bacteria 1351
331 Ga0207678_10720167 3300026067 Bacteria 879
332 Ga0207708_10001399 3300026075 Bacteria 18108
333 Ga0207708_11189846 3300026075 Bacteria 666
334 Ga0207641_10262314 3300026088 Bacteria 1618
335 Ga0207648_10009613 3300026089 Bacteria 9250
336 Ga0207648_10015126 3300026089 Bacteria 7101
337 Ga0207676_10003912 3300026095 Bacteria 10515
338 Ga0207676_10122475 3300026095 Bacteria 2196
339 Ga0207676_10442844 3300026095 Bacteria 1223
340 Ga0207674_10001143 3300026116 Bacteria 34428
341 Ga0207675_100020669 3300026118 Bacteria 6136
342 Ga0207675_100041267 3300026118 Bacteria 4309
343 Ga0207675_100237744 3300026118 Bacteria 1759
344 Ga0207683_10012443 3300026121 Bacteria 7262
345 Ga0207683_10049675 3300026121 Bacteria 3673
346 Ga0207683_10207785 3300026121 Bacteria 1781
347 Ga0207683_10359743 3300026121 Bacteria 1337
348 Ga0207698_10365826 3300026142 Bacteria 1367
349 Ga0207698_10469407 3300026142 Bacteria 1218
350 Ga0207698_11126418 3300026142 Bacteria 798
351 Ga0209179_1014804 3300027512 Bacteria 1439
352 Ga0209971_1008275 3300027682 Bacteria 2466
353 Ga0209813_10045836 3300027866 Bacteria 1348
354 Ga0207428_10145559 3300027907 Bacteria 1806
355 Ga0268266_10014965 3300028379 Bacteria 6660
356 Ga0268266_10051532 3300028379 Bacteria 3533
357 Ga0268266_10087997 3300028379 Bacteria 2718
358 Ga0268266_10229649 3300028379 Bacteria 1709
359 Ga0268266_10645387 3300028379 Bacteria 1018
360 Ga0268265_10000626 3300028380 Bacteria 35203
361 Ga0268265_10701674 3300028380 Bacteria 978
362 Ga0268264_10003320 3300028381 Bacteria 13903
363 Ga0268264_10091898 3300028381 Bacteria 2618
364 Ga0265334_10000420 3300028573 Bacteria 22284
365 Ga0265336_10000405 3300028666 Bacteria 26992
366 Ga0307515_10000137 3300028794 Bacteria 173516
367 Ga0307515_10000267 3300028794 Bacteria 128554
368 Ga0307515_10217636 3300028794 Bacteria 1737
369 Ga0307515_10443672 3300028794 Bacteria 914
370 Ga0265338_10050863 3300028800 Bacteria 3740
371 Ga0265338_10710892 3300028800 Bacteria 693
372 Ga0265324_10000005 3300029957 Bacteria 347038
373 Ga0265324_10001798 3300029957 Bacteria 11663
374 Ga0265324_10042811 3300029957 Bacteria 1564
375 Ga0307512_10283918 3300030522 Bacteria 788
376 Ga0265330_10000076 3300031235 Bacteria 84642
377 Ga0265330_10007256 3300031235 Bacteria 5421
378 Ga0265332_10000002 3300031238 Bacteria 709510
379 Ga0265328_10000558 3300031239 Bacteria 17328
380 Ga0265328_10013762 3300031239 Bacteria 3196
381 Ga0265325_10001692 3300031241 Bacteria 15320
382 Ga0265325_10005064 3300031241 Bacteria 8200
383 Ga0265325_10040154 3300031241 Bacteria 2459
384 Ga0265325_10040248 3300031241 Bacteria 2455
385 Ga0265329_10010276 3300031242 Bacteria 3444
386 Ga0265340_10100631 3300031247 Bacteria 1343
387 Ga0265340_10112049 3300031247 Bacteria 1261
388 Ga0265339_10010065 3300031249 Bacteria 5893
389 Ga0265331_10000030 3300031250 Bacteria 215032
390 Ga0265331_10000704 3300031250 Bacteria 28516
391 Ga0265331_10000818 3300031250 Bacteria 25607
392 Ga0265327_10000072 3300031251 Bacteria 215055
393 Ga0265327_10000374 3300031251 Bacteria 84337
394 Ga0265327_10020293 3300031251 Bacteria 4054
395 Ga0265327_10021128 3300031251 Bacteria 3937
396 Ga0265327_10076465 3300031251 Bacteria 1664
397 Ga0265316_10019208 3300031344 Bacteria 5852
398 Ga0265316_10069636 3300031344 Bacteria 2715
399 Ga0265316_10096020 3300031344 Bacteria 2257
400 Ga0265316_10237000 3300031344 Bacteria 1342
401 Ga0307513_10007611 3300031456 Bacteria 13999
402 Ga0307513_10105537 3300031456 Bacteria 2826
403 Ga0307513_10109605 3300031456 Bacteria 2758
404 Ga0307513_10232176 3300031456 Bacteria 1657
405 Ga0307513_10371905 3300031456 Bacteria 1171
406 Ga0307408_100154028 3300031548 Bacteria 1817
407 Ga0307408_100252592 3300031548 Bacteria 1455
408 Ga0307514_10000806 3300031649 Bacteria 51095
409 Ga0265314_10000066 3300031711 Bacteria 156399
410 Ga0265314_10002543 3300031711 Bacteria 18546
411 Ga0265314_10004160 3300031711 Bacteria 13610
412 Ga0265342_10064404 3300031712 Bacteria 2151
413 Ga0307516_10018058 3300031730 Bacteria 7338
414 Ga0307405_10100499 3300031731 Bacteria 1938
415 Ga0307405_10541310 3300031731 Bacteria 940
416 Ga0307413_10735315 3300031824 Bacteria 823
417 Ga0307413_11163037 3300031824 Bacteria 669
418 Ga0307410_10069663 3300031852 Bacteria 2434
419 Ga0307407_10702163 3300031903 Bacteria 762
420 Ga0307412_10036938 3300031911 Bacteria 3134
421 Ga0307412_10101480 3300031911 Bacteria 2036
422 Ga0307412_10164970 3300031911 Bacteria 1651
423 Ga0307412_10211383 3300031911 Bacteria 1480
424 Ga0307412_10262918 3300031911 Bacteria 1346
425 Ga0307412_11487217 3300031911 Bacteria 615
426 Ga0307409_100003240 3300031995 Bacteria 8775
427 Ga0307416_100137401 3300032002 Bacteria 2214
428 Ga0307416_100263104 3300032002 Bacteria 1687
429 Ga0307416_100497282 3300032002 Bacteria 1283
430 Ga0307414_10010665 3300032004 Bacteria 5347
431 Ga0307414_10390534 3300032004 Bacteria 1206
432 Ga0307414_11050451 3300032004 Bacteria 751
433 Ga0373958_0019893 3300034819 Unclassified 1231
434 Ga0373949_0009470 3300035090 Bacteria 2134
435 Ga0373951_0085048 3300035091 Unclassified 823
436 Ga0373932_0013561 3300035112 Bacteria 2031
437 Ga0373936_0057185 3300035113 Bacteria 1586
438 Ga0373960_0110439 3300035121 Unclassified 901
439 Ga0373955_0262999 3300035172 Bacteria 1036
440 Ga0373962_0023463 3300035242 Bacteria 1643
441 Ga0373931_0000751 3300035691 Bacteria 13545
442 Ga0373931_0439959 3300035691 Bacteria 832
443 Ga0395905_0038725 3300037471 Bacteria 4472
444 Ga0395905_0507613 3300037471 Bacteria 1106
445 Ga0395901_1294051 3300038443 Bacteria 691
446 Ga0436363_0022589 3300039450 Bacteria 749
447 Ga0439436_0032533 3300041404 Bacteria 1512
448 Ga0439439_0010182 3300041406 Bacteria 2246
449 Ga0439447_047573 3300041407 Bacteria 1030
450 Ga0439466_0087474 3300041411 Bacteria 979
451 Ga0439465_0198302 3300041413 Bacteria 731
452 Ga0451791_0373605 3300041451 Bacteria 942
453 Ga0451793_0612856 3300041452 Bacteria 1740
454 Ga0451797_1533881 3300041453 Bacteria 1229
455 Ga0451807_0569212 3300041486 Bacteria 841
456 Ga0451807_1298242 3300041486 Bacteria 1577
457 Ga0451807_1494639 3300041486 Bacteria 3566
458 Ga0451807_2154701 3300041486 Bacteria 1710
459 Ga0451833_0202489 3300041491 Bacteria 1434
460 Ga0451833_1346353 3300041491 Bacteria 2908
461 Ga0451837_0937937 3300041494 Bacteria 1150
462 Ga0451839_0661452 3300041496 Bacteria 852
463 Ga0451841_0961435 3300041498 Bacteria 3396
464 Ga0451845_0394193 3300041501 Bacteria 1616
465 Ga0451851_0805390 3300041507 Bacteria 746
466 Ga0451843_0549395 3300041509 Bacteria 1612
467 Ga0451843_0995758 3300041509 Unclassified 3174
468 Ga0451853_1991779 3300041512 Bacteria 3731
469 Ga0439433_0025210 3300041999 Bacteria 1342
470 Ga0439445_0009847 3300042004 Bacteria 2256
471 Ga0439432_034037 3300042006 Bacteria 1637
472 Ga0439452_019969 3300042010 Bacteria 1763
473 Ga0439462_0004131 3300042015 Bacteria 3527
474 Ga0439462_0004645 3300042015 Bacteria 3358
475 Ga0450911_000121 3300042115 Bacteria 31301
476 Ga0450898_047755 3300042134 Bacteria 822
477 Ga0439446_0078470 3300042156 Bacteria 1019
478 Ga0450909_018858 3300042185 Bacteria 1026
