F472882
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 654 | 259 | 654 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300049568|Ga0501031_0108733|Ga0501031_0108733_72_494 |
| Length | 140 |
| Sequence | MARDRYAELRRILEERRREILGQVHEKIRDVRAEGANNPTTGVLDAAETSESDIQDDIEFALIQMKAETLSKIEEALRRLEAGTFGNCFECGEEISERRLRALPFALRCKDCEEAREVAQQRERMAQRRSSSALFMDVQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 2 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 76 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 77 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 89 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 90 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 180 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 181 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 182 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 183 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 184 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 186 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 189 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 194 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 197 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 204 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 205 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 220 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 221 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 222 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 223 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 240 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 241 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 253 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 254 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 255 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 256 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 257 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 258 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.5 |
| Metatranscriptomes | 5.5 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.46 |
| Nodule | 0 |
| Rhizoplane | 3.21 |
| Rhizosphere | 94.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10041870 | 3300002459 | Unclassified | 947 |
| 2 | Ga0006759J45824_1087942 | 3300003163 | Unclassified | 503 |
| 3 | Ga0007417J51691_1055896 | 3300003544 | Bacteria | 505 |
| 4 | Ga0007409J51694_1029994 | 3300003575 | Bacteria | 531 |
| 5 | Ga0007416J51690_1024618 | 3300003577 | Unclassified | 508 |
| 6 | Ga0007416J51690_1032803 | 3300003577 | Unclassified | 557 |
| 7 | Ga0007416J51690_1064437 | 3300003577 | Bacteria | 580 |
| 8 | Ga0032354_1016568 | 3300003693 | Bacteria | 531 |
| 9 | Ga0058859_10012198 | 3300004798 | Bacteria | 966 |
| 10 | Ga0058859_10020515 | 3300004798 | Unclassified | 714 |
| 11 | Ga0058859_10042413 | 3300004798 | Bacteria | 1120 |
| 12 | Ga0058859_11724858 | 3300004798 | Bacteria | 898 |
| 13 | Ga0058863_11855751 | 3300004799 | Bacteria | 795 |
| 14 | Ga0058861_11956597 | 3300004800 | Unclassified | 1028 |
| 15 | Ga0058860_10010261 | 3300004801 | Bacteria | 888 |
| 16 | Ga0058860_10011861 | 3300004801 | Unclassified | 717 |
| 17 | Ga0058860_10044748 | 3300004801 | Bacteria | 611 |
| 18 | Ga0058860_12074596 | 3300004801 | Unclassified | 672 |
| 19 | Ga0058860_12192347 | 3300004801 | Bacteria | 791 |
| 20 | Ga0058862_12576226 | 3300004803 | Bacteria | 1137 |
| 21 | Ga0065712_10080836 | 3300005290 | Bacteria | 3066 |
| 22 | Ga0065707_10053155 | 3300005295 | Bacteria | 672 |
| 23 | Ga0065707_10640402 | 3300005295 | Unclassified | 659 |
| 24 | Ga0065707_10861655 | 3300005295 | Unclassified | 568 |
| 25 | Ga0070676_10007361 | 3300005328 | Bacteria | 5906 |
| 26 | Ga0070690_100336722 | 3300005330 | Bacteria | 1091 |
| 27 | Ga0070670_100627779 | 3300005331 | Bacteria | 963 |
| 28 | Ga0070670_100647936 | 3300005331 | Bacteria | 947 |
| 29 | Ga0068869_100102397 | 3300005334 | Bacteria | 2167 |
| 30 | Ga0068869_101429777 | 3300005334 | Bacteria | 613 |
| 31 | Ga0068869_102114851 | 3300005334 | Bacteria | 506 |
| 32 | Ga0070666_10015788 | 3300005335 | Bacteria | 4823 |
| 33 | Ga0070666_10077364 | 3300005335 | Bacteria | 2271 |
| 34 | Ga0070666_10440983 | 3300005335 | Bacteria | 939 |
| 35 | Ga0070666_10980315 | 3300005335 | Bacteria | 626 |
| 36 | Ga0070680_100307304 | 3300005336 | Bacteria | 1345 |
| 37 | Ga0070680_101460501 | 3300005336 | Unclassified | 592 |
| 38 | Ga0070682_100547364 | 3300005337 | Bacteria | 905 |
| 39 | Ga0068868_100046061 | 3300005338 | Bacteria | 3413 |
| 40 | Ga0068868_101981365 | 3300005338 | Unclassified | 552 |
| 41 | Ga0070660_100000836 | 3300005339 | Bacteria | 20489 |
| 42 | Ga0070689_100236365 | 3300005340 | Bacteria | 1504 |
| 43 | Ga0070689_100411607 | 3300005340 | Bacteria | 1145 |
| 44 | Ga0070691_10003956 | 3300005341 | Bacteria | 6703 |
| 45 | Ga0070691_10144466 | 3300005341 | Bacteria | 1215 |
| 46 | Ga0070687_100042608 | 3300005343 | Bacteria | 2301 |
| 47 | Ga0070687_100140697 | 3300005343 | Bacteria | 1405 |
| 48 | Ga0070687_100293952 | 3300005343 | Unclassified | 1028 |
| 49 | Ga0070661_101036413 | 3300005344 | Unclassified | 682 |
| 50 | Ga0070692_10642903 | 3300005345 | Archaea | 707 |
| 51 | Ga0070692_10796043 | 3300005345 | Bacteria | 645 |
| 52 | Ga0070692_11100254 | 3300005345 | Bacteria | 561 |
| 53 | Ga0070668_100040765 | 3300005347 | Bacteria | 3554 |
| 54 | Ga0070668_100085032 | 3300005347 | Bacteria | 2486 |
| 55 | Ga0070668_100150652 | 3300005347 | Bacteria | 1881 |
| 56 | Ga0070669_100009946 | 3300005353 | Bacteria | 6767 |
| 57 | Ga0070669_100296388 | 3300005353 | Bacteria | 1300 |
| 58 | Ga0070669_100341152 | 3300005353 | Unclassified | 1214 |
| 59 | Ga0070669_100521645 | 3300005353 | Bacteria | 988 |
| 60 | Ga0070669_100598340 | 3300005353 | Bacteria | 924 |
| 61 | Ga0070675_100013846 | 3300005354 | Bacteria | 6350 |
| 62 | Ga0070675_100190115 | 3300005354 | Bacteria | 1779 |
| 63 | Ga0070675_100271732 | 3300005354 | Bacteria | 1488 |
| 64 | Ga0070675_101364225 | 3300005354 | Unclassified | 654 |
| 65 | Ga0070675_101495716 | 3300005354 | Bacteria | 623 |
| 66 | Ga0070671_100107942 | 3300005355 | Bacteria | 2338 |
| 67 | Ga0070674_100021954 | 3300005356 | Bacteria | 4110 |
| 68 | Ga0070674_100628172 | 3300005356 | Bacteria | 911 |
| 69 | Ga0070674_100804627 | 3300005356 | Bacteria | 812 |
| 70 | Ga0070673_100008513 | 3300005364 | Bacteria | 6824 |
| 71 | Ga0070673_100215837 | 3300005364 | Bacteria | 1658 |
| 72 | Ga0070673_100220997 | 3300005364 | Bacteria | 1639 |
| 73 | Ga0070673_100853521 | 3300005364 | Bacteria | 843 |
| 74 | Ga0070688_100027444 | 3300005365 | Bacteria | 3393 |
| 75 | Ga0070659_100045929 | 3300005366 | Bacteria | 3423 |
| 76 | Ga0070667_100003098 | 3300005367 | Bacteria | 14304 |
| 77 | Ga0070701_10014844 | 3300005438 | Bacteria | 3580 |
| 78 | Ga0070701_10342811 | 3300005438 | Unclassified | 931 |
| 79 | Ga0070701_11042617 | 3300005438 | Bacteria | 573 |
| 80 | Ga0070705_100006397 | 3300005440 | Bacteria | 5774 |
| 81 | Ga0070705_100306733 | 3300005440 | Bacteria | 1140 |
| 82 | Ga0070700_100009994 | 3300005441 | Bacteria | 5223 |
| 83 | Ga0070700_100235780 | 3300005441 | Bacteria | 1305 |
| 84 | Ga0070694_100043331 | 3300005444 | Bacteria | 3009 |
| 85 | Ga0070694_100055461 | 3300005444 | Bacteria | 2688 |
| 86 | Ga0070694_100075315 | 3300005444 | Bacteria | 2334 |
| 87 | Ga0070694_100842449 | 3300005444 | Bacteria | 754 |
| 88 | Ga0070694_100988679 | 3300005444 | Unclassified | 698 |
| 89 | Ga0070708_100226522 | 3300005445 | Unclassified | 1754 |
| 90 | Ga0070708_100575575 | 3300005445 | Unclassified | 1062 |
| 91 | Ga0070708_100590834 | 3300005445 | Bacteria | 1047 |
| 92 | Ga0070662_100073811 | 3300005457 | Bacteria | 2522 |
| 93 | Ga0070662_100212252 | 3300005457 | Bacteria | 1541 |
| 94 | Ga0068867_100017807 | 3300005459 | Bacteria | 5045 |
| 95 | Ga0068867_100035895 | 3300005459 | Bacteria | 3598 |
| 96 | Ga0068867_100450432 | 3300005459 | Bacteria | 1096 |
| 97 | Ga0068867_100601924 | 3300005459 | Unclassified | 959 |
| 98 | Ga0070685_10050645 | 3300005466 | Bacteria | 2399 |
| 99 | Ga0070685_10399112 | 3300005466 | Bacteria | 952 |
| 100 | Ga0070706_100881929 | 3300005467 | Bacteria | 827 |
| 101 | Ga0070706_101408595 | 3300005467 | Bacteria | 638 |
| 102 | Ga0070707_100055131 | 3300005468 | Bacteria | 3811 |
| 103 | Ga0070707_100063602 | 3300005468 | Bacteria | 3541 |
| 104 | Ga0070707_100529782 | 3300005468 | Bacteria | 1140 |
| 105 | Ga0070707_100535022 | 3300005468 | Bacteria | 1134 |
| 106 | Ga0070707_101718690 | 3300005468 | Unclassified | 595 |
| 107 | Ga0070698_101351453 | 3300005471 | Bacteria | 663 |
| 108 | Ga0070699_100005856 | 3300005518 | Bacteria | 10738 |
| 109 | Ga0070699_100059185 | 3300005518 | Bacteria | 3319 |
| 110 | Ga0070699_100081109 | 3300005518 | Bacteria | 2828 |
| 111 | Ga0070699_100124073 | 3300005518 | Bacteria | 2273 |
| 112 | Ga0070699_101365233 | 3300005518 | Unclassified | 650 |
| 113 | Ga0070679_100009668 | 3300005530 | Bacteria | 9122 |
| 114 | Ga0070684_100429266 | 3300005535 | Bacteria | 1220 |
| 115 | Ga0070684_100658896 | 3300005535 | Bacteria | 975 |
| 116 | Ga0070697_100044923 | 3300005536 | Bacteria | 3579 |
| 117 | Ga0070697_100123547 | 3300005536 | Bacteria | 2167 |
| 118 | Ga0070697_100205846 | 3300005536 | Bacteria | 1674 |
| 119 | Ga0070697_100262271 | 3300005536 | Bacteria | 1480 |
| 120 | Ga0070697_100273294 | 3300005536 | Bacteria | 1449 |
| 121 | Ga0070697_100470142 | 3300005536 | Bacteria | 1097 |
| 122 | Ga0068853_100374852 | 3300005539 | Unclassified | 1328 |
| 123 | Ga0068853_100920749 | 3300005539 | Unclassified | 840 |
| 124 | Ga0070672_100217440 | 3300005543 | Bacteria | 1602 |
| 125 | Ga0070672_100282374 | 3300005543 | Bacteria | 1404 |
| 126 | Ga0070672_101851940 | 3300005543 | Bacteria | 543 |
| 127 | Ga0070686_100001079 | 3300005544 | Bacteria | 15728 |
| 128 | Ga0070686_100026480 | 3300005544 | Bacteria | 3500 |
| 129 | Ga0070686_100218156 | 3300005544 | Bacteria | 1377 |
| 130 | Ga0070686_100860001 | 3300005544 | Unclassified | 735 |
| 131 | Ga0070695_100003966 | 3300005545 | Bacteria | 8646 |
| 132 | Ga0070695_100059171 | 3300005545 | Bacteria | 2480 |
| 133 | Ga0070696_100004210 | 3300005546 | Bacteria | 9582 |
| 134 | Ga0070696_100196948 | 3300005546 | Bacteria | 1502 |
| 135 | Ga0070696_100557541 | 3300005546 | Bacteria | 919 |
| 136 | Ga0070696_100892769 | 3300005546 | Unclassified | 737 |
| 137 | Ga0070665_100001584 | 3300005548 | Bacteria | 26229 |
| 138 | Ga0070665_100046665 | 3300005548 | Bacteria | 4350 |
| 139 | Ga0070665_100337790 | 3300005548 | Bacteria | 1511 |
| 140 | Ga0070704_100006282 | 3300005549 | Bacteria | 6993 |
| 141 | Ga0070704_100024925 | 3300005549 | Bacteria | 3931 |
| 142 | Ga0070704_100084274 | 3300005549 | Bacteria | 2349 |
| 143 | Ga0070704_100264554 | 3300005549 | Bacteria | 1418 |
| 144 | Ga0070704_101087673 | 3300005549 | Bacteria | 726 |
| 145 | Ga0068855_100035602 | 3300005563 | Bacteria | 5929 |
| 146 | Ga0070664_100351389 | 3300005564 | Unclassified | 1341 |
| 147 | Ga0070664_100455017 | 3300005564 | Bacteria | 1176 |
| 148 | Ga0070664_100811939 | 3300005564 | Unclassified | 875 |
| 149 | Ga0068857_101955190 | 3300005577 | Bacteria | 575 |
| 150 | Ga0068854_100028184 | 3300005578 | Bacteria | 3878 |
| 151 | Ga0068854_101469754 | 3300005578 | Bacteria | 618 |
| 152 | Ga0068856_101130914 | 3300005614 | Bacteria | 800 |
| 153 | Ga0070702_100010666 | 3300005615 | Bacteria | 4537 |
| 154 | Ga0070702_100576059 | 3300005615 | Bacteria | 840 |
| 155 | Ga0068852_100703189 | 3300005616 | Bacteria | 1021 |
| 156 | Ga0068859_100089881 | 3300005617 | Bacteria | 3122 |
| 157 | Ga0068859_100121126 | 3300005617 | Bacteria | 2682 |
| 158 | Ga0068859_100716758 | 3300005617 | Bacteria | 1090 |
| 159 | Ga0068859_100831624 | 3300005617 | Bacteria | 1010 |
| 160 | Ga0068859_101115345 | 3300005617 | Unclassified | 868 |
| 161 | Ga0068859_102062956 | 3300005617 | Bacteria | 629 |
| 162 | Ga0068864_100007222 | 3300005618 | Bacteria | 9129 |
| 163 | Ga0068864_100520188 | 3300005618 | Bacteria | 1147 |
| 164 | Ga0068864_100837469 | 3300005618 | Unclassified | 906 |
| 165 | Ga0068864_100897840 | 3300005618 | Unclassified | 875 |
| 166 | Ga0068866_10189424 | 3300005718 | Bacteria | 1221 |
| 167 | Ga0068866_10312683 | 3300005718 | Unclassified | 985 |
| 168 | Ga0068866_10381775 | 3300005718 | Bacteria | 904 |
| 169 | Ga0068866_10807512 | 3300005718 | Bacteria | 653 |
| 170 | Ga0068861_100020467 | 3300005719 | Bacteria | 4740 |
| 171 | Ga0068861_100048067 | 3300005719 | Bacteria | 3223 |
| 172 | Ga0068861_100187867 | 3300005719 | Unclassified | 1725 |
| 173 | Ga0068861_100516354 | 3300005719 | Bacteria | 1083 |
| 174 | Ga0068870_10184499 | 3300005840 | Unclassified | 1255 |
| 175 | Ga0068863_100024942 | 3300005841 | Bacteria | 5703 |
| 176 | Ga0068863_100316245 | 3300005841 | Bacteria | 1516 |
| 177 | Ga0068863_100433449 | 3300005841 | Bacteria | 1289 |
| 178 | Ga0068858_100005983 | 3300005842 | Bacteria | 11881 |
| 179 | Ga0068858_100028204 | 3300005842 | Bacteria | 5216 |
| 180 | Ga0068858_100091242 | 3300005842 | Unclassified | 2835 |
| 181 | Ga0068858_100232073 | 3300005842 | Bacteria | 1750 |
| 182 | Ga0068858_100305907 | 3300005842 | Bacteria | 1517 |
| 183 | Ga0068858_100514591 | 3300005842 | Unclassified | 1157 |
| 184 | Ga0068858_100548122 | 3300005842 | Unclassified | 1119 |
| 185 | Ga0068858_100953519 | 3300005842 | Unclassified | 840 |
| 186 | Ga0068858_101384016 | 3300005842 | Bacteria | 693 |
| 187 | Ga0068860_100147694 | 3300005843 | Bacteria | 2263 |
| 188 | Ga0068860_100339257 | 3300005843 | Bacteria | 1477 |
| 189 | Ga0068860_101395326 | 3300005843 | Unclassified | 722 |
| 190 | Ga0068862_100010134 | 3300005844 | Bacteria | 7780 |
| 191 | Ga0068862_100090251 | 3300005844 | Bacteria | 2667 |
| 192 | Ga0068862_100159220 | 3300005844 | Bacteria | 2014 |
| 193 | Ga0068862_100239710 | 3300005844 | Bacteria | 1648 |
| 194 | Ga0068862_100607829 | 3300005844 | Unclassified | 1050 |
| 195 | Ga0081540_1109273 | 3300005983 | Bacteria | 1173 |
| 196 | Ga0081539_10150201 | 3300005985 | Bacteria | 1121 |
| 197 | Ga0081539_10354510 | 3300005985 | Unclassified | 616 |
| 198 | Ga0070717_11019278 | 3300006028 | Unclassified | 754 |
| 199 | Ga0075432_10050940 | 3300006058 | Bacteria | 1461 |
| 200 | Ga0097621_100023036 | 3300006237 | Bacteria | 4843 |
| 201 | Ga0097621_100039877 | 3300006237 | Bacteria | 3773 |
| 202 | Ga0097621_100152114 | 3300006237 | Bacteria | 1984 |
| 203 | Ga0097621_100766714 | 3300006237 | Unclassified | 892 |
| 204 | Ga0068871_100051028 | 3300006358 | Bacteria | 3348 |
| 205 | Ga0068871_100072257 | 3300006358 | Bacteria | 2841 |
| 206 | Ga0068871_100287788 | 3300006358 | Bacteria | 1439 |
| 207 | Ga0068871_100357150 | 3300006358 | Unclassified | 1294 |
| 208 | Ga0068871_100505512 | 3300006358 | Bacteria | 1090 |
| 209 | Ga0075428_100651253 | 3300006844 | Bacteria | 1123 |
| 210 | Ga0075428_100825245 | 3300006844 | Bacteria | 985 |
| 211 | Ga0075428_101051954 | 3300006844 | Bacteria | 861 |
| 212 | Ga0075433_10009068 | 3300006852 | Bacteria | 7947 |
| 213 | Ga0075433_10029899 | 3300006852 | Bacteria | 4644 |
| 214 | Ga0075433_10036743 | 3300006852 | Bacteria | 4221 |
| 215 | Ga0075433_10544341 | 3300006852 | Bacteria | 1021 |
| 216 | Ga0075433_10601132 | 3300006852 | Unclassified | 966 |
| 217 | Ga0075433_10821816 | 3300006852 | Unclassified | 812 |
| 218 | Ga0075433_11037467 | 3300006852 | Bacteria | 714 |
| 219 | Ga0075433_11791430 | 3300006852 | Unclassified | 528 |
| 220 | Ga0075434_100001358 | 3300006871 | Bacteria | 20536 |
| 221 | Ga0075434_100212446 | 3300006871 | Bacteria | 1955 |
| 222 | Ga0075434_100292511 | 3300006871 | Bacteria | 1649 |
| 223 | Ga0075434_100347233 | 3300006871 | Bacteria | 1505 |
| 224 | Ga0075434_100401017 | 3300006871 | Unclassified | 1392 |
| 225 | Ga0075434_100404417 | 3300006871 | Unclassified | 1386 |
| 226 | Ga0075434_100431136 | 3300006871 | Bacteria | 1339 |
| 227 | Ga0075434_100440153 | 3300006871 | Bacteria | 1325 |
| 228 | Ga0075434_101082346 | 3300006871 | Bacteria | 815 |
| 229 | Ga0075434_101655586 | 3300006871 | Bacteria | 648 |
| 230 | Ga0075429_100674754 | 3300006880 | Unclassified | 905 |
| 231 | Ga0068865_100020372 | 3300006881 | Bacteria | 4299 |
| 232 | Ga0075436_100022532 | 3300006914 | Bacteria | 4325 |
| 233 | Ga0075436_100060059 | 3300006914 | Unclassified | 2626 |
| 234 | Ga0075436_100394688 | 3300006914 | Unclassified | 1002 |
| 235 | Ga0097620_100089880 | 3300006931 | Bacteria | 3122 |
| 236 | Ga0097620_100121124 | 3300006931 | Bacteria | 2682 |
| 237 | Ga0097620_100716726 | 3300006931 | Bacteria | 1090 |
| 238 | Ga0097620_100831636 | 3300006931 | Bacteria | 1010 |
| 239 | Ga0097620_101115230 | 3300006931 | Unclassified | 868 |
| 240 | Ga0097620_102062961 | 3300006931 | Bacteria | 629 |
| 241 | Ga0075435_100005188 | 3300007076 | Bacteria | 9061 |
| 242 | Ga0075435_100010927 | 3300007076 | Bacteria | 6653 |
| 243 | Ga0075435_100011725 | 3300007076 | Bacteria | 6466 |
| 244 | Ga0075435_100216351 | 3300007076 | Bacteria | 1626 |
| 245 | Ga0075435_100222828 | 3300007076 | Bacteria | 1602 |
| 246 | Ga0075435_100312131 | 3300007076 | Bacteria | 1346 |
| 247 | Ga0099794_10013634 | 3300007265 | Bacteria | 3543 |