479 Ga0439464_0005973 3300042439 Bacteria 3165
480 Ga0451577_0118620 3300042876 Bacteria 2370
481 Ga0451577_0188749 3300042876 Bacteria 1859
482 Ga0451577_0227421 3300042876 Bacteria 1687
483 Ga0466969_0000177 3300044656 Bacteria 34210
484 Ga0466969_0005025 3300044656 Bacteria 7038
485 Ga0466973_0041228 3300044659 Bacteria 4347
486 Ga0466965_0001523 3300044683 Bacteria 9405
487 Ga0466965_0016395 3300044683 Bacteria 3525
488 Ga0466966_0005905 3300044684 Bacteria 8077
489 Ga0466961_0003013 3300044693 Bacteria 10444
490 Ga0466961_0463443 3300044693 Bacteria 766
491 Ga0466963_0003797 3300044694 Bacteria 8705
492 Ga0466964_0004537 3300044706 Bacteria 5129
493 Ga0453684_0000386 3300044712 Bacteria 180948
494 Ga0453684_0104545 3300044712 Bacteria 3456
495 Ga0453684_0453429 3300044712 Bacteria 1427
496 Ga0466971_0005166 3300044719 Bacteria 5649
497 Ga0466968_0045588 3300044735 Bacteria 1861
498 Ga0466970_0020423 3300044765 Bacteria 3441
499 Ga0466970_0024892 3300044765 Bacteria 3131
500 Ga0466957_0000706 3300044842 Bacteria 17082
501 Ga0466957_0030827 3300044842 Bacteria 3202
502 Ga0466959_0036671 3300045049 Bacteria 3622
503 Ga0466959_0071640 3300045049 Bacteria 2509
504 Ga0466958_0028478 3300045836 Bacteria 3312
505 Ga0466958_0444143 3300045836 Bacteria 839
506 Ga0466967_0109733 3300045976 Bacteria 2533
507 Ga0466967_0510581 3300045976 Bacteria 1180
508 Ga0495629_0392544 3300046459 Bacteria 944
509 Ga0495629_0444459 3300046459 Bacteria 878
510 Ga0495638_0394567 3300046460 Bacteria 719
511 Ga0495639_0001341 3300046475 Bacteria 11053
512 Ga0495585_0011075 3300046492 Bacteria 5354
513 Ga0495596_0000226 3300046500 Bacteria 38225
514 Ga0495607_0029361 3300046501 Bacteria 3384
515 Ga0495583_0011007 3300046506 Bacteria 5217
516 Ga0495583_0103007 3300046506 Bacteria 1217
517 Ga0495632_0110887 3300046519 Bacteria 1288
518 Ga0495643_0000080 3300046522 Bacteria 161872
519 Ga0495643_0008118 3300046522 Bacteria 6685
520 Ga0495643_0298446 3300046522 Bacteria 735
521 Ga0495642_0116254 3300046528 Bacteria 1146
522 Ga0495609_0006369 3300046538 Bacteria 6024
523 Ga0495597_0004256 3300046542 Bacteria 7917
524 Ga0495645_0331592 3300046543 Bacteria 985
525 Ga0495656_0000209 3300046615 Bacteria 20972
526 Ga0495656_0300890 3300046615 Bacteria 822
527 Ga0495668_0079721 3300046616 Bacteria 1797
528 Ga0495611_0180948 3300046648 Bacteria 985
529 Ga0495588_0024320 3300046674 Bacteria 3008
530 Ga0495657_0502068 3300046675 Bacteria 707
531 Ga0495599_0503703 3300046678 Bacteria 712
532 Ga0495599_0619170 3300046678 Bacteria 629
533 Ga0495670_0026417 3300046691 Bacteria 2874
534 Ga0495670_0242765 3300046691 Bacteria 959
535 Ga0495671_0033080 3300046692 Bacteria 2636
536 Ga0495671_0066158 3300046692 Bacteria 1779
537 Ga0495649_0118359 3300046694 Bacteria 1402
538 Ga0495636_0054414 3300047318 Bacteria 1682
539 Ga0495676_0036994 3300047321 Bacteria 4069
540 Ga0495687_000128 3300047443 Bacteria 116626
541 Ga0495677_0157552 3300047445 Bacteria 875
542 Ga0495673_0182189 3300047469 Bacteria 795
543 Ga0495681_0070693 3300047470 Bacteria 1582
544 Ga0495593_0135857 3300047673 Bacteria 1247
545 Ga0495626_0070790 3300048091 Bacteria 1568
546 Ga0496101_0000958 3300048904 Bacteria 17056
547 Ga0496101_0423793 3300048904 Bacteria 1049
548 Ga0496101_0976634 3300048904 Bacteria 666
549 Ga0496102_0002816 3300048905 Bacteria 14813
550 Ga0496102_0009559 3300048905 Bacteria 8340
551 Ga0496102_0014592 3300048905 Bacteria 6828
552 Ga0496102_0492320 3300048905 Bacteria 1148
553 Ga0496102_0870987 3300048905 Bacteria 823
554 Ga0496103_0213946 3300048906 Bacteria 1239
555 Ga0496104_0000688 3300048907 Bacteria 29108
556 Ga0496104_0209342 3300048907 Bacteria 1862
557 Ga0496104_0269814 3300048907 Bacteria 1614
558 Ga0496105_0005944 3300048908 Bacteria 9312
559 Ga0496105_0124317 3300048908 Bacteria 2127
560 Ga0496105_0371651 3300048908 Bacteria 1139
561 Ga0496106_0002769 3300048909 Bacteria 12994
562 Ga0496106_0067516 3300048909 Bacteria 2726
563 Ga0496107_0027449 3300048910 Bacteria 4042
564 Ga0496107_0177045 3300048910 Bacteria 1584
565 Ga0496108_0044917 3300048911 Bacteria 3689
566 Ga0496109_0030792 3300048912 Bacteria 4810
567 Ga0496109_0089162 3300048912 Bacteria 2851
568 Ga0496109_0138057 3300048912 Bacteria 2279
569 Ga0496109_0185917 3300048912 Bacteria 1952
570 Ga0496110_0058288 3300048913 Bacteria 3401
571 Ga0496110_0269330 3300048913 Bacteria 1551
572 Ga0496110_0372599 3300048913 Bacteria 1301
573 Ga0496113_0155268 3300048916 Bacteria 1807
574 Ga0496114_0078913 3300048917 Bacteria 2778
575 Ga0496114_0088470 3300048917 Bacteria 2627
576 Ga0496117_0018952 3300048920 Bacteria 5673
577 Ga0496117_0191115 3300048920 Bacteria 1166
578 Ga0496118_0049833 3300048921 Bacteria 3220
579 Ga0496121_0005075 3300048924 Bacteria 17179
580 Ga0496121_0045777 3300048924 Bacteria 3756
581 Ga0496124_0101737 3300048927 Bacteria 2327
582 Ga0496124_0487440 3300048927 Bacteria 830
583 Ga0496125_0004501 3300048928 Bacteria 16030
584 Ga0496125_0010645 3300048928 Bacteria 9286
585 Ga0496125_0014401 3300048928 Bacteria 7704
586 Ga0496126_0302190 3300048929 Bacteria 1320
587 Ga0496126_0357361 3300048929 Bacteria 1194
588 Ga0501308_015991 3300049128 Bacteria 894
589 Ga0501034_0188716 3300049571 Bacteria 2024
590 Ga0501034_0345936 3300049571 Bacteria 1416
591 Ga0501034_0471650 3300049571 Bacteria 1171
592 Ga0501036_0234997 3300049572 Bacteria 1538
593 Ga0501036_0289434 3300049572 Bacteria 1371
594 Ga0501040_0564605 3300049576 Bacteria 822
595 Ga0501041_0323891 3300049577 Bacteria 972
596 Ga0501042_0259462 3300049578 Bacteria 1254
597 Ga0501043_0186685 3300049579 Bacteria 1614
598 Ga0501046_0130424 3300049580 Bacteria 1907
599 Ga0501047_0454556 3300049581 Bacteria 1110
600 Ga0501048_0142758 3300049582 Bacteria 1693
601 Ga0501070_0232774 3300049586 Bacteria 1509
602 Ga0501071_0252747 3300049587 Bacteria 1331
603 Ga0501071_0276502 3300049587 Bacteria 1270
604 Ga0501074_0117790 3300049590 Bacteria 1900
605 Ga0501074_0361204 3300049590 Bacteria 1030
606 Ga0501075_0058604 3300049591 Bacteria 2901
607 Ga0501077_0091526 3300049593 Bacteria 1927
608 Ga0501077_0277856 3300049593 Bacteria 1066
609 Ga0501079_0036430 3300049741 Bacteria 3790
610 Ga0501079_0167106 3300049741 Bacteria 1716
611 Ga0501083_0312731 3300049744 Bacteria 1022
612 Ga0501035_0068916 3300049822 Bacteria 3136
613 Ga0501035_0790191 3300049822 Bacteria 759
614 Ga0501044_0082733 3300049823 Bacteria 3247
615 Ga0501044_0109666 3300049823 Bacteria 2769
616 Ga0501044_0334543 3300049823 Bacteria 1436
617 Ga0501045_0287247 3300049824 Bacteria 1224
618 nmdc:mga03683_148240_c1 3300050489 Bacteria 1058
619 nmdc:mga03683_153569_c1 3300050489 Bacteria 1040
620 nmdc:mga03n38_386301_c1 3300050490 Bacteria 768
621 nmdc:mga0yw44_136428_c1 3300050492 Bacteria 1592
622 nmdc:mga0yw44_272037_c1 3300050492 Bacteria 1131
623 nmdc:mga0k408_34186_c1 3300050493 Bacteria 2910
624 nmdc:mga0k408_49986_c1 3300050493 Bacteria 2420
625 nmdc:mga0k408_5220_c1 3300050493 Bacteria 3266
626 nmdc:mga0k408_58645_c1 3300050493 Bacteria 2236
627 nmdc:mga0k408_89092_c1 3300050493 Bacteria 1812
628 nmdc:mga04h51_109530_c1 3300050495 Bacteria 1016
629 nmdc:mga04h51_22089_c1 3300050495 Bacteria 1404