| 248 | Ga0099794_10249847 | 3300007265 | Unclassified | 914 |
| 249 | Ga0105240_10026532 | 3300009093 | Bacteria | 7600 |
| 250 | Ga0105240_10261493 | 3300009093 | Bacteria | 1996 |
| 251 | Ga0105240_10527742 | 3300009093 | Bacteria | 1309 |
| 252 | Ga0105240_10661791 | 3300009093 | Unclassified | 1143 |
| 253 | Ga0111539_10024118 | 3300009094 | Bacteria | 7470 |
| 254 | Ga0111539_10076803 | 3300009094 | Bacteria | 3932 |
| 255 | Ga0111539_10417045 | 3300009094 | Bacteria | 1564 |
| 256 | Ga0105245_10005562 | 3300009098 | Bacteria | 11072 |
| 257 | Ga0105245_10340071 | 3300009098 | Unclassified | 1484 |
| 258 | Ga0105245_10491066 | 3300009098 | Bacteria | 1242 |
| 259 | Ga0105245_10634109 | 3300009098 | Bacteria | 1098 |
| 260 | Ga0105245_11906782 | 3300009098 | Unclassified | 647 |
| 261 | Ga0105245_12180346 | 3300009098 | Bacteria | 608 |
| 262 | Ga0105247_10044351 | 3300009101 | Bacteria | 2727 |
| 263 | Ga0105247_10076554 | 3300009101 | Unclassified | 2101 |
| 264 | Ga0105247_10499227 | 3300009101 | Unclassified | 886 |
| 265 | Ga0105247_10967077 | 3300009101 | Bacteria | 662 |
| 266 | Ga0114129_10001158 | 3300009147 | Bacteria | 34926 |
| 267 | Ga0114129_10002835 | 3300009147 | Bacteria | 24213 |
| 268 | Ga0114129_10004994 | 3300009147 | Bacteria | 18697 |
| 269 | Ga0114129_10013237 | 3300009147 | Bacteria | 11749 |
| 270 | Ga0114129_10058744 | 3300009147 | Bacteria | 5380 |
| 271 | Ga0114129_10078869 | 3300009147 | Bacteria | 4579 |
| 272 | Ga0114129_10113794 | 3300009147 | Bacteria | 3731 |
| 273 | Ga0114129_10221600 | 3300009147 | Unclassified | 2551 |
| 274 | Ga0114129_10606629 | 3300009147 | Unclassified | 1417 |
| 275 | Ga0114129_10650462 | 3300009147 | Bacteria | 1360 |
| 276 | Ga0105243_10031944 | 3300009148 | Bacteria | 4063 |
| 277 | Ga0105243_10070836 | 3300009148 | Bacteria | 2817 |
| 278 | Ga0105243_10682484 | 3300009148 | Bacteria | 999 |
| 279 | Ga0105241_10098154 | 3300009174 | Bacteria | 2324 |
| 280 | Ga0105241_10214886 | 3300009174 | Bacteria | 1613 |
| 281 | Ga0105241_10369205 | 3300009174 | Bacteria | 1251 |
| 282 | Ga0105242_10059020 | 3300009176 | Bacteria | 3147 |
| 283 | Ga0105242_10069666 | 3300009176 | Bacteria | 2914 |
| 284 | Ga0105242_10116565 | 3300009176 | Bacteria | 2285 |
| 285 | Ga0105242_11022379 | 3300009176 | Unclassified | 836 |
| 286 | Ga0105242_11149823 | 3300009176 | Unclassified | 793 |
| 287 | Ga0105248_10001680 | 3300009177 | Bacteria | 24638 |
| 288 | Ga0105248_10024153 | 3300009177 | Bacteria | 6755 |
| 289 | Ga0105248_10042724 | 3300009177 | Bacteria | 5083 |
| 290 | Ga0105248_10238539 | 3300009177 | Bacteria | 2047 |
| 291 | Ga0105248_10330143 | 3300009177 | Bacteria | 1718 |
| 292 | Ga0105248_10476273 | 3300009177 | Bacteria | 1407 |
| 293 | Ga0105248_10709429 | 3300009177 | Bacteria | 1135 |
| 294 | Ga0105248_10857596 | 3300009177 | Bacteria | 1025 |
| 295 | Ga0105248_11268784 | 3300009177 | Bacteria | 833 |
| 296 | Ga0105237_10880228 | 3300009545 | Unclassified | 902 |
| 297 | Ga0105238_10259192 | 3300009551 | Bacteria | 1718 |
| 298 | Ga0105238_10703068 | 3300009551 | Unclassified | 1023 |
| 299 | Ga0105238_11020777 | 3300009551 | Unclassified | 848 |
| 300 | Ga0105238_11185358 | 3300009551 | Unclassified | 788 |
| 301 | Ga0105249_10140625 | 3300009553 | Unclassified | 2314 |
| 302 | Ga0105239_10492690 | 3300010375 | Bacteria | 1393 |
| 303 | Ga0105246_10434521 | 3300011119 | Bacteria | 1099 |
| 304 | Ga0105246_10523396 | 3300011119 | Bacteria | 1011 |
| 305 | Ga0105246_10784600 | 3300011119 | Unclassified | 844 |
| 306 | Ga0157374_10002908 | 3300013296 | Bacteria | 14342 |
| 307 | Ga0157374_10576824 | 3300013296 | Bacteria | 1134 |
| 308 | Ga0157374_10612772 | 3300013296 | Bacteria | 1099 |
| 309 | Ga0157378_10113074 | 3300013297 | Bacteria | 2492 |
| 310 | Ga0157378_10619841 | 3300013297 | Unclassified | 1095 |
| 311 | Ga0157378_10701634 | 3300013297 | Bacteria | 1031 |
| 312 | Ga0157378_10782445 | 3300013297 | Bacteria | 979 |
| 313 | Ga0157378_12034972 | 3300013297 | Unclassified | 624 |
| 314 | Ga0163162_10091514 | 3300013306 | Bacteria | 3125 |
| 315 | Ga0163162_10300919 | 3300013306 | Bacteria | 1736 |
| 316 | Ga0163162_10621117 | 3300013306 | Bacteria | 1206 |
| 317 | Ga0163162_10794438 | 3300013306 | Bacteria | 1064 |
| 318 | Ga0163162_11472843 | 3300013306 | Bacteria | 775 |
| 319 | Ga0157375_10164112 | 3300013308 | Bacteria | 2365 |
| 320 | Ga0157375_10422062 | 3300013308 | Bacteria | 1500 |
| 321 | Ga0163163_10025482 | 3300014325 | Bacteria | 5638 |
| 322 | Ga0163163_10641094 | 3300014325 | Unclassified | 1126 |
| 323 | Ga0157380_10057779 | 3300014326 | Bacteria | 3091 |
| 324 | Ga0157380_10058080 | 3300014326 | Bacteria | 3083 |
| 325 | Ga0157380_10062361 | 3300014326 | Bacteria | 2986 |
| 326 | Ga0157380_10168723 | 3300014326 | Bacteria | 1910 |
| 327 | Ga0157380_10704218 | 3300014326 | Bacteria | 1015 |
| 328 | Ga0157377_10061537 | 3300014745 | Bacteria | 2146 |
| 329 | Ga0157377_10144034 | 3300014745 | Bacteria | 1467 |
| 330 | Ga0157379_10021810 | 3300014968 | Bacteria | 5674 |
| 331 | Ga0157379_10035792 | 3300014968 | Bacteria | 4427 |
| 332 | Ga0157379_10137202 | 3300014968 | Bacteria | 2204 |
| 333 | Ga0157379_10404943 | 3300014968 | Bacteria | 1255 |
| 334 | Ga0157379_11897119 | 3300014968 | Bacteria | 587 |
| 335 | Ga0157376_10197336 | 3300014969 | Bacteria | 1849 |
| 336 | Ga0197907_10089739 | 3300020069 | Unclassified | 803 |
| 337 | Ga0206356_10536623 | 3300020070 | Bacteria | 507 |
| 338 | Ga0206349_1538291 | 3300020075 | Bacteria | 843 |
| 339 | Ga0206351_10264964 | 3300020077 | Bacteria | 886 |
| 340 | Ga0206352_10542349 | 3300020078 | Bacteria | 580 |
| 341 | Ga0206350_10392355 | 3300020080 | Bacteria | 651 |
| 342 | Ga0206350_10997823 | 3300020080 | Unclassified | 765 |
| 343 | Ga0206354_10661468 | 3300020081 | Bacteria | 843 |
| 344 | Ga0154015_1520739 | 3300020610 | Bacteria | 704 |
| 345 | Ga0207642_10021957 | 3300025899 | Bacteria | 2522 |
| 346 | Ga0207642_10054388 | 3300025899 | Bacteria | 1826 |
| 347 | Ga0207710_10052308 | 3300025900 | Unclassified | 1836 |
| 348 | Ga0207688_10018413 | 3300025901 | Bacteria | 3801 |
| 349 | Ga0207680_10037738 | 3300025903 | Bacteria | 2791 |
| 350 | Ga0207680_10060092 | 3300025903 | Bacteria | 2312 |
| 351 | Ga0207680_10208049 | 3300025903 | Bacteria | 1336 |
| 352 | Ga0207680_10245895 | 3300025903 | Bacteria | 1234 |
| 353 | Ga0207680_10591817 | 3300025903 | Unclassified | 793 |
| 354 | Ga0207645_10005026 | 3300025907 | Bacteria | 9690 |
| 355 | Ga0207645_10066299 | 3300025907 | Bacteria | 2308 |
| 356 | Ga0207645_10091249 | 3300025907 | Unclassified | 1959 |
| 357 | Ga0207645_10473116 | 3300025907 | Unclassified | 847 |
| 358 | Ga0207684_10580735 | 3300025910 | Unclassified | 958 |
| 359 | Ga0207684_10620714 | 3300025910 | Bacteria | 922 |
| 360 | Ga0207654_10047220 | 3300025911 | Bacteria | 2459 |
| 361 | Ga0207654_10144423 | 3300025911 | Bacteria | 1521 |
| 362 | Ga0207695_10040063 | 3300025913 | Bacteria | 5029 |
| 363 | Ga0207695_10387455 | 3300025913 | Bacteria | 1283 |
| 364 | Ga0207695_10666866 | 3300025913 | Unclassified | 921 |
| 365 | Ga0207660_10481175 | 3300025917 | Bacteria | 1006 |
| 366 | Ga0207662_10040029 | 3300025918 | Bacteria | 2753 |
| 367 | Ga0207662_10274011 | 3300025918 | Bacteria | 1114 |
| 368 | Ga0207657_10002566 | 3300025919 | Bacteria | 19652 |
| 369 | Ga0207649_10668703 | 3300025920 | Bacteria | 804 |
| 370 | Ga0207652_10047748 | 3300025921 | Bacteria | 3657 |
| 371 | Ga0207646_10037144 | 3300025922 | Bacteria | 4393 |
| 372 | Ga0207646_10542943 | 3300025922 | Bacteria | 1046 |
| 373 | Ga0207646_10574360 | 3300025922 | Bacteria | 1013 |
| 374 | Ga0207681_10011395 | 3300025923 | Bacteria | 5464 |
| 375 | Ga0207681_10023797 | 3300025923 | Bacteria | 3922 |
| 376 | Ga0207681_10056942 | 3300025923 | Bacteria | 2669 |
| 377 | Ga0207681_10407822 | 3300025923 | Bacteria | 1099 |
| 378 | Ga0207681_10425010 | 3300025923 | Unclassified | 1077 |
| 379 | Ga0207694_10174097 | 3300025924 | Bacteria | 1743 |
| 380 | Ga0207694_10240751 | 3300025924 | Bacteria | 1479 |
| 381 | Ga0207694_10517427 | 3300025924 | Unclassified | 1000 |
| 382 | Ga0207694_10840819 | 3300025924 | Bacteria | 776 |
| 383 | Ga0207650_10216343 | 3300025925 | Bacteria | 1540 |
| 384 | Ga0207650_10714817 | 3300025925 | Bacteria | 847 |
| 385 | Ga0207659_10012872 | 3300025926 | Bacteria | 5341 |
| 386 | Ga0207659_10061202 | 3300025926 | Bacteria | 2712 |
| 387 | Ga0207659_10613471 | 3300025926 | Bacteria | 928 |
| 388 | Ga0207687_10152252 | 3300025927 | Bacteria | 1766 |
| 389 | Ga0207687_10390822 | 3300025927 | Bacteria | 1142 |
| 390 | Ga0207687_10444584 | 3300025927 | Bacteria | 1074 |
| 391 | Ga0207687_10967909 | 3300025927 | Bacteria | 729 |
| 392 | Ga0207644_10054463 | 3300025931 | Bacteria | 2881 |
| 393 | Ga0207644_10509380 | 3300025931 | Bacteria | 993 |
| 394 | Ga0207690_10238828 | 3300025932 | Bacteria | 1399 |
| 395 | Ga0207706_10044665 | 3300025933 | Bacteria | 3927 |
| 396 | Ga0207706_10325930 | 3300025933 | Bacteria | 1336 |
| 397 | Ga0207686_10017277 | 3300025934 | Bacteria | 4064 |
| 398 | Ga0207686_10132681 | 3300025934 | Bacteria | 1710 |
| 399 | Ga0207686_10425479 | 3300025934 | Bacteria | 1017 |
| 400 | Ga0207686_10528227 | 3300025934 | Unclassified | 919 |
| 401 | Ga0207686_10742376 | 3300025934 | Unclassified | 783 |
| 402 | Ga0207686_11315030 | 3300025934 | Bacteria | 594 |
| 403 | Ga0207709_10013731 | 3300025935 | Bacteria | 4469 |
| 404 | Ga0207709_10117654 | 3300025935 | Bacteria | 1789 |
| 405 | Ga0207709_10423126 | 3300025935 | Unclassified | 1023 |
| 406 | Ga0207670_10024968 | 3300025936 | Bacteria | 3743 |
| 407 | Ga0207670_10091712 | 3300025936 | Bacteria | 2149 |
| 408 | Ga0207669_10008920 | 3300025937 | Bacteria | 4740 |
| 409 | Ga0207669_10017472 | 3300025937 | Bacteria | 3680 |
| 410 | Ga0207669_10610922 | 3300025937 | Bacteria | 887 |
| 411 | Ga0207669_10667734 | 3300025937 | Bacteria | 851 |
| 412 | Ga0207669_10710235 | 3300025937 | Unclassified | 827 |
| 413 | Ga0207704_10048575 | 3300025938 | Bacteria | 2545 |
| 414 | Ga0207691_10152521 | 3300025940 | Bacteria | 2031 |
| 415 | Ga0207691_10240168 | 3300025940 | Bacteria | 1566 |
| 416 | Ga0207691_10251672 | 3300025940 | Bacteria | 1525 |
| 417 | Ga0207691_10272470 | 3300025940 | Bacteria | 1457 |
| 418 | Ga0207691_10467458 | 3300025940 | Unclassified | 1072 |
| 419 | Ga0207691_11001790 | 3300025940 | Bacteria | 697 |
| 420 | Ga0207691_11104369 | 3300025940 | Bacteria | 660 |
| 421 | Ga0207711_10017070 | 3300025941 | Bacteria | 6030 |
| 422 | Ga0207711_10326518 | 3300025941 | Bacteria | 1418 |
| 423 | Ga0207711_10706805 | 3300025941 | Bacteria | 940 |
| 424 | Ga0207711_10744584 | 3300025941 | Bacteria | 914 |
| 425 | Ga0207711_11396234 | 3300025941 | Archaea | 643 |
| 426 | Ga0207711_11689872 | 3300025941 | Unclassified | 576 |
| 427 | Ga0207689_10062906 | 3300025942 | Bacteria | 3052 |
| 428 | Ga0207689_10098021 | 3300025942 | Bacteria | 2408 |
| 429 | Ga0207689_10126880 | 3300025942 | Bacteria | 2099 |
| 430 | Ga0207689_10976221 | 3300025942 | Unclassified | 715 |
| 431 | Ga0207689_11766422 | 3300025942 | Bacteria | 511 |
| 432 | Ga0207679_10269235 | 3300025945 | Bacteria | 1456 |
| 433 | Ga0207679_10377023 | 3300025945 | Bacteria | 1243 |
| 434 | Ga0207667_10164877 | 3300025949 | Bacteria | 2278 |
| 435 | Ga0207667_10510551 | 3300025949 | Unclassified | 1218 |
| 436 | Ga0207651_10007618 | 3300025960 | Bacteria | 5778 |
| 437 | Ga0207651_10067972 | 3300025960 | Bacteria | 2510 |
| 438 | Ga0207651_10092515 | 3300025960 | Bacteria | 2218 |
| 439 | Ga0207651_10894976 | 3300025960 | Bacteria | 790 |
| 440 | Ga0207712_10160611 | 3300025961 | Unclassified | 1746 |
| 441 | Ga0207712_10264383 | 3300025961 | Bacteria | 1397 |
| 442 | Ga0207668_10020400 | 3300025972 | Bacteria | 4210 |
| 443 | Ga0207668_10119492 | 3300025972 | Bacteria | 1993 |
| 444 | Ga0207640_10016889 | 3300025981 | Bacteria | 4256 |
| 445 | Ga0207640_10105381 | 3300025981 | Bacteria | 1987 |
| 446 | Ga0207640_10481006 | 3300025981 | Bacteria | 1030 |
| 447 | Ga0207658_10164689 | 3300025986 | Bacteria | 1820 |
| 448 | Ga0207677_10049114 | 3300026023 | Bacteria | 2845 |
| 449 | Ga0207677_10072435 | 3300026023 | Unclassified | 2435 |
| 450 | Ga0207677_10293404 | 3300026023 | Bacteria | 1340 |
| 451 | Ga0207703_10018700 | 3300026035 | Bacteria | 5412 |
| 452 | Ga0207703_10029188 | 3300026035 | Bacteria | 4351 |
| 453 | Ga0207703_10049343 | 3300026035 | Bacteria | 3403 |
| 454 | Ga0207703_10098033 | 3300026035 | Bacteria | 2478 |
| 455 | Ga0207703_10300439 | 3300026035 | Unclassified | 1464 |
| 456 | Ga0207703_10832495 | 3300026035 | Unclassified | 882 |
| 457 | Ga0207703_11322021 | 3300026035 | Bacteria | 693 |
| 458 | Ga0207639_11918236 | 3300026041 | Bacteria | 553 |
| 459 | Ga0207708_10007652 | 3300026075 | Bacteria | 7994 |
| 460 | Ga0207708_10182024 | 3300026075 | Bacteria | 1669 |
| 461 | Ga0207708_10858991 | 3300026075 | Bacteria | 784 |
| 462 | Ga0207708_10887617 | 3300026075 | Unclassified | 771 |
| 463 | Ga0207708_10979487 | 3300026075 | Bacteria | 734 |
| 464 | Ga0207702_10324564 | 3300026078 | Bacteria | 1467 |
| 465 | Ga0207702_10418180 | 3300026078 | Bacteria | 1296 |
| 466 | Ga0207641_10003384 | 3300026088 | Bacteria | 14155 |
| 467 | Ga0207641_10118665 | 3300026088 | Bacteria | 2357 |
| 468 | Ga0207641_10334468 | 3300026088 | Bacteria | 1439 |
| 469 | Ga0207641_10626651 | 3300026088 | Bacteria | 1055 |
| 470 | Ga0207648_10010834 | 3300026089 | Bacteria | 8617 |
| 471 | Ga0207648_10024894 | 3300026089 | Bacteria | 5337 |
| 472 | Ga0207648_10255069 | 3300026089 | Bacteria | 1564 |
| 473 | Ga0207648_10308876 | 3300026089 | Unclassified | 1419 |
| 474 | Ga0207648_10728570 | 3300026089 | Bacteria | 920 |
| 475 | Ga0207648_11385706 | 3300026089 | Unclassified | 661 |
| 476 | Ga0207648_11481812 | 3300026089 | Unclassified | 638 |
| 477 | Ga0207676_10124312 | 3300026095 | Bacteria | 2181 |
| 478 | Ga0207676_10598833 | 3300026095 | Bacteria | 1058 |
| 479 | Ga0207674_10769606 | 3300026116 | Bacteria | 929 |
| 480 | Ga0207675_100009579 | 3300026118 | Bacteria | 9061 |
| 481 | Ga0207675_100018853 | 3300026118 | Bacteria | 6439 |
| 482 | Ga0207675_100090323 | 3300026118 | Bacteria | 2880 |
| 483 | Ga0207675_100100456 | 3300026118 | Bacteria | 2725 |
| 484 | Ga0207675_100123677 | 3300026118 | Bacteria | 2449 |
| 485 | Ga0207675_100195166 | 3300026118 | Unclassified | 1943 |
| 486 | Ga0207675_100293260 | 3300026118 | Bacteria | 1583 |
| 487 | Ga0207675_101298793 | 3300026118 | Bacteria | 748 |
| 488 | Ga0207683_10299021 | 3300026121 | Bacteria | 1472 |
| 489 | Ga0207683_10368850 | 3300026121 | Bacteria | 1319 |
| 490 | Ga0207698_10936022 | 3300026142 | Unclassified | 875 |
| 491 | Ga0207428_10009852 | 3300027907 | Bacteria | 8558 |
| 492 | Ga0207428_10197964 | 3300027907 | Bacteria | 1512 |
| 493 | Ga0268266_10021105 | 3300028379 | Bacteria | 5549 |
| 494 | Ga0268266_10027981 | 3300028379 | Bacteria | 4793 |
| 495 | Ga0268266_10282492 | 3300028379 | Bacteria | 1544 |
| 496 | Ga0268265_10037208 | 3300028380 | Bacteria | 3570 |
| 497 | Ga0268265_10193941 | 3300028380 | Bacteria | 1756 |
| 498 | Ga0268265_10195921 | 3300028380 | Bacteria | 1748 |
| 499 | Ga0268265_10236695 | 3300028380 | Unclassified | 1608 |
| 500 | Ga0268265_11225639 | 3300028380 | Unclassified | 748 |
| 501 | Ga0268265_11955376 | 3300028380 | Unclassified | 593 |
| 502 | Ga0268264_10261470 | 3300028381 | Bacteria | 1612 |
| 503 | Ga0268264_11053213 | 3300028381 | Unclassified | 821 |
| 504 | Ga0268264_11203960 | 3300028381 | Unclassified | 767 |
| 505 | Ga0268264_11459379 | 3300028381 | Bacteria | 695 |
| 506 | Ga0268264_11972105 | 3300028381 | Unclassified | 593 |
| 507 | Ga0268264_12028678 | 3300028381 | Bacteria | 584 |
| 508 | Ga0307513_10717989 | 3300031456 | Unclassified | 705 |
| 509 | Ga0307408_100121216 | 3300031548 | Bacteria | 2026 |
| 510 | Ga0307408_101254648 | 3300031548 | Bacteria | 693 |
| 511 | Ga0307413_10154911 | 3300031824 | Unclassified | 1602 |
| 512 | Ga0307410_10089499 | 3300031852 | Bacteria | 2181 |
| 513 | Ga0307407_10030456 | 3300031903 | Bacteria | 2911 |
| 514 | Ga0307412_10231257 | 3300031911 | Bacteria | 1424 |
| 515 | Ga0307409_100036041 | 3300031995 | Bacteria | 3631 |
| 516 | Ga0307414_10216335 | 3300032004 | Unclassified | 1570 |
| 517 | Ga0373930_0003565 | 3300034816 | Unclassified | 2477 |
| 518 | Ga0373950_0000568 | 3300034818 | Bacteria | 4538 |
| 519 | Ga0373959_0004952 | 3300034820 | Bacteria | 2171 |
| 520 | Ga0373929_0000093 | 3300035085 | Bacteria | 14945 |
| 521 | Ga0373929_0016466 | 3300035085 | Bacteria | 1449 |
| 522 | Ga0373940_0000166 | 3300035088 | Bacteria | 8802 |
| 523 | Ga0373940_0097960 | 3300035088 | Unclassified | 887 |
| 524 | Ga0373940_0173544 | 3300035088 | Bacteria | 698 |
| 525 | Ga0373949_0001403 | 3300035090 | Bacteria | 6906 |
| 526 | Ga0373952_0181907 | 3300035092 | Bacteria | 607 |
| 527 | Ga0373932_0001847 | 3300035112 | Bacteria | 5673 |
| 528 | Ga0373932_0187733 | 3300035112 | Bacteria | 729 |
| 529 | Ga0373939_0000289 | 3300035114 | Bacteria | 13260 |
| 530 | Ga0373939_0352510 | 3300035114 | Bacteria | 599 |
| 531 | Ga0373941_0230637 | 3300035115 | Bacteria | 715 |
| 532 | Ga0373956_0133396 | 3300035119 | Bacteria | 1164 |