630 nmdc:mga07m45_355052_c1 3300050496 Bacteria 852
631 nmdc:mga07m45_5412_c1 3300050496 Bacteria 6350
632 nmdc:mga05p37_423790_c1 3300050507 Bacteria 1548
633 nmdc:mga09592_166675_c1 3300050508 Bacteria 1904
634 nmdc:mga0qj67_362379_c1 3300050509 Bacteria 1171
635 nmdc:mga06r32_209636_c1 3300050510 Bacteria 1936
636 nmdc:mga06r32_875546_c1 3300050510 Bacteria 856
637 nmdc:mga08y16_1293335_c1 3300050511 Bacteria 696
638 nmdc:mga08y16_177827_c1 3300050511 Bacteria 2210
639 nmdc:mga08y16_296372_c1 3300050511 Bacteria 1667
640 nmdc:mga0n895_114187_c1 3300050512 Bacteria 2719
641 nmdc:mga0a205_113760_c1 3300050515 Bacteria 2605
642 Ga0500562_008842 3300053108 Bacteria 2543
643 Ga0500593_001263 3300053117 Bacteria 9151
644 Ga0500594_0193636 3300053118 Bacteria 666
645 Ga0500618_035321 3300053125 Bacteria 1161
646 Ga0500652_000673 3300053131 Bacteria 11601
647 Ga0500559_0003620 3300053136 Bacteria 7556
648 Ga0500559_0011876 3300053136 Bacteria 3712
649 Ga0500616_0021040 3300053153 Bacteria 3662
650 Ga0500645_005416 3300053730 Bacteria 4704
651 Ga0501084_0107458 3300054114 Bacteria 2344
652 Ga0501082_0050362 3300060353 Bacteria 3592
653 Ga0501082_0281564 3300060353 Bacteria 1447
654 Ga0466962_0074084 3300061719 Bacteria 1627
655 Ga0530510_0316182 3300061734 Bacteria 1170

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003794 Ga0055531_10001259 Ga0055531_1000125912 173
2 3300025303 Ga0209051_1000254 Ga0209051_100025457 173
3 3300025304 Ga0209257_1000012 Ga0209257_1000012683 173
4 3300025304 Ga0209257_1000045 Ga0209257_100004589 173
5 3300025304 Ga0209257_1000137 Ga0209257_100013767 173
6 3300031911 Ga0307412_10164970 Ga0307412_101649701 174
7 3300032002 Ga0307416_100497282 Ga0307416_1004972821 174
8 3300035113 Ga0373936_0057185 Ga0373936_0057185_590_1177 176
9 3300006178 Ga0075367_10097913 Ga0075367_100979133 177
10 3300006847 Ga0075431_100228668 Ga0075431_1002286682 177
11 3300006852 Ga0075433_10292612 Ga0075433_102926122 177
12 3300009094 Ga0111539_10319637 Ga0111539_103196372 177
13 3300009147 Ga0114129_11077473 Ga0114129_110774732 177
14 3300014969 Ga0157376_10277736 Ga0157376_102777362 177
15 3300027907 Ga0207428_10145559 Ga0207428_101455593 177
16 3300034819 Ga0373958_0019893 Ga0373958_0019893_562_1104 177
17 3300035090 Ga0373949_0009470 Ga0373949_0009470_1038_1580 177
18 3300035091 Ga0373951_0085048 Ga0373951_0085048_41_583 177
19 3300035121 Ga0373960_0110439 Ga0373960_0110439_206_748 177
20 3300035242 Ga0373962_0023463 Ga0373962_0023463_423_965 177
21 3300035691 Ga0373931_0000751 Ga0373931_0000751_2139_2681 177
22 3300046694 Ga0495649_0118359 Ga0495649_0118359_816_1364 177
23 3300050510 nmdc:mga06r32_209636_c1 nmdc:mga06r32_209636_c1_677_1243 177
24 3300050512 nmdc:mga0n895_114187_c1 nmdc:mga0n895_114187_c1_14_580 177
25 3300050515 nmdc:mga0a205_113760_c1 nmdc:mga0a205_113760_c1_1681_2247 177
26 iso_pu_bacteria 2974320154 2974323229 177
27 3300005355 Ga0070671_100176145 Ga0070671_1001761452 178
28 3300005364 Ga0070673_100005707 Ga0070673_1000057073 178
29 3300005367 Ga0070667_100000126 Ga0070667_10000012632 178
30 3300005563 Ga0068855_100828720 Ga0068855_1008287202 178
31 3300005843 Ga0068860_100113479 Ga0068860_1001134793 178
32 3300014326 Ga0157380_11486310 Ga0157380_114863101 178
33 3300025909 Ga0207705_10032130 Ga0207705_100321302 178
34 3300025931 Ga0207644_10020849 Ga0207644_100208492 178
35 3300025949 Ga0207667_10576672 Ga0207667_105766722 178
36 3300025960 Ga0207651_10137005 Ga0207651_101370052 178
37 3300025986 Ga0207658_10002969 Ga0207658_100029698 178
38 3300028381 Ga0268264_10091898 Ga0268264_100918983 178
39 3300041491 Ga0451833_0202489 Ga0451833_0202489_558_1109 178
40 3300046492 Ga0495585_0011075 Ga0495585_0011075_1328_1879 178
41 3300046500 Ga0495596_0000226 Ga0495596_0000226_36969_37520 178
42 3300046501 Ga0495607_0029361 Ga0495607_0029361_504_1055 178
43 3300046506 Ga0495583_0011007 Ga0495583_0011007_3218_3769 178
44 3300046506 Ga0495583_0103007 Ga0495583_0103007_538_1089 178
45 3300046519 Ga0495632_0110887 Ga0495632_0110887_674_1225 178
46 3300046522 Ga0495643_0000080 Ga0495643_0000080_114431_114979 178
47 3300046522 Ga0495643_0008118 Ga0495643_0008118_3343_3894 178
48 3300046538 Ga0495609_0006369 Ga0495609_0006369_4909_5460 178
49 3300046616 Ga0495668_0079721 Ga0495668_0079721_673_1224 178
50 3300046692 Ga0495671_0066158 Ga0495671_0066158_288_839 178
51 3300047469 Ga0495673_0182189 Ga0495673_0182189_61_612 178
52 3300047470 Ga0495681_0070693 Ga0495681_0070693_781_1332 178
53 3300002987 JGI25159J45721_1028197 JGI25159J45721_10281972 179
54 3300003187 JGI25151J46595_10007367 JGI25151J46595_100073672 179
55 3300003323 rootH1_10053255 rootH1_100532554 179
56 3300003577 Ga0007416J51690_1045190 Ga0007416J51690_10451902 179
57 3300003759 Ga0055525_1000046 Ga0055525_1000046207 179
58 3300003781 Ga0055536_1038771 Ga0055536_10387712 179
59 3300003784 Ga0055534_1000830 Ga0055534_10008305 179
60 3300003794 Ga0055531_10060115 Ga0055531_100601152 179
61 3300005288 Ga0065714_10158578 Ga0065714_101585782 179
62 3300005290 Ga0065712_10488927 Ga0065712_104889271 179
63 3300005293 Ga0065715_10246939 Ga0065715_102469392 179
64 3300005327 Ga0070658_10036341 Ga0070658_100363412 179
65 3300005327 Ga0070658_10163156 Ga0070658_101631562 179
66 3300005328 Ga0070676_10058519 Ga0070676_100585192 179
67 3300005333 Ga0070677_10003364 Ga0070677_100033642 179
68 3300005334 Ga0068869_100014018 Ga0068869_1000140186 179
69 3300005336 Ga0070680_100020142 Ga0070680_1000201421 179
70 3300005338 Ga0068868_100128778 Ga0068868_1001287782 179
71 3300005338 Ga0068868_100613629 Ga0068868_1006136291 179
72 3300005341 Ga0070691_10010717 Ga0070691_100107173 179
73 3300005343 Ga0070687_100081552 Ga0070687_1000815522 179
74 3300005344 Ga0070661_100150208 Ga0070661_1001502082 179
75 3300005345 Ga0070692_10045832 Ga0070692_100458323 179
76 3300005354 Ga0070675_100007299 Ga0070675_1000072993 179
77 3300005354 Ga0070675_100055685 Ga0070675_1000556853 179
78 3300005355 Ga0070671_100354747 Ga0070671_1003547472 179
79 3300005356 Ga0070674_100019397 Ga0070674_1000193973 179
80 3300005356 Ga0070674_100396412 Ga0070674_1003964122 179
81 3300005364 Ga0070673_100053999 Ga0070673_1000539994 179
82 3300005364 Ga0070673_100172184 Ga0070673_1001721842 179
83 3300005365 Ga0070688_100567641 Ga0070688_1005676411 179
84 3300005366 Ga0070659_100542326 Ga0070659_1005423262 179
85 3300005367 Ga0070667_100017882 Ga0070667_1000178827 179
86 3300005367 Ga0070667_100066632 Ga0070667_1000666321 179
87 3300005406 Ga0070703_10002365 Ga0070703_100023653 179
88 3300005436 Ga0070713_100415619 Ga0070713_1004156191 179
89 3300005438 Ga0070701_10013275 Ga0070701_100132753 179
90 3300005438 Ga0070701_10013492 Ga0070701_100134921 179
91 3300005440 Ga0070705_100000901 Ga0070705_1000009018 179
92 3300005441 Ga0070700_100001924 Ga0070700_1000019246 179
93 3300005444 Ga0070694_100001405 Ga0070694_1000014058 179
94 3300005445 Ga0070708_100016481 Ga0070708_1000164813 179
95 3300005455 Ga0070663_100135786 Ga0070663_1001357862 179
96 3300005455 Ga0070663_100489168 Ga0070663_1004891681 179
97 3300005456 Ga0070678_100155685 Ga0070678_1001556853 179