| 533 | Ga0373960_0001238 | 3300035121 | Bacteria | 5597 |
| 534 | Ga0373960_0138099 | 3300035121 | Unclassified | 823 |
| 535 | Ga0373946_0758373 | 3300035171 | Bacteria | 510 |
| 536 | Ga0373961_0000432 | 3300035241 | Bacteria | 17284 |
| 537 | Ga0373962_0000263 | 3300035242 | Bacteria | 11245 |
| 538 | Ga0373962_0315067 | 3300035242 | Bacteria | 558 |
| 539 | Ga0373924_0046697 | 3300035410 | Bacteria | 1785 |
| 540 | Ga0373931_0055104 | 3300035691 | Bacteria | 2126 |
| 541 | Ga0373931_0107654 | 3300035691 | Bacteria | 1577 |
| 542 | Ga0373935_1060319 | 3300035692 | Unclassified | 603 |
| 543 | Ga0373927_0751605 | 3300035695 | Unclassified | 644 |
| 544 | Ga0373937_0068808 | 3300036401 | Bacteria | 3264 |
| 545 | Ga0373937_0184799 | 3300036401 | Bacteria | 1958 |
| 546 | Ga0373937_0321999 | 3300036401 | Bacteria | 1463 |
| 547 | Ga0373925_0367122 | 3300037068 | Bacteria | 1171 |
| 548 | Ga0373925_0443496 | 3300037068 | Bacteria | 1062 |
| 549 | Ga0436363_0281232 | 3300039450 | Bacteria | 680 |
| 550 | Ga0439445_0174142 | 3300042004 | Bacteria | 631 |
| 551 | Ga0450894_081456 | 3300042131 | Unclassified | 505 |
| 552 | Ga0451576_0004321 | 3300045051 | Bacteria | 18561 |
| 553 | Ga0451576_0310116 | 3300045051 | Unclassified | 1651 |
| 554 | Ga0495641_0460703 | 3300046461 | Bacteria | 579 |
| 555 | Ga0495580_0153602 | 3300046472 | Unclassified | 1595 |
| 556 | Ga0495664_0356325 | 3300046477 | Unclassified | 881 |
| 557 | Ga0495618_0346744 | 3300046514 | Unclassified | 916 |
| 558 | Ga0495640_0220040 | 3300046533 | Bacteria | 1198 |
| 559 | Ga0495645_0068194 | 3300046543 | Bacteria | 2568 |
| 560 | Ga0495667_0258020 | 3300046559 | Bacteria | 1109 |
| 561 | Ga0495668_0236712 | 3300046616 | Bacteria | 1000 |
| 562 | Ga0495647_0413367 | 3300046681 | Bacteria | 621 |
| 563 | Ga0495647_0524008 | 3300046681 | Unclassified | 553 |
| 564 | Ga0495658_0152615 | 3300046683 | Bacteria | 1420 |
| 565 | Ga0495600_0742621 | 3300046809 | Unclassified | 588 |
| 566 | Ga0495684_0131470 | 3300047471 | Bacteria | 1880 |
| 567 | Ga0496102_1025027 | 3300048905 | Unclassified | 746 |
| 568 | Ga0496104_0653946 | 3300048907 | Unclassified | 960 |
| 569 | Ga0496104_0988985 | 3300048907 | Bacteria | 745 |
| 570 | Ga0496105_1136171 | 3300048908 | Bacteria | 578 |
| 571 | Ga0496106_0369990 | 3300048909 | Bacteria | 1152 |
| 572 | Ga0496106_0422208 | 3300048909 | Bacteria | 1072 |
| 573 | Ga0496106_0529286 | 3300048909 | Bacteria | 946 |
| 574 | Ga0496106_1387091 | 3300048909 | Bacteria | 543 |
| 575 | Ga0496108_0007563 | 3300048911 | Bacteria | 8804 |
| 576 | Ga0496109_0452958 | 3300048912 | Bacteria | 1212 |
| 577 | Ga0496109_0699732 | 3300048912 | Unclassified | 951 |
| 578 | Ga0496109_1106733 | 3300048912 | Bacteria | 729 |
| 579 | Ga0496110_0638281 | 3300048913 | Unclassified | 964 |
| 580 | Ga0496110_1795235 | 3300048913 | Bacteria | 523 |
| 581 | Ga0496112_0020537 | 3300048915 | Bacteria | 6263 |
| 582 | Ga0496112_0025438 | 3300048915 | Bacteria | 5684 |
| 583 | Ga0496112_0216684 | 3300048915 | Bacteria | 1871 |
| 584 | Ga0496112_0382647 | 3300048915 | Bacteria | 1348 |
| 585 | Ga0496113_0004808 | 3300048916 | Bacteria | 8352 |
| 586 | Ga0496114_0045288 | 3300048917 | Bacteria | 3654 |
| 587 | Ga0496114_0834320 | 3300048917 | Bacteria | 801 |
| 588 | Ga0501306_060890 | 3300049127 | Bacteria | 622 |
| 589 | Ga0501308_048397 | 3300049128 | Unclassified | 617 |
| 590 | Ga0501309_081377 | 3300049129 | Unclassified | 543 |
| 591 | Ga0501310_067655 | 3300049130 | Unclassified | 542 |
| 592 | Ga0501304_010001 | 3300049160 | Unclassified | 823 |
| 593 | Ga0501314_048075 | 3300049530 | Bacteria | 511 |
| 594 | Ga0501031_0108733 | 3300049568 | Unclassified | 1810 |
| 595 | Ga0501071_0128455 | 3300049587 | Bacteria | 1882 |
| 596 | Ga0501072_0509241 | 3300049588 | Unclassified | 952 |
| 597 | Ga0501076_0293949 | 3300049592 | Bacteria | 1331 |
| 598 | Ga0501235_116200 | 3300049669 | Bacteria | 666 |
| 599 | nmdc:mga06z11_535730_c1 | 3300050494 | Bacteria | 710 |
| 600 | nmdc:mga05p37_17259_c1 | 3300050507 | Bacteria | 8706 |
| 601 | nmdc:mga05p37_198389_c1 | 3300050507 | Bacteria | 2432 |
| 602 | nmdc:mga05p37_20496_c1 | 3300050507 | Bacteria | 7998 |
| 603 | nmdc:mga05p37_29202_c1 | 3300050507 | Bacteria | 6732 |
| 604 | nmdc:mga05p37_30035_c1 | 3300050507 | Bacteria | 6633 |
| 605 | nmdc:mga05p37_55895_c1 | 3300050507 | Bacteria | 4859 |
| 606 | nmdc:mga05p37_69327_c1 | 3300050507 | Bacteria | 4337 |
| 607 | nmdc:mga05p37_70848_c1 | 3300050507 | Unclassified | 4288 |
| 608 | nmdc:mga05p37_73549_c1 | 3300050507 | Bacteria | 4206 |
| 609 | nmdc:mga09592_338518_c1 | 3300050508 | Bacteria | 1302 |
| 610 | nmdc:mga0qj67_536003_c1 | 3300050509 | Unclassified | 939 |
| 611 | nmdc:mga08y16_19023_c1 | 3300050511 | Bacteria | 7234 |
| 612 | nmdc:mga08y16_9065_c1 | 3300050511 | Bacteria | 10444 |
| 613 | nmdc:mga08y16_93277_c1 | 3300050511 | Bacteria | 3137 |
| 614 | nmdc:mga0n895_106738_c1 | 3300050512 | Unclassified | 2814 |
| 615 | nmdc:mga0n895_1179991_c1 | 3300050512 | Bacteria | 740 |
| 616 | nmdc:mga0n895_163873_c1 | 3300050512 | Bacteria | 2255 |
| 617 | nmdc:mga0n895_273931_c1 | 3300050512 | Bacteria | 1712 |
| 618 | nmdc:mga0n895_299076_c1 | 3300050512 | Bacteria | 1631 |
| 619 | nmdc:mga0n895_338122_c1 | 3300050512 | Bacteria | 1525 |
| 620 | nmdc:mga0n895_350144_c1 | 3300050512 | Unclassified | 1496 |
| 621 | nmdc:mga0n895_494994_c1 | 3300050512 | Bacteria | 1232 |
| 622 | nmdc:mga0n895_64_c1 | 3300050512 | Bacteria | 62327 |
| 623 | nmdc:mga0n895_69666_c1 | 3300050512 | Bacteria | 3485 |
| 624 | nmdc:mga0rr50_119_c1 | 3300050513 | Bacteria | 43382 |
| 625 | nmdc:mga0rr50_262953_c1 | 3300050513 | Bacteria | 1436 |
| 626 | nmdc:mga0rr50_44470_c1 | 3300050513 | Bacteria | 3258 |
| 627 | nmdc:mga0rr50_558371_c1 | 3300050513 | Bacteria | 975 |
| 628 | nmdc:mga0rr50_87_c1 | 3300050513 | Bacteria | 52403 |
| 629 | nmdc:mga08x19_126_c1 | 3300050514 | Bacteria | 67080 |
| 630 | nmdc:mga08x19_17287_c1 | 3300050514 | Bacteria | 4412 |
| 631 | nmdc:mga08x19_193570_c1 | 3300050514 | Bacteria | 1392 |
| 632 | nmdc:mga08x19_343713_c1 | 3300050514 | Unclassified | 1041 |
| 633 | nmdc:mga0a205_1227128_c1 | 3300050515 | Unclassified | 598 |
| 634 | nmdc:mga0a205_20926_c1 | 3300050515 | Bacteria | 6181 |
| 635 | nmdc:mga0a205_27457_c1 | 3300050515 | Bacteria | 5436 |
| 636 | nmdc:mga0a205_568775_c1 | 3300050515 | Bacteria | 988 |
| 637 | nmdc:mga0a205_74538_c1 | 3300050515 | Bacteria | 3279 |
| 638 | nmdc:mga0a205_849265_c1 | 3300050515 | Bacteria | 760 |
| 639 | nmdc:mga0a205_910058_c1 | 3300050515 | Bacteria | 726 |
| 640 | nmdc:mga0a205_969162_c1 | 3300050515 | Bacteria | 697 |
| 641 | Ga0495601_0067328 | 3300053077 | Bacteria | 2281 |
| 642 | Ga0495595_0295601 | 3300053084 | Unclassified | 814 |
| 643 | Ga0495619_0025143 | 3300053085 | Bacteria | 3822 |
| 644 | Ga0495619_0033592 | 3300053085 | Bacteria | 3332 |
| 645 | Ga0500566_0359688 | 3300053094 | Bacteria | 664 |
| 646 | Ga0500658_0265274 | 3300053134 | Unclassified | 789 |
| 647 | Ga0590071_000072 | 3300059421 | Bacteria | 27433 |
| 648 | Ga0590074_006648 | 3300059423 | Unclassified | 1919 |
| 649 | Ga0590075_001644 | 3300059424 | Bacteria | 5511 |
| 650 | Ga0590075_034501 | 3300059424 | Bacteria | 1287 |
| 651 | Ga0590077_000044 | 3300059426 | Bacteria | 28687 |
| 652 | Ga0590077_018619 | 3300059426 | Bacteria | 1467 |
| 653 | Ga0587082_089334 | 3300059504 | Bacteria | 655 |
| 654 | Ga0587115_039711 | 3300059626 | Unclassified | 731 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049568 | Ga0501031_0108733 | Ga0501031_0108733_72_494 | 126 |
| 2 | 3300049587 | Ga0501071_0128455 | Ga0501071_0128455_1040_1462 | 126 |
| 3 | 3300049588 | Ga0501072_0509241 | Ga0501072_0509241_445_867 | 126 |
| 4 | 3300049592 | Ga0501076_0293949 | Ga0501076_0293949_82_504 | 126 |
| 5 | 3300009177 | Ga0105248_11268784 | Ga0105248_112687841 | 127 |
| 6 | 3300009101 | Ga0105247_10499227 | Ga0105247_104992271 | 128 |
| 7 | 3300009147 | Ga0114129_10013237 | Ga0114129_1001323710 | 128 |
| 8 | 3300009148 | Ga0105243_10682484 | Ga0105243_106824842 | 128 |
| 9 | 3300009177 | Ga0105248_10042724 | Ga0105248_100427242 | 128 |
| 10 | 3300013297 | Ga0157378_12034972 | Ga0157378_120349721 | 128 |
| 11 | 3300035085 | Ga0373929_0016466 | Ga0373929_0016466_613_1035 | 128 |
| 12 | 3300035121 | Ga0373960_0138099 | Ga0373960_0138099_59_481 | 128 |
| 13 | 3300048909 | Ga0496106_0369990 | Ga0496106_0369990_709_1131 | 128 |
| 14 | 3300048915 | Ga0496112_0216684 | Ga0496112_0216684_796_1218 | 128 |
| 15 | 3300050507 | nmdc:mga05p37_29202_c1 | nmdc:mga05p37_29202_c1_5569_5991 | 128 |