98 3300005456 Ga0070678_100170557 Ga0070678_1001705571 179
99 3300005456 Ga0070678_100283762 Ga0070678_1002837623 179
100 3300005457 Ga0070662_100004214 Ga0070662_1000042149 179
101 3300005457 Ga0070662_100405133 Ga0070662_1004051332 179
102 3300005458 Ga0070681_10134315 Ga0070681_101343152 179
103 3300005458 Ga0070681_10657371 Ga0070681_106573712 179
104 3300005459 Ga0068867_100006945 Ga0068867_1000069452 179
105 3300005459 Ga0068867_100327498 Ga0068867_1003274982 179
106 3300005466 Ga0070685_10782778 Ga0070685_107827781 179
107 3300005467 Ga0070706_100029463 Ga0070706_1000294636 179
108 3300005471 Ga0070698_100017908 Ga0070698_1000179088 179
109 3300005518 Ga0070699_100015194 Ga0070699_1000151943 179
110 3300005530 Ga0070679_100241151 Ga0070679_1002411511 179
111 3300005530 Ga0070679_100388884 Ga0070679_1003888841 179
112 3300005530 Ga0070679_100414668 Ga0070679_1004146681 179
113 3300005536 Ga0070697_100009532 Ga0070697_1000095323 179
114 3300005543 Ga0070672_100097790 Ga0070672_1000977903 179
115 3300005543 Ga0070672_100117463 Ga0070672_1001174632 179
116 3300005545 Ga0070695_100000158 Ga0070695_10000015833 179
117 3300005546 Ga0070696_100004561 Ga0070696_1000045612 179
118 3300005547 Ga0070693_100022136 Ga0070693_1000221363 179
119 3300005548 Ga0070665_100011192 Ga0070665_1000111923 179
120 3300005548 Ga0070665_100088712 Ga0070665_1000887122 179
121 3300005548 Ga0070665_100805428 Ga0070665_1008054282 179
122 3300005549 Ga0070704_100008256 Ga0070704_1000082568 179
123 3300005549 Ga0070704_100059348 Ga0070704_1000593483 179
124 3300005563 Ga0068855_100029598 Ga0068855_1000295985 179
125 3300005563 Ga0068855_100086706 Ga0068855_1000867063 179
126 3300005564 Ga0070664_100041366 Ga0070664_1000413664 179
127 3300005564 Ga0070664_101256036 Ga0070664_1012560361 179
128 3300005577 Ga0068857_100009560 Ga0068857_1000095608 179
129 3300005578 Ga0068854_100112572 Ga0068854_1001125722 179
130 3300005578 Ga0068854_100565227 Ga0068854_1005652272 179
131 3300005615 Ga0070702_100621617 Ga0070702_1006216171 179
132 3300005616 Ga0068852_100385929 Ga0068852_1003859292 179
133 3300005616 Ga0068852_100665084 Ga0068852_1006650842 179
134 3300005617 Ga0068859_100003502 Ga0068859_1000035029 179
135 3300005617 Ga0068859_100573091 Ga0068859_1005730913 179
136 3300005618 Ga0068864_100014556 Ga0068864_1000145562 179
137 3300005618 Ga0068864_100025178 Ga0068864_1000251783 179
138 3300005618 Ga0068864_100379845 Ga0068864_1003798453 179
139 3300005718 Ga0068866_10089975 Ga0068866_100899752 179
140 3300005718 Ga0068866_10391779 Ga0068866_103917791 179
141 3300005719 Ga0068861_100042905 Ga0068861_1000429052 179
142 3300005719 Ga0068861_100194215 Ga0068861_1001942152 179
143 3300005719 Ga0068861_100414923 Ga0068861_1004149231 179
144 3300005840 Ga0068870_10009503 Ga0068870_100095035 179
145 3300005840 Ga0068870_10018925 Ga0068870_100189253 179
146 3300005841 Ga0068863_100794612 Ga0068863_1007946122 179
147 3300005842 Ga0068858_100054191 Ga0068858_1000541913 179
148 3300005843 Ga0068860_100001841 Ga0068860_10000184111 179
149 3300005844 Ga0068862_100002731 Ga0068862_1000027319 179
150 3300005844 Ga0068862_100043810 Ga0068862_1000438103 179
151 3300006042 Ga0075368_10047295 Ga0075368_100472952 179
152 3300006048 Ga0075363_100110546 Ga0075363_1001105463 179
153 3300006048 Ga0075363_100192940 Ga0075363_1001929402 179
154 3300006051 Ga0075364_10068103 Ga0075364_100681033 179
155 3300006173 Ga0070716_100123171 Ga0070716_1001231712 179
156 3300006173 Ga0070716_100245128 Ga0070716_1002451282 179
157 3300006177 Ga0075362_10198653 Ga0075362_101986531 179
158 3300006178 Ga0075367_10244352 Ga0075367_102443522 179
159 3300006195 Ga0075366_10000371 Ga0075366_100003713 179
160 3300006195 Ga0075366_10014438 Ga0075366_100144384 179
161 3300006195 Ga0075366_10015834 Ga0075366_100158343 179
162 3300006195 Ga0075366_10048208 Ga0075366_100482083 179
163 3300006237 Ga0097621_100031472 Ga0097621_1000314726 179
164 3300006237 Ga0097621_100073271 Ga0097621_1000732713 179
165 3300006237 Ga0097621_100086234 Ga0097621_1000862342 179
166 3300006237 Ga0097621_100204124 Ga0097621_1002041243 179
167 3300006353 Ga0075370_10009692 Ga0075370_100096924 179
168 3300006353 Ga0075370_10040097 Ga0075370_100400973 179
169 3300006353 Ga0075370_10169388 Ga0075370_101693882 179
170 3300006353 Ga0075370_10397692 Ga0075370_103976921 179
171 3300006358 Ga0068871_100027904 Ga0068871_1000279046 179
172 3300006358 Ga0068871_100185732 Ga0068871_1001857322 179
173 3300006358 Ga0068871_100330282 Ga0068871_1003302821 179
174 3300006358 Ga0068871_100796591 Ga0068871_1007965911 179
175 3300006846 Ga0075430_100074103 Ga0075430_1000741032 179
176 3300006880 Ga0075429_100386532 Ga0075429_1003865322 179
177 3300006881 Ga0068865_100157758 Ga0068865_1001577583 179
178 3300006881 Ga0068865_100384230 Ga0068865_1003842302 179
179 3300006931 Ga0097620_100003500 Ga0097620_1000035009 179
180 3300006931 Ga0097620_100573063 Ga0097620_1005730633 179
181 3300006948 Ga0099826_10100537 Ga0099826_101005373 179
182 3300007788 Ga0099795_10022813 Ga0099795_100228133 179
183 3300009036 Ga0105244_10006285 Ga0105244_100062855 179
184 3300009093 Ga0105240_10002809 Ga0105240_1000280925 179
185 3300009093 Ga0105240_10264560 Ga0105240_102645602 179
186 3300009093 Ga0105240_10315421 Ga0105240_103154212 179
187 3300009093 Ga0105240_10422603 Ga0105240_104226032 179
188 3300009093 Ga0105240_10829872 Ga0105240_108298722 179
189 3300009094 Ga0111539_10007314 Ga0111539_100073147 179
190 3300009094 Ga0111539_10346507 Ga0111539_103465072 179
191 3300009094 Ga0111539_10382640 Ga0111539_103826402 179
192 3300009098 Ga0105245_10227463 Ga0105245_102274632 179
193 3300009101 Ga0105247_10630404 Ga0105247_106304041 179
194 3300009147 Ga0114129_11537441 Ga0114129_115374412 179
195 3300009148 Ga0105243_10014281 Ga0105243_100142813 179
196 3300009148 Ga0105243_10020340 Ga0105243_100203403 179
197 3300009148 Ga0105243_11599670 Ga0105243_115996701 179
198 3300009174 Ga0105241_10279185 Ga0105241_102791851 179
199 3300009174 Ga0105241_11588154 Ga0105241_115881541 179
200 3300009176 Ga0105242_10135094 Ga0105242_101350942 179
201 3300009176 Ga0105242_10457450 Ga0105242_104574501 179
202 3300009176 Ga0105242_10475924 Ga0105242_104759242 179
203 3300009176 Ga0105242_11013213 Ga0105242_110132131 179
204 3300009177 Ga0105248_10097185 Ga0105248_100971852 179
205 3300009545 Ga0105237_10006964 Ga0105237_100069647 179
206 3300009545 Ga0105237_10122282 Ga0105237_101222822 179
207 3300009545 Ga0105237_10255533 Ga0105237_102555331 179
208 3300009551 Ga0105238_10218757 Ga0105238_102187572 179
209 3300009551 Ga0105238_10277921 Ga0105238_102779212 179
210 3300009551 Ga0105238_10452207 Ga0105238_104522072 179
211 3300009551 Ga0105238_10785937 Ga0105238_107859371 179
212 3300009553 Ga0105249_10046892 Ga0105249_100468926 179
213 3300009553 Ga0105249_10184246 Ga0105249_101842462 179
214 3300010159 Ga0099796_10009871 Ga0099796_100098713 179
215 3300010375 Ga0105239_10001353 Ga0105239_1000135323 179
216 3300010375 Ga0105239_10206651 Ga0105239_102066513 179
217 3300010375 Ga0105239_10494175 Ga0105239_104941752 179
218 3300011119 Ga0105246_10019026 Ga0105246_100190262 179
219 3300011119 Ga0105246_10097776 Ga0105246_100977763 179
220 3300013100 Ga0157373_10178389 Ga0157373_101783892 179
221 3300013104 Ga0157370_10034191 Ga0157370_100341914 179
222 3300013104 Ga0157370_10034844 Ga0157370_100348446 179
223 3300013104 Ga0157370_10157913 Ga0157370_101579132 179
224 3300013104 Ga0157370_10788032 Ga0157370_107880322 179
225 3300013104 Ga0157370_11352092 Ga0157370_113520921 179
226 3300013297 Ga0157378_10075339 Ga0157378_100753394 179
227 3300013306 Ga0163162_10204769 Ga0163162_102047692 179
228 3300013306 Ga0163162_10207189 Ga0163162_102071892 179
229 3300013308 Ga0157375_10005559 Ga0157375_100055599 179
230 3300013308 Ga0157375_10664819 Ga0157375_106648192 179
231 3300013308 Ga0157375_11238975 Ga0157375_112389752 179
232 3300014325 Ga0163163_10087001 Ga0163163_100870012 179
233 3300014325 Ga0163163_10270276 Ga0163163_102702762 179
234 3300014326 Ga0157380_10017946 Ga0157380_100179465 179
235 3300014326 Ga0157380_10039990 Ga0157380_100399903 179
236 3300014326 Ga0157380_10043724 Ga0157380_100437242 179
237 3300014326 Ga0157380_10081240 Ga0157380_100812402 179
238 3300014326 Ga0157380_10091942 Ga0157380_100919423 179
239 3300014326 Ga0157380_10492242 Ga0157380_104922422 179
240 3300014497 Ga0182008_10000190 Ga0182008_1000019028 179
241 3300014497 Ga0182008_10001821 Ga0182008_100018213 179
242 3300014497 Ga0182008_10012122 Ga0182008_100121226 179
243 3300014497 Ga0182008_10055900 Ga0182008_100559002 179
244 3300014745 Ga0157377_10158844 Ga0157377_101588442 179
245 3300014969 Ga0157376_10104459 Ga0157376_101044592 179
246 3300014969 Ga0157376_10529909 Ga0157376_105299091 179
247 3300014969 Ga0157376_10571101 Ga0157376_105711012 179
248 3300014969 Ga0157376_10848076 Ga0157376_108480761 179
249 3300014969 Ga0157376_10935923 Ga0157376_109359232 179
250 3300015261 Ga0182006_1001217 Ga0182006_100121715 179
251 3300015262 Ga0182007_10000916 Ga0182007_100009167 179
252 3300015262 Ga0182007_10001403 Ga0182007_100014039 179
253 3300015265 Ga0182005_1021950 Ga0182005_10219502 179
254 3300017792 Ga0163161_10000092 Ga0163161_1000009269 179
255 3300017792 Ga0163161_10048563 Ga0163161_100485632 179
256 3300017792 Ga0163161_10048941 Ga0163161_100489413 179
257 3300017792 Ga0163161_10070504 Ga0163161_100705044 179
258 3300017792 Ga0163161_10087775 Ga0163161_100877753 179
259 3300017792 Ga0163161_10194495 Ga0163161_101944951 179
260 3300020070 Ga0206356_11249086 Ga0206356_112490861 179
261 3300025230 Ga0209563_100005 Ga0209563_100005944 179
262 3300025254 Ga0209148_1000501 Ga0209148_100050112 179
263 3300025271 Ga0207666_1033809 Ga0207666_10338091 179
264 3300025272 Ga0209455_1003800 Ga0209455_10038003 179
265 3300025273 Ga0209673_1041890 Ga0209673_10418902 179
266 3300025284 Ga0209130_1004992 Ga0209130_10049925 179
267 3300025291 Ga0209675_1004723 Ga0209675_10047237 179
268 3300025292 Ga0209676_1001468 Ga0209676_100146820 179
269 3300025292 Ga0209676_1025600 Ga0209676_10256002 179
270 3300025294 Ga0209025_1000073 Ga0209025_1000073132 179
271 3300025295 Ga0209564_1041276 Ga0209564_10412762 179
272 3300025303 Ga0209051_1020090 Ga0209051_10200902 179
273 3300025304 Ga0209257_1010252 Ga0209257_10102524 179
274 3300025728 Ga0207655_1010441 Ga0207655_10104415 179
275 3300025885 Ga0207653_10002878 Ga0207653_100028782 179
276 3300025893 Ga0207682_10002252 Ga0207682_100022528 179
277 3300025898 Ga0207692_10043374 Ga0207692_100433743 179
278 3300025899 Ga0207642_10102332 Ga0207642_101023322 179
279 3300025899 Ga0207642_10266882 Ga0207642_102668821 179
280 3300025901 Ga0207688_10254502 Ga0207688_102545021 179
281 3300025905 Ga0207685_10120601 Ga0207685_101206011 179
282 3300025907 Ga0207645_10166886 Ga0207645_101668862 179
283 3300025908 Ga0207643_10045292 Ga0207643_100452922 179
284 3300025908 Ga0207643_10124418 Ga0207643_101244182 179
285 3300025909 Ga0207705_10058067 Ga0207705_100580673 179
286 3300025911 Ga0207654_10230518 Ga0207654_102305181 179
287 3300025911 Ga0207654_10925928 Ga0207654_109259281 179
288 3300025912 Ga0207707_10152090 Ga0207707_101520901 179
289 3300025912 Ga0207707_11048495 Ga0207707_110484951 179
290 3300025913 Ga0207695_10005251 Ga0207695_100052513 179
291 3300025913 Ga0207695_10565174 Ga0207695_105651742 179
292 3300025914 Ga0207671_10001552 Ga0207671_1000155222 179
293 3300025914 Ga0207671_10545140 Ga0207671_105451401 179
294 3300025917 Ga0207660_10004296 Ga0207660_100042963 179
295 3300025918 Ga0207662_10100667 Ga0207662_101006671 179
296 3300025920 Ga0207649_10115897 Ga0207649_101158972 179
297 3300025921 Ga0207652_10322397 Ga0207652_103223971 179
298 3300025921 Ga0207652_10339037 Ga0207652_103390372 179
299 3300025924 Ga0207694_10102739 Ga0207694_101027392 179
300 3300025925 Ga0207650_10100860 Ga0207650_101008603 179
301 3300025926 Ga0207659_10010491 Ga0207659_100104913 179
302 3300025926 Ga0207659_10040540 Ga0207659_100405402 179
303 3300025931 Ga0207644_10051468 Ga0207644_100514684 179
304 3300025931 Ga0207644_10311665 Ga0207644_103116652 179
305 3300025931 Ga0207644_10801337 Ga0207644_108013372 179
306 3300025932 Ga0207690_10291234 Ga0207690_102912342 179
307 3300025933 Ga0207706_10015206 Ga0207706_100152063 179
308 3300025933 Ga0207706_10028972 Ga0207706_100289722 179
309 3300025934 Ga0207686_10306372 Ga0207686_103063722 179
310 3300025935 Ga0207709_10001793 Ga0207709_100017936 179
311 3300025935 Ga0207709_10051052 Ga0207709_100510524 179
312 3300025935 Ga0207709_10266285 Ga0207709_102662851 179
313 3300025936 Ga0207670_10095863 Ga0207670_100958632 179
314 3300025936 Ga0207670_10396956 Ga0207670_103969561 179
315 3300025937 Ga0207669_10017639 Ga0207669_100176393 179
316 3300025937 Ga0207669_10164764 Ga0207669_101647641 179
317 3300025938 Ga0207704_10206810 Ga0207704_102068103 179
318 3300025938 Ga0207704_10246637 Ga0207704_102466372 179
319 3300025938 Ga0207704_10525551 Ga0207704_105255512 179
320 3300025939 Ga0207665_10291509 Ga0207665_102915092 179
321 3300025940 Ga0207691_10005068 Ga0207691_100050688 179
322 3300025940 Ga0207691_10005116 Ga0207691_100051169 179
323 3300025940 Ga0207691_10019129 Ga0207691_100191298 179
324 3300025940 Ga0207691_10031346 Ga0207691_100313465 179
325 3300025940 Ga0207691_10167489 Ga0207691_101674892 179
326 3300025941 Ga0207711_10093072 Ga0207711_100930722 179
327 3300025942 Ga0207689_10113048 Ga0207689_101130482 179
328 3300025942 Ga0207689_10146016 Ga0207689_101460162 179
329 3300025945 Ga0207679_10260614 Ga0207679_102606142 179
330 3300025945 Ga0207679_11161028 Ga0207679_111610281 179
331 3300025949 Ga0207667_10038744 Ga0207667_100387446 179
332 3300025949 Ga0207667_10646545 Ga0207667_106465451 179
333 3300025960 Ga0207651_10101407 Ga0207651_101014073 179
334 3300025960 Ga0207651_10149439 Ga0207651_101494392 179
335 3300025960 Ga0207651_10477916 Ga0207651_104779161 179
336 3300025961 Ga0207712_10023018 Ga0207712_100230186 179
337 3300025972 Ga0207668_10553714 Ga0207668_105537141 179
338 3300025981 Ga0207640_10276794 Ga0207640_102767942 179
339 3300025981 Ga0207640_10464726 Ga0207640_104647261 179
340 3300025981 Ga0207640_10507485 Ga0207640_105074852 179
341 3300025986 Ga0207658_10079468 Ga0207658_100794684 179