| 16 | 3300050512 | nmdc:mga0n895_163873_c1 | nmdc:mga0n895_163873_c1_686_1108 | 128 |
| 17 | 3300050513 | nmdc:mga0rr50_558371_c1 | nmdc:mga0rr50_558371_c1_119_541 | 128 |
| 18 | 3300050515 | nmdc:mga0a205_20926_c1 | nmdc:mga0a205_20926_c1_1087_1509 | 128 |
| 19 | 3300050515 | nmdc:mga0a205_849265_c1 | nmdc:mga0a205_849265_c1_130_552 | 128 |
| 20 | 3300050515 | nmdc:mga0a205_910058_c1 | nmdc:mga0a205_910058_c1_240_662 | 128 |
| 21 | 3300031548 | Ga0307408_100121216 | Ga0307408_1001212161 | 130 |
| 22 | 3300050508 | nmdc:mga09592_338518_c1 | nmdc:mga09592_338518_c1_226_690 | 130 |
| 23 | 3300005543 | Ga0070672_100217440 | Ga0070672_1002174402 | 131 |
| 24 | 3300005719 | Ga0068861_100187867 | Ga0068861_1001878672 | 131 |
| 25 | 3300025913 | Ga0207695_10387455 | Ga0207695_103874552 | 131 |
| 26 | 3300025931 | Ga0207644_10509380 | Ga0207644_105093801 | 131 |
| 27 | 3300025940 | Ga0207691_10272470 | Ga0207691_102724702 | 131 |
| 28 | 3300025981 | Ga0207640_10105381 | Ga0207640_101053812 | 131 |
| 29 | 3300031548 | Ga0307408_101254648 | Ga0307408_1012546481 | 131 |
| 30 | 3300031824 | Ga0307413_10154911 | Ga0307413_101549112 | 131 |
| 31 | 3300031911 | Ga0307412_10231257 | Ga0307412_102312571 | 131 |
| 32 | 3300034816 | Ga0373930_0003565 | Ga0373930_0003565_159_677 | 131 |
| 33 | 3300034818 | Ga0373950_0000568 | Ga0373950_0000568_1388_1906 | 131 |
| 34 | 3300034820 | Ga0373959_0004952 | Ga0373959_0004952_633_1151 | 131 |
| 35 | 3300035090 | Ga0373949_0001403 | Ga0373949_0001403_2909_3427 | 131 |
| 36 | 3300035112 | Ga0373932_0001847 | Ga0373932_0001847_2812_3330 | 131 |
| 37 | 3300035121 | Ga0373960_0001238 | Ga0373960_0001238_110_628 | 131 |
| 38 | 3300035241 | Ga0373961_0000432 | Ga0373961_0000432_15931_16449 | 131 |
| 39 | 3300035242 | Ga0373962_0000263 | Ga0373962_0000263_2599_3117 | 131 |
| 40 | 3300035691 | Ga0373931_0055104 | Ga0373931_0055104_38_556 | 131 |
| 41 | 3300048909 | Ga0496106_0422208 | Ga0496106_0422208_221_676 | 131 |
| 42 | 3300049127 | Ga0501306_060890 | Ga0501306_060890_135_578 | 131 |
| 43 | 3300049128 | Ga0501308_048397 | Ga0501308_048397_41_484 | 131 |
| 44 | 3300049129 | Ga0501309_081377 | Ga0501309_081377_45_488 | 131 |
| 45 | 3300049130 | Ga0501310_067655 | Ga0501310_067655_45_488 | 131 |
| 46 | 3300049160 | Ga0501304_010001 | Ga0501304_010001_318_761 | 131 |
| 47 | 3300049530 | Ga0501314_048075 | Ga0501314_048075_28_471 | 131 |
| 48 | 3300049669 | Ga0501235_116200 | Ga0501235_116200_150_593 | 131 |
| 49 | 3300006871 | Ga0075434_100212446 | Ga0075434_1002124462 | 132 |
| 50 | 3300006914 | Ga0075436_100394688 | Ga0075436_1003946881 | 132 |
| 51 | 3300007076 | Ga0075435_100010927 | Ga0075435_1000109277 | 132 |
| 52 | 3300007265 | Ga0099794_10013634 | Ga0099794_100136342 | 132 |
| 53 | 3300009093 | Ga0105240_10261493 | Ga0105240_102614932 | 132 |
| 54 | 3300013296 | Ga0157374_10612772 | Ga0157374_106127722 | 132 |
| 55 | 3300013306 | Ga0163162_10794438 | Ga0163162_107944381 | 132 |
| 56 | 3300025918 | Ga0207662_10040029 | Ga0207662_100400293 | 132 |
| 57 | 3300026118 | Ga0207675_100123677 | Ga0207675_1001236772 | 132 |
| 58 | 3300035085 | Ga0373929_0000093 | Ga0373929_0000093_14381_14899 | 132 |
| 59 | 3300035088 | Ga0373940_0000166 | Ga0373940_0000166_166_684 | 132 |
| 60 | 3300035114 | Ga0373939_0000289 | Ga0373939_0000289_10797_11315 | 132 |
| 61 | 3300035115 | Ga0373941_0230637 | Ga0373941_0230637_54_572 | 132 |
| 62 | 3300045051 | Ga0451576_0004321 | Ga0451576_0004321_7049_7567 | 132 |
| 63 | 3300050512 | nmdc:mga0n895_69666_c1 | nmdc:mga0n895_69666_c1_2004_2459 | 132 |
| 64 | 3300050513 | nmdc:mga0rr50_87_c1 | nmdc:mga0rr50_87_c1_48384_48839 | 132 |
| 65 | 3300050514 | nmdc:mga08x19_343713_c1 | nmdc:mga08x19_343713_c1_535_990 | 132 |
| 66 | 3300005459 | Ga0068867_100450432 | Ga0068867_1004504321 | 133 |
| 67 | 3300005468 | Ga0070707_101718690 | Ga0070707_1017186901 | 133 |
| 68 | 3300009176 | Ga0105242_11022379 | Ga0105242_110223792 | 133 |
| 69 | 3300026089 | Ga0207648_11385706 | Ga0207648_113857061 | 133 |
| 70 | 3300042004 | Ga0439445_0174142 | Ga0439445_0174142_88_558 | 133 |
| 71 | 3300059421 | Ga0590071_000072 | Ga0590071_000072_17444_17893 | 133 |
| 72 | 3300059423 | Ga0590074_006648 | Ga0590074_006648_831_1280 | 133 |
| 73 | 3300059424 | Ga0590075_001644 | Ga0590075_001644_2275_2724 | 133 |
| 74 | 3300059424 | Ga0590075_034501 | Ga0590075_034501_688_1137 | 133 |
| 75 | 3300059426 | Ga0590077_000044 | Ga0590077_000044_8952_9401 | 133 |
| 76 | 3300059426 | Ga0590077_018619 | Ga0590077_018619_924_1373 | 133 |
| 77 | 3300009177 | Ga0105248_10238539 | Ga0105248_102385392 | 134 |
| 78 | 3300025941 | Ga0207711_11689872 | Ga0207711_116898721 | 134 |
| 79 | 3300031852 | Ga0307410_10089499 | Ga0307410_100894992 | 134 |
| 80 | 3300031903 | Ga0307407_10030456 | Ga0307407_100304562 | 134 |
| 81 | 3300031995 | Ga0307409_100036041 | Ga0307409_1000360413 | 134 |
| 82 | 3300032004 | Ga0307414_10216335 | Ga0307414_102163352 | 134 |
| 83 | 3300042131 | Ga0450894_081456 | Ga0450894_081456_16_468 | 134 |
| 84 | 3300004799 | Ga0058863_11855751 | Ga0058863_118557511 | 137 |
| 85 | 3300004800 | Ga0058861_11956597 | Ga0058861_119565972 | 137 |
| 86 | 3300004803 | Ga0058862_12576226 | Ga0058862_125762262 | 137 |
| 87 | 3300005336 | Ga0070680_100307304 | Ga0070680_1003073042 | 137 |
| 88 | 3300005337 | Ga0070682_100547364 | Ga0070682_1005473641 | 137 |
| 89 | 3300005339 | Ga0070660_100000836 | Ga0070660_10000083615 | 137 |
| 90 | 3300005345 | Ga0070692_10796043 | Ga0070692_107960431 | 137 |
| 91 | 3300005366 | Ga0070659_100045929 | Ga0070659_1000459291 | 137 |
| 92 | 3300005530 | Ga0070679_100009668 | Ga0070679_1000096685 | 137 |
| 93 | 3300005563 | Ga0068855_100035602 | Ga0068855_1000356022 | 137 |
| 94 | 3300005578 | Ga0068854_101469754 | Ga0068854_1014697541 | 137 |
| 95 | 3300009093 | Ga0105240_10026532 | Ga0105240_100265326 | 137 |
| 96 | 3300009551 | Ga0105238_10259192 | Ga0105238_102591922 | 137 |
| 97 | 3300014326 | Ga0157380_10704218 | Ga0157380_107042183 | 137 |
| 98 | 3300020069 | Ga0197907_10089739 | Ga0197907_100897392 | 137 |
| 99 | 3300020070 | Ga0206356_10536623 | Ga0206356_105366231 | 137 |
| 100 | 3300020075 | Ga0206349_1538291 | Ga0206349_15382911 | 137 |
| 101 | 3300020077 | Ga0206351_10264964 | Ga0206351_102649641 | 137 |
| 102 | 3300020078 | Ga0206352_10542349 | Ga0206352_105423491 | 137 |
| 103 | 3300020080 | Ga0206350_10392355 | Ga0206350_103923551 | 137 |
| 104 | 3300020080 | Ga0206350_10997823 | Ga0206350_109978231 | 137 |
| 105 | 3300020081 | Ga0206354_10661468 | Ga0206354_106614681 | 137 |
| 106 | 3300020610 | Ga0154015_1520739 | Ga0154015_15207391 | 137 |
| 107 | 3300025910 | Ga0207684_10580735 | Ga0207684_105807351 | 137 |
| 108 | 3300025913 | Ga0207695_10040063 | Ga0207695_100400634 | 137 |
| 109 | 3300025917 | Ga0207660_10481175 | Ga0207660_104811751 | 137 |
| 110 | 3300025919 | Ga0207657_10002566 | Ga0207657_100025665 | 137 |
| 111 | 3300025921 | Ga0207652_10047748 | Ga0207652_100477485 | 137 |
| 112 | 3300025924 | Ga0207694_10174097 | Ga0207694_101740971 | 137 |
| 113 | 3300025924 | Ga0207694_10240751 | Ga0207694_102407511 | 137 |
| 114 | 3300025932 | Ga0207690_10238828 | Ga0207690_102388281 | 137 |
| 115 | 3300025941 | Ga0207711_11396234 | Ga0207711_113962341 | 137 |
| 116 | 3300025949 | Ga0207667_10164877 | Ga0207667_101648772 | 137 |
| 117 | 3300025949 | Ga0207667_10510551 | Ga0207667_105105511 | 137 |
| 118 | 3300026078 | Ga0207702_10324564 | Ga0207702_103245642 | 137 |
| 119 | 3300026118 | Ga0207675_100100456 | Ga0207675_1001004562 | 137 |
| 120 | 3300050512 | nmdc:mga0n895_64_c1 | nmdc:mga0n895_64_c1_57746_58213 | 137 |
| 121 | 3300050513 | nmdc:mga0rr50_119_c1 | nmdc:mga0rr50_119_c1_33274_33741 | 137 |
| 122 | 3300050514 | nmdc:mga08x19_126_c1 | nmdc:mga08x19_126_c1_8877_9344 | 137 |
| 123 | 3300050515 | nmdc:mga0a205_969162_c1 | nmdc:mga0a205_969162_c1_87_554 | 137 |
| 124 | 3300059504 | Ga0587082_089334 | Ga0587082_089334_123_575 | 137 |
| 125 | 3300005518 | Ga0070699_100124073 | Ga0070699_1001240732 | 138 |
| 126 | 3300005518 | Ga0070699_101365233 | Ga0070699_1013652331 | 138 |
| 127 | 3300005536 | Ga0070697_100273294 | Ga0070697_1002732943 | 138 |
| 128 | 3300005536 | Ga0070697_100470142 | Ga0070697_1004701422 | 138 |
| 129 | 3300006852 | Ga0075433_11037467 | Ga0075433_110374671 | 138 |
| 130 | 3300006871 | Ga0075434_100440153 | Ga0075434_1004401531 | 138 |
| 131 | 3300059626 | Ga0587115_039711 | Ga0587115_039711_30_551 | 138 |
| 132 | 3300004798 | Ga0058859_11724858 | Ga0058859_117248582 | 139 |
| 133 | 3300005335 | Ga0070666_10015788 | Ga0070666_100157882 | 139 |
| 134 | 3300005343 | Ga0070687_100140697 | Ga0070687_1001406971 | 139 |