342 3300025986 Ga0207658_10099340 Ga0207658_100993402 179
343 3300025986 Ga0207658_10690327 Ga0207658_106903272 179
344 3300026041 Ga0207639_10089228 Ga0207639_100892282 179
345 3300026041 Ga0207639_10602943 Ga0207639_106029432 179
346 3300026067 Ga0207678_10043388 Ga0207678_100433883 179
347 3300026067 Ga0207678_10044918 Ga0207678_100449182 179
348 3300026067 Ga0207678_10312314 Ga0207678_103123142 179
349 3300026067 Ga0207678_10720167 Ga0207678_107201672 179
350 3300026075 Ga0207708_10001399 Ga0207708_100013999 179
351 3300026075 Ga0207708_11189846 Ga0207708_111898462 179
352 3300026088 Ga0207641_10262314 Ga0207641_102623143 179
353 3300026089 Ga0207648_10009613 Ga0207648_100096138 179
354 3300026089 Ga0207648_10015126 Ga0207648_100151266 179
355 3300026095 Ga0207676_10003912 Ga0207676_100039126 179
356 3300026095 Ga0207676_10122475 Ga0207676_101224754 179
357 3300026095 Ga0207676_10442844 Ga0207676_104428442 179
358 3300026116 Ga0207674_10001143 Ga0207674_100011432 179
359 3300026118 Ga0207675_100020669 Ga0207675_1000206693 179
360 3300026118 Ga0207675_100041267 Ga0207675_1000412675 179
361 3300026118 Ga0207675_100237744 Ga0207675_1002377442 179
362 3300026121 Ga0207683_10012443 Ga0207683_100124435 179
363 3300026121 Ga0207683_10049675 Ga0207683_100496753 179
364 3300026121 Ga0207683_10207785 Ga0207683_102077851 179
365 3300026121 Ga0207683_10359743 Ga0207683_103597432 179
366 3300026142 Ga0207698_10365826 Ga0207698_103658262 179
367 3300026142 Ga0207698_10469407 Ga0207698_104694071 179
368 3300026142 Ga0207698_11126418 Ga0207698_111264181 179
369 3300027512 Ga0209179_1014804 Ga0209179_10148041 179
370 3300027682 Ga0209971_1008275 Ga0209971_10082752 179
371 3300027866 Ga0209813_10045836 Ga0209813_100458361 179
372 3300028379 Ga0268266_10014965 Ga0268266_100149656 179
373 3300028379 Ga0268266_10051532 Ga0268266_100515324 179
374 3300028379 Ga0268266_10087997 Ga0268266_100879972 179
375 3300028379 Ga0268266_10229649 Ga0268266_102296492 179
376 3300028379 Ga0268266_10645387 Ga0268266_106453871 179
377 3300028380 Ga0268265_10000626 Ga0268265_1000062635 179
378 3300028380 Ga0268265_10701674 Ga0268265_107016741 179
379 3300028381 Ga0268264_10003320 Ga0268264_100033207 179
380 3300028573 Ga0265334_10000420 Ga0265334_1000042023 179
381 3300028666 Ga0265336_10000405 Ga0265336_1000040521 179
382 3300028794 Ga0307515_10000137 Ga0307515_10000137109 179
383 3300028794 Ga0307515_10000267 Ga0307515_1000026716 179
384 3300028794 Ga0307515_10217636 Ga0307515_102176362 179
385 3300028794 Ga0307515_10443672 Ga0307515_104436722 179
386 3300028800 Ga0265338_10050863 Ga0265338_100508633 179
387 3300028800 Ga0265338_10710892 Ga0265338_107108921 179
388 3300029957 Ga0265324_10000005 Ga0265324_10000005350 179
389 3300029957 Ga0265324_10001798 Ga0265324_1000179810 179
390 3300029957 Ga0265324_10042811 Ga0265324_100428112 179
391 3300030522 Ga0307512_10283918 Ga0307512_102839181 179
392 3300031235 Ga0265330_10000076 Ga0265330_1000007647 179
393 3300031235 Ga0265330_10007256 Ga0265330_100072567 179
394 3300031238 Ga0265332_10000002 Ga0265332_10000002443 179
395 3300031239 Ga0265328_10000558 Ga0265328_100005587 179
396 3300031239 Ga0265328_10013762 Ga0265328_100137624 179
397 3300031241 Ga0265325_10001692 Ga0265325_100016925 179
398 3300031241 Ga0265325_10005064 Ga0265325_100050647 179
399 3300031241 Ga0265325_10040154 Ga0265325_100401542 179
400 3300031241 Ga0265325_10040248 Ga0265325_100402482 179
401 3300031242 Ga0265329_10010276 Ga0265329_100102762 179
402 3300031247 Ga0265340_10100631 Ga0265340_101006311 179
403 3300031247 Ga0265340_10112049 Ga0265340_101120492 179
404 3300031249 Ga0265339_10010065 Ga0265339_100100655 179
405 3300031250 Ga0265331_10000030 Ga0265331_10000030192 179
406 3300031250 Ga0265331_10000704 Ga0265331_100007047 179
407 3300031250 Ga0265331_10000818 Ga0265331_100008184 179
408 3300031251 Ga0265327_10000072 Ga0265327_10000072193 179
409 3300031251 Ga0265327_10000374 Ga0265327_1000037479 179
410 3300031251 Ga0265327_10020293 Ga0265327_100202932 179
411 3300031251 Ga0265327_10021128 Ga0265327_100211283 179
412 3300031251 Ga0265327_10076465 Ga0265327_100764651 179
413 3300031344 Ga0265316_10019208 Ga0265316_100192081 179
414 3300031344 Ga0265316_10069636 Ga0265316_100696362 179
415 3300031344 Ga0265316_10096020 Ga0265316_100960202 179
416 3300031344 Ga0265316_10237000 Ga0265316_102370002 179
417 3300031456 Ga0307513_10007611 Ga0307513_100076119 179
418 3300031456 Ga0307513_10105537 Ga0307513_101055374 179
419 3300031456 Ga0307513_10109605 Ga0307513_101096056 179
420 3300031456 Ga0307513_10232176 Ga0307513_102321762 179
421 3300031456 Ga0307513_10371905 Ga0307513_103719052 179
422 3300031548 Ga0307408_100154028 Ga0307408_1001540282 179
423 3300031548 Ga0307408_100252592 Ga0307408_1002525922 179
424 3300031649 Ga0307514_10000806 Ga0307514_1000080634 179
425 3300031711 Ga0265314_10000066 Ga0265314_1000006699 179
426 3300031711 Ga0265314_10002543 Ga0265314_100025439 179
427 3300031711 Ga0265314_10004160 Ga0265314_1000416010 179
428 3300031712 Ga0265342_10064404 Ga0265342_100644042 179
429 3300031730 Ga0307516_10018058 Ga0307516_100180589 179
430 3300031731 Ga0307405_10100499 Ga0307405_101004992 179
431 3300031731 Ga0307405_10541310 Ga0307405_105413102 179
432 3300031824 Ga0307413_10735315 Ga0307413_107353151 179
433 3300031852 Ga0307410_10069663 Ga0307410_100696632 179
434 3300031903 Ga0307407_10702163 Ga0307407_107021632 179
435 3300031911 Ga0307412_10036938 Ga0307412_100369384 179
436 3300031911 Ga0307412_10101480 Ga0307412_101014802 179
437 3300031911 Ga0307412_10211383 Ga0307412_102113832 179
438 3300031911 Ga0307412_10262918 Ga0307412_102629182 179
439 3300031911 Ga0307412_11487217 Ga0307412_114872171 179
440 3300031995 Ga0307409_100003240 Ga0307409_1000032409 179
441 3300032002 Ga0307416_100137401 Ga0307416_1001374012 179
442 3300032002 Ga0307416_100263104 Ga0307416_1002631043 179
443 3300032004 Ga0307414_10010665 Ga0307414_100106656 179
444 3300032004 Ga0307414_10390534 Ga0307414_103905342 179
445 3300032004 Ga0307414_11050451 Ga0307414_110504511 179
446 3300035112 Ga0373932_0013561 Ga0373932_0013561_156_707 179
447 3300035172 Ga0373955_0262999 Ga0373955_0262999_174_731 179
448 3300035691 Ga0373931_0439959 Ga0373931_0439959_212_763 179
449 3300037471 Ga0395905_0038725 Ga0395905_0038725_1239_1796 179
450 3300037471 Ga0395905_0507613 Ga0395905_0507613_149_700 179
451 3300038443 Ga0395901_1294051 Ga0395901_1294051_52_603 179
452 3300039450 Ga0436363_0022589 Ga0436363_0022589_90_641 179
453 3300041404 Ga0439436_0032533 Ga0439436_0032533_664_1221 179
454 3300041406 Ga0439439_0010182 Ga0439439_0010182_1086_1643 179
455 3300041407 Ga0439447_047573 Ga0439447_047573_222_785 179
456 3300041411 Ga0439466_0087474 Ga0439466_0087474_215_781 179
457 3300041413 Ga0439465_0198302 Ga0439465_0198302_121_678 179
458 3300041451 Ga0451791_0373605 Ga0451791_0373605_283_834 179
459 3300041452 Ga0451793_0612856 Ga0451793_0612856_1033_1596 179
460 3300041453 Ga0451797_1533881 Ga0451797_1533881_51_605 179
461 3300041486 Ga0451807_0569212 Ga0451807_0569212_63_614 179
462 3300041486 Ga0451807_1298242 Ga0451807_1298242_600_1160 179
463 3300041486 Ga0451807_1494639 Ga0451807_1494639_1685_2236 179
464 3300041486 Ga0451807_2154701 Ga0451807_2154701_477_1031 179
465 3300041491 Ga0451833_1346353 Ga0451833_1346353_1135_1692 179
466 3300041494 Ga0451837_0937937 Ga0451837_0937937_443_997 179
467 3300041498 Ga0451841_0961435 Ga0451841_0961435_215_772 179
468 3300041501 Ga0451845_0394193 Ga0451845_0394193_293_850 179
469 3300041507 Ga0451851_0805390 Ga0451851_0805390_54_605 179
470 3300041509 Ga0451843_0549395 Ga0451843_0549395_114_668 179
471 3300041509 Ga0451843_0995758 Ga0451843_0995758_606_1163 179
472 3300041512 Ga0451853_1991779 Ga0451853_1991779_216_773 179
473 3300041999 Ga0439433_0025210 Ga0439433_0025210_57_623 179
474 3300042004 Ga0439445_0009847 Ga0439445_0009847_1145_1699 179
475 3300042006 Ga0439432_034037 Ga0439432_034037_523_1077 179
476 3300042010 Ga0439452_019969 Ga0439452_019969_183_740 179
477 3300042015 Ga0439462_0004131 Ga0439462_0004131_1834_2400 179
478 3300042015 Ga0439462_0004645 Ga0439462_0004645_2445_3002 179
479 3300042115 Ga0450911_000121 Ga0450911_000121_11065_11619 179
480 3300042134 Ga0450898_047755 Ga0450898_047755_84_635 179
481 3300042156 Ga0439446_0078470 Ga0439446_0078470_358_915 179
482 3300042185 Ga0450909_018858 Ga0450909_018858_88_645 179
483 3300042439 Ga0439464_0005973 Ga0439464_0005973_2237_2803 179
484 3300042876 Ga0451577_0118620 Ga0451577_0118620_813_1364 179
485 3300042876 Ga0451577_0188749 Ga0451577_0188749_97_648 179
486 3300042876 Ga0451577_0227421 Ga0451577_0227421_430_981 179
487 3300044656 Ga0466969_0000177 Ga0466969_0000177_9107_9661 179
488 3300044656 Ga0466969_0005025 Ga0466969_0005025_182_733 179
489 3300044659 Ga0466973_0041228 Ga0466973_0041228_2895_3449 179
490 3300044683 Ga0466965_0001523 Ga0466965_0001523_8686_9240 179
491 3300044683 Ga0466965_0016395 Ga0466965_0016395_2322_2873 179
492 3300044684 Ga0466966_0005905 Ga0466966_0005905_1653_2204 179
493 3300044693 Ga0466961_0003013 Ga0466961_0003013_7844_8398 179
494 3300044693 Ga0466961_0463443 Ga0466961_0463443_137_688 179
495 3300044694 Ga0466963_0003797 Ga0466963_0003797_7971_8525 179
496 3300044706 Ga0466964_0004537 Ga0466964_0004537_1148_1699 179
497 3300044712 Ga0453684_0000386 Ga0453684_0000386_28291_28842 179
498 3300044712 Ga0453684_0104545 Ga0453684_0104545_163_714 179
499 3300044712 Ga0453684_0453429 Ga0453684_0453429_714_1262 179
500 3300044719 Ga0466971_0005166 Ga0466971_0005166_1319_1870 179
501 3300044735 Ga0466968_0045588 Ga0466968_0045588_1289_1840 179
502 3300044765 Ga0466970_0020423 Ga0466970_0020423_1786_2337 179
503 3300044765 Ga0466970_0024892 Ga0466970_0024892_2270_2824 179
504 3300044842 Ga0466957_0000706 Ga0466957_0000706_12876_13430 179
505 3300044842 Ga0466957_0030827 Ga0466957_0030827_2007_2558 179
506 3300045049 Ga0466959_0036671 Ga0466959_0036671_1714_2268 179
507 3300045049 Ga0466959_0071640 Ga0466959_0071640_1911_2462 179
508 3300045836 Ga0466958_0028478 Ga0466958_0028478_584_1138 179
509 3300045836 Ga0466958_0444143 Ga0466958_0444143_277_828 179
510 3300045976 Ga0466967_0109733 Ga0466967_0109733_296_847 179
511 3300045976 Ga0466967_0510581 Ga0466967_0510581_574_1125 179
512 3300046459 Ga0495629_0392544 Ga0495629_0392544_32_589 179
513 3300046459 Ga0495629_0444459 Ga0495629_0444459_290_844 179
514 3300046460 Ga0495638_0394567 Ga0495638_0394567_76_636 179
515 3300046475 Ga0495639_0001341 Ga0495639_0001341_6813_7367 179
516 3300046522 Ga0495643_0298446 Ga0495643_0298446_132_686 179
517 3300046528 Ga0495642_0116254 Ga0495642_0116254_414_968 179
518 3300046542 Ga0495597_0004256 Ga0495597_0004256_1378_1929 179
519 3300046543 Ga0495645_0331592 Ga0495645_0331592_45_599 179
520 3300046615 Ga0495656_0000209 Ga0495656_0000209_3797_4348 179
521 3300046615 Ga0495656_0300890 Ga0495656_0300890_13_567 179
522 3300046648 Ga0495611_0180948 Ga0495611_0180948_385_936 179
523 3300046674 Ga0495588_0024320 Ga0495588_0024320_1132_1686 179
524 3300046675 Ga0495657_0502068 Ga0495657_0502068_131_685 179
525 3300046678 Ga0495599_0503703 Ga0495599_0503703_40_591 179
526 3300046678 Ga0495599_0619170 Ga0495599_0619170_11_565 179
527 3300046691 Ga0495670_0026417 Ga0495670_0026417_403_960 179
528 3300046691 Ga0495670_0242765 Ga0495670_0242765_366_917 179
529 3300046692 Ga0495671_0033080 Ga0495671_0033080_1951_2502 179
530 3300047318 Ga0495636_0054414 Ga0495636_0054414_492_1043 179
531 3300047321 Ga0495676_0036994 Ga0495676_0036994_1350_1907 179
532 3300047443 Ga0495687_000128 Ga0495687_000128_98716_99267 179
533 3300047445 Ga0495677_0157552 Ga0495677_0157552_204_755 179
534 3300047673 Ga0495593_0135857 Ga0495593_0135857_467_1021 179
535 3300048091 Ga0495626_0070790 Ga0495626_0070790_514_1065 179
536 3300048904 Ga0496101_0000958 Ga0496101_0000958_11270_11824 179
537 3300048904 Ga0496101_0423793 Ga0496101_0423793_276_827 179
538 3300048904 Ga0496101_0976634 Ga0496101_0976634_51_605 179
539 3300048905 Ga0496102_0002816 Ga0496102_0002816_7958_8509 179
540 3300048905 Ga0496102_0009559 Ga0496102_0009559_3660_4211 179
541 3300048905 Ga0496102_0014592 Ga0496102_0014592_3656_4210 179
542 3300048905 Ga0496102_0492320 Ga0496102_0492320_327_881 179
543 3300048905 Ga0496102_0870987 Ga0496102_0870987_152_703 179
544 3300048906 Ga0496103_0213946 Ga0496103_0213946_238_789 179
545 3300048907 Ga0496104_0000688 Ga0496104_0000688_21994_22548 179
546 3300048907 Ga0496104_0209342 Ga0496104_0209342_242_793 179
547 3300048907 Ga0496104_0269814 Ga0496104_0269814_576_1139 179
548 3300048908 Ga0496105_0005944 Ga0496105_0005944_8569_9123 179
549 3300048908 Ga0496105_0124317 Ga0496105_0124317_1133_1684 179
550 3300048908 Ga0496105_0371651 Ga0496105_0371651_492_1055 179
551 3300048909 Ga0496106_0002769 Ga0496106_0002769_11466_12017 179
552 3300048909 Ga0496106_0067516 Ga0496106_0067516_1811_2365 179
553 3300048910 Ga0496107_0027449 Ga0496107_0027449_858_1409 179
554 3300048910 Ga0496107_0177045 Ga0496107_0177045_551_1105 179
555 3300048911 Ga0496108_0044917 Ga0496108_0044917_2003_2557 179
556 3300048912 Ga0496109_0030792 Ga0496109_0030792_1345_1899 179
557 3300048912 Ga0496109_0089162 Ga0496109_0089162_1899_2453 179
558 3300048912 Ga0496109_0138057 Ga0496109_0138057_884_1435 179
559 3300048912 Ga0496109_0185917 Ga0496109_0185917_1228_1782 179
560 3300048913 Ga0496110_0058288 Ga0496110_0058288_920_1474 179
561 3300048913 Ga0496110_0269330 Ga0496110_0269330_192_743 179
562 3300048913 Ga0496110_0372599 Ga0496110_0372599_131_688 179
563 3300048916 Ga0496113_0155268 Ga0496113_0155268_873_1427 179
564 3300048917 Ga0496114_0078913 Ga0496114_0078913_2206_2760 179
565 3300048917 Ga0496114_0088470 Ga0496114_0088470_1914_2468 179
566 3300048920 Ga0496117_0018952 Ga0496117_0018952_1855_2409 179
567 3300048920 Ga0496117_0191115 Ga0496117_0191115_597_1151 179
568 3300048921 Ga0496118_0049833 Ga0496118_0049833_1163_1717 179
569 3300048924 Ga0496121_0005075 Ga0496121_0005075_5604_6158 179
570 3300048924 Ga0496121_0045777 Ga0496121_0045777_530_1084 179
571 3300048927 Ga0496124_0101737 Ga0496124_0101737_771_1325 179
572 3300048927 Ga0496124_0487440 Ga0496124_0487440_22_576 179
573 3300048928 Ga0496125_0004501 Ga0496125_0004501_10363_10917 179