| 135 | 3300005353 | Ga0070669_100341152 | Ga0070669_1003411522 | 139 |
| 136 | 3300005354 | Ga0070675_100013846 | Ga0070675_1000138463 | 139 |
| 137 | 3300005354 | Ga0070675_101364225 | Ga0070675_1013642251 | 139 |
| 138 | 3300005364 | Ga0070673_100008513 | Ga0070673_1000085132 | 139 |
| 139 | 3300005444 | Ga0070694_100075315 | Ga0070694_1000753154 | 139 |
| 140 | 3300005444 | Ga0070694_100988679 | Ga0070694_1009886791 | 139 |
| 141 | 3300005445 | Ga0070708_100226522 | Ga0070708_1002265222 | 139 |
| 142 | 3300005445 | Ga0070708_100575575 | Ga0070708_1005755752 | 139 |
| 143 | 3300005459 | Ga0068867_100601924 | Ga0068867_1006019241 | 139 |
| 144 | 3300005518 | Ga0070699_100005856 | Ga0070699_1000058564 | 139 |
| 145 | 3300005518 | Ga0070699_100081109 | Ga0070699_1000811092 | 139 |
| 146 | 3300005535 | Ga0070684_100658896 | Ga0070684_1006588962 | 139 |
| 147 | 3300005539 | Ga0068853_100374852 | Ga0068853_1003748522 | 139 |
| 148 | 3300005539 | Ga0068853_100920749 | Ga0068853_1009207492 | 139 |
| 149 | 3300005544 | Ga0070686_100001079 | Ga0070686_1000010799 | 139 |
| 150 | 3300005545 | Ga0070695_100059171 | Ga0070695_1000591714 | 139 |
| 151 | 3300005549 | Ga0070704_100264554 | Ga0070704_1002645541 | 139 |
| 152 | 3300005564 | Ga0070664_100351389 | Ga0070664_1003513892 | 139 |
| 153 | 3300005578 | Ga0068854_100028184 | Ga0068854_1000281842 | 139 |
| 154 | 3300005614 | Ga0068856_101130914 | Ga0068856_1011309142 | 139 |
| 155 | 3300005617 | Ga0068859_100121126 | Ga0068859_1001211261 | 139 |
| 156 | 3300005842 | Ga0068858_100028204 | Ga0068858_1000282046 | 139 |
| 157 | 3300005842 | Ga0068858_100514591 | Ga0068858_1005145912 | 139 |
| 158 | 3300006237 | Ga0097621_100152114 | Ga0097621_1001521142 | 139 |
| 159 | 3300006852 | Ga0075433_10544341 | Ga0075433_105443412 | 139 |
| 160 | 3300006871 | Ga0075434_100001358 | Ga0075434_10000135818 | 139 |
| 161 | 3300006871 | Ga0075434_101655586 | Ga0075434_1016555861 | 139 |
| 162 | 3300006914 | Ga0075436_100022532 | Ga0075436_1000225321 | 139 |
| 163 | 3300006931 | Ga0097620_100121124 | Ga0097620_1001211241 | 139 |
| 164 | 3300007076 | Ga0075435_100011725 | Ga0075435_1000117256 | 139 |
| 165 | 3300007076 | Ga0075435_100216351 | Ga0075435_1002163512 | 139 |
| 166 | 3300009093 | Ga0105240_10527742 | Ga0105240_105277422 | 139 |
| 167 | 3300009098 | Ga0105245_10340071 | Ga0105245_103400712 | 139 |
| 168 | 3300009098 | Ga0105245_11906782 | Ga0105245_119067821 | 139 |
| 169 | 3300009147 | Ga0114129_10113794 | Ga0114129_101137942 | 139 |
| 170 | 3300009147 | Ga0114129_10650462 | Ga0114129_106504621 | 139 |
| 171 | 3300009174 | Ga0105241_10098154 | Ga0105241_100981542 | 139 |
| 172 | 3300009176 | Ga0105242_11149823 | Ga0105242_111498232 | 139 |
| 173 | 3300009551 | Ga0105238_10703068 | Ga0105238_107030682 | 139 |
| 174 | 3300013296 | Ga0157374_10576824 | Ga0157374_105768241 | 139 |
| 175 | 3300013297 | Ga0157378_10619841 | Ga0157378_106198412 | 139 |
| 176 | 3300013297 | Ga0157378_10782445 | Ga0157378_107824451 | 139 |
| 177 | 3300014326 | Ga0157380_10058080 | Ga0157380_100580804 | 139 |
| 178 | 3300014745 | Ga0157377_10144034 | Ga0157377_101440342 | 139 |
| 179 | 3300025903 | Ga0207680_10037738 | Ga0207680_100377382 | 139 |
| 180 | 3300025903 | Ga0207680_10591817 | Ga0207680_105918172 | 139 |
| 181 | 3300025907 | Ga0207645_10091249 | Ga0207645_100912492 | 139 |
| 182 | 3300025911 | Ga0207654_10047220 | Ga0207654_100472202 | 139 |
| 183 | 3300025923 | Ga0207681_10407822 | Ga0207681_104078222 | 139 |
| 184 | 3300025923 | Ga0207681_10425010 | Ga0207681_104250101 | 139 |
| 185 | 3300025926 | Ga0207659_10012872 | Ga0207659_100128721 | 139 |
| 186 | 3300025927 | Ga0207687_10390822 | Ga0207687_103908221 | 139 |
| 187 | 3300025927 | Ga0207687_10444584 | Ga0207687_104445841 | 139 |
| 188 | 3300025940 | Ga0207691_10467458 | Ga0207691_104674581 | 139 |
| 189 | 3300025945 | Ga0207679_10377023 | Ga0207679_103770232 | 139 |
| 190 | 3300025960 | Ga0207651_10007618 | Ga0207651_100076182 | 139 |
| 191 | 3300025981 | Ga0207640_10016889 | Ga0207640_100168892 | 139 |
| 192 | 3300026035 | Ga0207703_10029188 | Ga0207703_100291886 | 139 |
| 193 | 3300026035 | Ga0207703_10300439 | Ga0207703_103004392 | 139 |
| 194 | 3300026075 | Ga0207708_10887617 | Ga0207708_108876171 | 139 |
| 195 | 3300026078 | Ga0207702_10418180 | Ga0207702_104181802 | 139 |
| 196 | 3300026088 | Ga0207641_10626651 | Ga0207641_106266511 | 139 |
| 197 | 3300026089 | Ga0207648_10308876 | Ga0207648_103088762 | 139 |
| 198 | 3300026089 | Ga0207648_11481812 | Ga0207648_114818121 | 139 |
| 199 | 3300026118 | Ga0207675_100293260 | Ga0207675_1002932602 | 139 |
| 200 | 3300035119 | Ga0373956_0133396 | Ga0373956_0133396_554_1009 | 139 |
| 201 | 3300035410 | Ga0373924_0046697 | Ga0373924_0046697_713_1168 | 139 |
| 202 | 3300035691 | Ga0373931_0107654 | Ga0373931_0107654_19_480 | 139 |
| 203 | 3300036401 | Ga0373937_0068808 | Ga0373937_0068808_1229_1684 | 139 |
| 204 | 3300039450 | Ga0436363_0281232 | Ga0436363_0281232_170_631 | 139 |
| 205 | 3300045051 | Ga0451576_0310116 | Ga0451576_0310116_850_1311 | 139 |
| 206 | 3300046461 | Ga0495641_0460703 | Ga0495641_0460703_61_516 | 139 |
| 207 | 3300046472 | Ga0495580_0153602 | Ga0495580_0153602_80_538 | 139 |
| 208 | 3300046477 | Ga0495664_0356325 | Ga0495664_0356325_269_724 | 139 |
| 209 | 3300046533 | Ga0495640_0220040 | Ga0495640_0220040_660_1115 | 139 |
| 210 | 3300046543 | Ga0495645_0068194 | Ga0495645_0068194_1361_1816 | 139 |
| 211 | 3300046559 | Ga0495667_0258020 | Ga0495667_0258020_352_807 | 139 |
| 212 | 3300047471 | Ga0495684_0131470 | Ga0495684_0131470_895_1350 | 139 |
| 213 | 3300048908 | Ga0496105_1136171 | Ga0496105_1136171_56_511 | 139 |
| 214 | 3300050514 | nmdc:mga08x19_17287_c1 | nmdc:mga08x19_17287_c1_3824_4282 | 139 |
| 215 | 3300053077 | Ga0495601_0067328 | Ga0495601_0067328_650_1105 | 139 |
| 216 | 3300053084 | Ga0495595_0295601 | Ga0495595_0295601_326_781 | 139 |
| 217 | 3300053085 | Ga0495619_0025143 | Ga0495619_0025143_266_721 | 139 |
| 218 | 3300002459 | JGI24751J29686_10041870 | JGI24751J29686_100418701 | 140 |
| 219 | 3300003163 | Ga0006759J45824_1087942 | Ga0006759J45824_10879421 | 140 |
| 220 | 3300003544 | Ga0007417J51691_1055896 | Ga0007417J51691_10558961 | 140 |
| 221 | 3300003575 | Ga0007409J51694_1029994 | Ga0007409J51694_10299941 | 140 |
| 222 | 3300003577 | Ga0007416J51690_1024618 | Ga0007416J51690_10246181 | 140 |
| 223 | 3300003577 | Ga0007416J51690_1032803 | Ga0007416J51690_10328031 | 140 |
| 224 | 3300003577 | Ga0007416J51690_1064437 | Ga0007416J51690_10644371 | 140 |
| 225 | 3300003693 | Ga0032354_1016568 | Ga0032354_10165681 | 140 |
| 226 | 3300004798 | Ga0058859_10012198 | Ga0058859_100121982 | 140 |
| 227 | 3300004798 | Ga0058859_10020515 | Ga0058859_100205151 | 140 |
| 228 | 3300004798 | Ga0058859_10042413 | Ga0058859_100424131 | 140 |
| 229 | 3300004801 | Ga0058860_10010261 | Ga0058860_100102611 | 140 |
| 230 | 3300004801 | Ga0058860_10011861 | Ga0058860_100118611 | 140 |
| 231 | 3300004801 | Ga0058860_10044748 | Ga0058860_100447481 | 140 |
| 232 | 3300004801 | Ga0058860_12074596 | Ga0058860_120745961 | 140 |
| 233 | 3300004801 | Ga0058860_12192347 | Ga0058860_121923471 | 140 |
| 234 | 3300005290 | Ga0065712_10080836 | Ga0065712_100808364 | 140 |
| 235 | 3300005295 | Ga0065707_10053155 | Ga0065707_100531551 | 140 |
| 236 | 3300005295 | Ga0065707_10640402 | Ga0065707_106404021 | 140 |
| 237 | 3300005295 | Ga0065707_10861655 | Ga0065707_108616551 | 140 |
| 238 | 3300005328 | Ga0070676_10007361 | Ga0070676_100073617 | 140 |
| 239 | 3300005330 | Ga0070690_100336722 | Ga0070690_1003367222 | 140 |
| 240 | 3300005331 | Ga0070670_100627779 | Ga0070670_1006277791 | 140 |
| 241 | 3300005331 | Ga0070670_100647936 | Ga0070670_1006479361 | 140 |
| 242 | 3300005334 | Ga0068869_100102397 | Ga0068869_1001023972 | 140 |
| 243 | 3300005334 | Ga0068869_101429777 | Ga0068869_1014297771 | 140 |
| 244 | 3300005334 | Ga0068869_102114851 | Ga0068869_1021148511 | 140 |
| 245 | 3300005335 | Ga0070666_10077364 | Ga0070666_100773642 | 140 |
| 246 | 3300005335 | Ga0070666_10440983 | Ga0070666_104409831 | 140 |
| 247 | 3300005335 | Ga0070666_10980315 | Ga0070666_109803151 | 140 |
| 248 | 3300005336 | Ga0070680_101460501 | Ga0070680_1014605011 | 140 |
| 249 | 3300005338 | Ga0068868_100046061 | Ga0068868_1000460611 | 140 |
| 250 | 3300005338 | Ga0068868_101981365 | Ga0068868_1019813651 | 140 |
| 251 | 3300005340 | Ga0070689_100236365 | Ga0070689_1002363652 | 140 |
| 252 | 3300005340 | Ga0070689_100411607 | Ga0070689_1004116071 | 140 |
| 253 | 3300005341 | Ga0070691_10003956 | Ga0070691_100039562 | 140 |