574 3300048928 Ga0496125_0010645 Ga0496125_0010645_5211_5765 179
575 3300048928 Ga0496125_0014401 Ga0496125_0014401_4949_5503 179
576 3300048929 Ga0496126_0302190 Ga0496126_0302190_297_851 179
577 3300048929 Ga0496126_0357361 Ga0496126_0357361_43_597 179
578 3300049128 Ga0501308_015991 Ga0501308_015991_63_617 179
579 3300049571 Ga0501034_0188716 Ga0501034_0188716_141_692 179
580 3300049571 Ga0501034_0345936 Ga0501034_0345936_557_1108 179
581 3300049571 Ga0501034_0471650 Ga0501034_0471650_550_1101 179
582 3300049572 Ga0501036_0289434 Ga0501036_0289434_669_1229 179
583 3300049576 Ga0501040_0564605 Ga0501040_0564605_67_615 179
584 3300049577 Ga0501041_0323891 Ga0501041_0323891_38_586 179
585 3300049578 Ga0501042_0259462 Ga0501042_0259462_373_924 179
586 3300049579 Ga0501043_0186685 Ga0501043_0186685_817_1383 179
587 3300049580 Ga0501046_0130424 Ga0501046_0130424_1120_1671 179
588 3300049581 Ga0501047_0454556 Ga0501047_0454556_530_1096 179
589 3300049582 Ga0501048_0142758 Ga0501048_0142758_386_937 179
590 3300049586 Ga0501070_0232774 Ga0501070_0232774_834_1385 179
591 3300049587 Ga0501071_0252747 Ga0501071_0252747_426_977 179
592 3300049587 Ga0501071_0276502 Ga0501071_0276502_423_974 179
593 3300049590 Ga0501074_0117790 Ga0501074_0117790_790_1341 179
594 3300049590 Ga0501074_0361204 Ga0501074_0361204_259_807 179
595 3300049591 Ga0501075_0058604 Ga0501075_0058604_2241_2792 179
596 3300049593 Ga0501077_0091526 Ga0501077_0091526_1134_1685 179
597 3300049593 Ga0501077_0277856 Ga0501077_0277856_22_570 179
598 3300049741 Ga0501079_0036430 Ga0501079_0036430_2394_2945 179
599 3300049741 Ga0501079_0167106 Ga0501079_0167106_104_652 179
600 3300049744 Ga0501083_0312731 Ga0501083_0312731_334_882 179
601 3300049822 Ga0501035_0068916 Ga0501035_0068916_310_876 179
602 3300049822 Ga0501035_0790191 Ga0501035_0790191_32_586 179
603 3300049823 Ga0501044_0082733 Ga0501044_0082733_151_717 179
604 3300049823 Ga0501044_0334543 Ga0501044_0334543_755_1306 179
605 3300049824 Ga0501045_0287247 Ga0501045_0287247_616_1167 179
606 3300050489 nmdc:mga03683_148240_c1 nmdc:mga03683_148240_c1_415_966 179
607 3300050489 nmdc:mga03683_153569_c1 nmdc:mga03683_153569_c1_317_868 179
608 3300050490 nmdc:mga03n38_386301_c1 nmdc:mga03n38_386301_c1_37_594 179
609 3300050492 nmdc:mga0yw44_136428_c1 nmdc:mga0yw44_136428_c1_263_817 179
610 3300050492 nmdc:mga0yw44_272037_c1 nmdc:mga0yw44_272037_c1_84_635 179
611 3300050493 nmdc:mga0k408_34186_c1 nmdc:mga0k408_34186_c1_535_1092 179
612 3300050493 nmdc:mga0k408_49986_c1 nmdc:mga0k408_49986_c1_939_1490 179
613 3300050493 nmdc:mga0k408_5220_c1 nmdc:mga0k408_5220_c1_640_1191 179
614 3300050493 nmdc:mga0k408_58645_c1 nmdc:mga0k408_58645_c1_581_1147 179
615 3300050493 nmdc:mga0k408_89092_c1 nmdc:mga0k408_89092_c1_182_739 179
616 3300050495 nmdc:mga04h51_109530_c1 nmdc:mga04h51_109530_c1_120_701 179
617 3300050495 nmdc:mga04h51_22089_c1 nmdc:mga04h51_22089_c1_577_1134 179
618 3300050496 nmdc:mga07m45_355052_c1 nmdc:mga07m45_355052_c1_275_826 179
619 3300050496 nmdc:mga07m45_5412_c1 nmdc:mga07m45_5412_c1_3825_4382 179
620 3300050507 nmdc:mga05p37_423790_c1 nmdc:mga05p37_423790_c1_219_773 179
621 3300050508 nmdc:mga09592_166675_c1 nmdc:mga09592_166675_c1_926_1480 179
622 3300050509 nmdc:mga0qj67_362379_c1 nmdc:mga0qj67_362379_c1_183_734 179
623 3300050510 nmdc:mga06r32_875546_c1 nmdc:mga06r32_875546_c1_142_696 179
624 3300050511 nmdc:mga08y16_1293335_c1 nmdc:mga08y16_1293335_c1_125_676 179
625 3300050511 nmdc:mga08y16_177827_c1 nmdc:mga08y16_177827_c1_1346_1897 179
626 3300050511 nmdc:mga08y16_296372_c1 nmdc:mga08y16_296372_c1_323_871 179
627 3300053108 Ga0500562_008842 Ga0500562_008842_1567_2118 179
628 3300053117 Ga0500593_001263 Ga0500593_001263_276_827 179
629 3300053118 Ga0500594_0193636 Ga0500594_0193636_80_634 179
630 3300053125 Ga0500618_035321 Ga0500618_035321_568_1116 179
631 3300053131 Ga0500652_000673 Ga0500652_000673_5546_6097 179
632 3300053136 Ga0500559_0003620 Ga0500559_0003620_5619_6167 179
633 3300053136 Ga0500559_0011876 Ga0500559_0011876_1468_2022 179
634 3300053153 Ga0500616_0021040 Ga0500616_0021040_1592_2143 179
635 3300053730 Ga0500645_005416 Ga0500645_005416_3347_3898 179
636 3300054114 Ga0501084_0107458 Ga0501084_0107458_306_857 179
637 3300060353 Ga0501082_0050362 Ga0501082_0050362_909_1460 179
638 3300060353 Ga0501082_0281564 Ga0501082_0281564_811_1359 179
639 3300061719 Ga0466962_0074084 Ga0466962_0074084_875_1426 179
640 3300061734 Ga0530510_0316182 Ga0530510_0316182_102_650 179
641 3300041496 Ga0451839_0661452 Ga0451839_0661452_29_571 180
642 3300002075 JGI24738J21930_10010593 JGI24738J21930_100105932 181
643 3300005354 Ga0070675_100767959 Ga0070675_1007679591 181
644 3300005457 Ga0070662_100084052 Ga0070662_1000840523 181
645 3300005563 Ga0068855_100126864 Ga0068855_1001268643 181
646 3300006237 Ga0097621_100295183 Ga0097621_1002951832 181
647 3300011119 Ga0105246_10000896 Ga0105246_100008966 181
648 3300013100 Ga0157373_10064951 Ga0157373_100649513 181
649 3300013307 Ga0157372_10816511 Ga0157372_108165112 181
650 3300014745 Ga0157377_10333239 Ga0157377_103332391 181
651 3300025926 Ga0207659_11071081 Ga0207659_110710811 181
652 3300025933 Ga0207706_10041291 Ga0207706_100412914 181
653 3300025949 Ga0207667_10022875 Ga0207667_100228755 181
654 3300031824 Ga0307413_11163037 Ga0307413_111630371 181
655 3300049572 Ga0501036_0234997 Ga0501036_0234997_370_927 181
656 3300049823 Ga0501044_0109666 Ga0501044_0109666_1059_1616 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

4

152

0.96

PF02525

Flavodoxin_2

Flavodoxin-like fold

4

163

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.9249 1 179
3u7r-assembly1.cif.gz_A ferb - flavoenzyme nad(p)h:(acceptor) oxidoreductase (ferb) from paracoccus denitrificans 0.9151 1 179
3s2y-assembly1.cif.gz_A crystal structure of a chromate/uranium reductase from gluconacetobacter hansenii 0.8772 2 180
4hs4-assembly1.cif.gz_G-1 crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a y129n substitution. 0.8759 2 180
4h6p-assembly1.cif.gz_A crystal structure of a putative chromate reductase from gluconacetobacter hansenii, gh-chrr, containing a r101a substitution. 0.8749 2 180
ID Description Score Start End Superfamily
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9204 1 179 3.40.50.360
3u7rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9055 1 179 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8722 3 173 3.40.50.360
3svlA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8544 1 176 3.40.50.360
1x77B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.8538 3 173 3.40.50.360
ID Description Score Start End GO Terms
AF-J8VW18-F1-model_v4 deleted 0.974 1 180
AF-G6EC80-F1-model_v4 NADPH-dependent FMN reductase 0.97 2 179 GO:0005829
GO:0010181
GO:0016491
AF-J8VW18-F1-model_v4 deleted 0.9687 1 180
AF-A0A257PSN8-F1-model_v4 NADPH-dependent FMN reductase 0.9668 1 115 GO:0005829
GO:0010181
GO:0016491
AF-A0A0A0EWY9-F1-model_v4 NADPH-dependent FMN reductase 0.9618 1 180 GO:0005829
GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
93.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map