| 254 | 3300005341 | Ga0070691_10144466 | Ga0070691_101444662 | 140 |
| 255 | 3300005343 | Ga0070687_100042608 | Ga0070687_1000426082 | 140 |
| 256 | 3300005343 | Ga0070687_100293952 | Ga0070687_1002939522 | 140 |
| 257 | 3300005344 | Ga0070661_101036413 | Ga0070661_1010364131 | 140 |
| 258 | 3300005345 | Ga0070692_10642903 | Ga0070692_106429031 | 140 |
| 259 | 3300005345 | Ga0070692_11100254 | Ga0070692_111002541 | 140 |
| 260 | 3300005347 | Ga0070668_100040765 | Ga0070668_1000407655 | 140 |
| 261 | 3300005347 | Ga0070668_100085032 | Ga0070668_1000850322 | 140 |
| 262 | 3300005347 | Ga0070668_100150652 | Ga0070668_1001506521 | 140 |
| 263 | 3300005353 | Ga0070669_100009946 | Ga0070669_1000099462 | 140 |
| 264 | 3300005353 | Ga0070669_100296388 | Ga0070669_1002963881 | 140 |
| 265 | 3300005353 | Ga0070669_100521645 | Ga0070669_1005216451 | 140 |
| 266 | 3300005353 | Ga0070669_100598340 | Ga0070669_1005983401 | 140 |
| 267 | 3300005354 | Ga0070675_100190115 | Ga0070675_1001901152 | 140 |
| 268 | 3300005354 | Ga0070675_100271732 | Ga0070675_1002717322 | 140 |
| 269 | 3300005354 | Ga0070675_101495716 | Ga0070675_1014957161 | 140 |
| 270 | 3300005355 | Ga0070671_100107942 | Ga0070671_1001079422 | 140 |
| 271 | 3300005356 | Ga0070674_100021954 | Ga0070674_1000219542 | 140 |
| 272 | 3300005356 | Ga0070674_100628172 | Ga0070674_1006281722 | 140 |
| 273 | 3300005356 | Ga0070674_100804627 | Ga0070674_1008046271 | 140 |
| 274 | 3300005364 | Ga0070673_100215837 | Ga0070673_1002158372 | 140 |
| 275 | 3300005364 | Ga0070673_100220997 | Ga0070673_1002209971 | 140 |
| 276 | 3300005364 | Ga0070673_100853521 | Ga0070673_1008535211 | 140 |
| 277 | 3300005365 | Ga0070688_100027444 | Ga0070688_1000274441 | 140 |
| 278 | 3300005367 | Ga0070667_100003098 | Ga0070667_10000309810 | 140 |
| 279 | 3300005438 | Ga0070701_10014844 | Ga0070701_100148445 | 140 |
| 280 | 3300005438 | Ga0070701_10342811 | Ga0070701_103428111 | 140 |
| 281 | 3300005438 | Ga0070701_11042617 | Ga0070701_110426171 | 140 |
| 282 | 3300005440 | Ga0070705_100006397 | Ga0070705_1000063976 | 140 |
| 283 | 3300005440 | Ga0070705_100306733 | Ga0070705_1003067331 | 140 |
| 284 | 3300005441 | Ga0070700_100009994 | Ga0070700_1000099942 | 140 |
| 285 | 3300005441 | Ga0070700_100235780 | Ga0070700_1002357801 | 140 |
| 286 | 3300005444 | Ga0070694_100043331 | Ga0070694_1000433313 | 140 |
| 287 | 3300005444 | Ga0070694_100055461 | Ga0070694_1000554612 | 140 |
| 288 | 3300005444 | Ga0070694_100842449 | Ga0070694_1008424491 | 140 |
| 289 | 3300005445 | Ga0070708_100590834 | Ga0070708_1005908341 | 140 |
| 290 | 3300005457 | Ga0070662_100073811 | Ga0070662_1000738112 | 140 |
| 291 | 3300005457 | Ga0070662_100212252 | Ga0070662_1002122522 | 140 |
| 292 | 3300005459 | Ga0068867_100017807 | Ga0068867_1000178076 | 140 |
| 293 | 3300005459 | Ga0068867_100035895 | Ga0068867_1000358954 | 140 |
| 294 | 3300005466 | Ga0070685_10050645 | Ga0070685_100506452 | 140 |
| 295 | 3300005466 | Ga0070685_10399112 | Ga0070685_103991121 | 140 |
| 296 | 3300005467 | Ga0070706_100881929 | Ga0070706_1008819291 | 140 |
| 297 | 3300005467 | Ga0070706_101408595 | Ga0070706_1014085951 | 140 |
| 298 | 3300005468 | Ga0070707_100055131 | Ga0070707_1000551312 | 140 |
| 299 | 3300005468 | Ga0070707_100063602 | Ga0070707_1000636022 | 140 |
| 300 | 3300005468 | Ga0070707_100529782 | Ga0070707_1005297822 | 140 |
| 301 | 3300005468 | Ga0070707_100535022 | Ga0070707_1005350221 | 140 |
| 302 | 3300005471 | Ga0070698_101351453 | Ga0070698_1013514531 | 140 |
| 303 | 3300005518 | Ga0070699_100059185 | Ga0070699_1000591853 | 140 |
| 304 | 3300005535 | Ga0070684_100429266 | Ga0070684_1004292662 | 140 |
| 305 | 3300005536 | Ga0070697_100044923 | Ga0070697_1000449231 | 140 |
| 306 | 3300005536 | Ga0070697_100123547 | Ga0070697_1001235472 | 140 |
| 307 | 3300005536 | Ga0070697_100205846 | Ga0070697_1002058462 | 140 |
| 308 | 3300005536 | Ga0070697_100262271 | Ga0070697_1002622711 | 140 |
| 309 | 3300005543 | Ga0070672_100282374 | Ga0070672_1002823742 | 140 |
| 310 | 3300005543 | Ga0070672_101851940 | Ga0070672_1018519401 | 140 |
| 311 | 3300005544 | Ga0070686_100026480 | Ga0070686_1000264802 | 140 |
| 312 | 3300005544 | Ga0070686_100218156 | Ga0070686_1002181562 | 140 |
| 313 | 3300005544 | Ga0070686_100860001 | Ga0070686_1008600011 | 140 |
| 314 | 3300005545 | Ga0070695_100003966 | Ga0070695_1000039666 | 140 |
| 315 | 3300005546 | Ga0070696_100004210 | Ga0070696_1000042102 | 140 |
| 316 | 3300005546 | Ga0070696_100196948 | Ga0070696_1001969482 | 140 |
| 317 | 3300005546 | Ga0070696_100557541 | Ga0070696_1005575412 | 140 |
| 318 | 3300005546 | Ga0070696_100892769 | Ga0070696_1008927691 | 140 |
| 319 | 3300005548 | Ga0070665_100001584 | Ga0070665_1000015847 | 140 |
| 320 | 3300005548 | Ga0070665_100046665 | Ga0070665_1000466653 | 140 |
| 321 | 3300005548 | Ga0070665_100337790 | Ga0070665_1003377902 | 140 |
| 322 | 3300005549 | Ga0070704_100006282 | Ga0070704_1000062822 | 140 |
| 323 | 3300005549 | Ga0070704_100024925 | Ga0070704_1000249253 | 140 |
| 324 | 3300005549 | Ga0070704_100084274 | Ga0070704_1000842742 | 140 |
| 325 | 3300005549 | Ga0070704_101087673 | Ga0070704_1010876731 | 140 |
| 326 | 3300005564 | Ga0070664_100455017 | Ga0070664_1004550172 | 140 |
| 327 | 3300005564 | Ga0070664_100811939 | Ga0070664_1008119392 | 140 |
| 328 | 3300005577 | Ga0068857_101955190 | Ga0068857_1019551901 | 140 |
| 329 | 3300005615 | Ga0070702_100010666 | Ga0070702_1000106664 | 140 |
| 330 | 3300005615 | Ga0070702_100576059 | Ga0070702_1005760591 | 140 |
| 331 | 3300005616 | Ga0068852_100703189 | Ga0068852_1007031892 | 140 |
| 332 | 3300005617 | Ga0068859_100089881 | Ga0068859_1000898812 | 140 |
| 333 | 3300005617 | Ga0068859_100716758 | Ga0068859_1007167582 | 140 |
| 334 | 3300005617 | Ga0068859_100831624 | Ga0068859_1008316241 | 140 |
| 335 | 3300005617 | Ga0068859_101115345 | Ga0068859_1011153451 | 140 |
| 336 | 3300005617 | Ga0068859_102062956 | Ga0068859_1020629561 | 140 |
| 337 | 3300005618 | Ga0068864_100007222 | Ga0068864_1000072226 | 140 |
| 338 | 3300005618 | Ga0068864_100520188 | Ga0068864_1005201882 | 140 |
| 339 | 3300005618 | Ga0068864_100837469 | Ga0068864_1008374691 | 140 |
| 340 | 3300005618 | Ga0068864_100897840 | Ga0068864_1008978401 | 140 |
| 341 | 3300005718 | Ga0068866_10189424 | Ga0068866_101894241 | 140 |
| 342 | 3300005718 | Ga0068866_10312683 | Ga0068866_103126832 | 140 |
| 343 | 3300005718 | Ga0068866_10381775 | Ga0068866_103817751 | 140 |
| 344 | 3300005718 | Ga0068866_10807512 | Ga0068866_108075121 | 140 |
| 345 | 3300005719 | Ga0068861_100020467 | Ga0068861_1000204672 | 140 |
| 346 | 3300005719 | Ga0068861_100048067 | Ga0068861_1000480674 | 140 |
| 347 | 3300005719 | Ga0068861_100516354 | Ga0068861_1005163542 | 140 |
| 348 | 3300005840 | Ga0068870_10184499 | Ga0068870_101844991 | 140 |
| 349 | 3300005841 | Ga0068863_100024942 | Ga0068863_1000249424 | 140 |
| 350 | 3300005841 | Ga0068863_100316245 | Ga0068863_1003162452 | 140 |
| 351 | 3300005841 | Ga0068863_100433449 | Ga0068863_1004334492 | 140 |
| 352 | 3300005842 | Ga0068858_100005983 | Ga0068858_1000059832 | 140 |
| 353 | 3300005842 | Ga0068858_100091242 | Ga0068858_1000912422 | 140 |
| 354 | 3300005842 | Ga0068858_100232073 | Ga0068858_1002320732 | 140 |
| 355 | 3300005842 | Ga0068858_100305907 | Ga0068858_1003059072 | 140 |
| 356 | 3300005842 | Ga0068858_100548122 | Ga0068858_1005481222 | 140 |
| 357 | 3300005842 | Ga0068858_100953519 | Ga0068858_1009535191 | 140 |
| 358 | 3300005842 | Ga0068858_101384016 | Ga0068858_1013840161 | 140 |
| 359 | 3300005843 | Ga0068860_100147694 | Ga0068860_1001476942 | 140 |
| 360 | 3300005843 | Ga0068860_100339257 | Ga0068860_1003392571 | 140 |
| 361 | 3300005843 | Ga0068860_101395326 | Ga0068860_1013953261 | 140 |
| 362 | 3300005844 | Ga0068862_100010134 | Ga0068862_1000101343 | 140 |
| 363 | 3300005844 | Ga0068862_100090251 | Ga0068862_1000902512 | 140 |
| 364 | 3300005844 | Ga0068862_100159220 | Ga0068862_1001592202 | 140 |
| 365 | 3300005844 | Ga0068862_100239710 | Ga0068862_1002397102 | 140 |
| 366 | 3300005844 | Ga0068862_100607829 | Ga0068862_1006078291 | 140 |
| 367 | 3300005983 | Ga0081540_1109273 | Ga0081540_11092732 | 140 |
| 368 | 3300005985 | Ga0081539_10150201 | Ga0081539_101502012 | 140 |
| 369 | 3300005985 | Ga0081539_10354510 | Ga0081539_103545101 | 140 |
| 370 | 3300006028 | Ga0070717_11019278 | Ga0070717_110192781 | 140 |
| 371 | 3300006058 | Ga0075432_10050940 | Ga0075432_100509402 | 140 |
| 372 | 3300006237 | Ga0097621_100023036 | Ga0097621_1000230362 | 140 |
| 373 | 3300006237 | Ga0097621_100039877 | Ga0097621_1000398772 | 140 |
| 374 | 3300006237 | Ga0097621_100766714 | Ga0097621_1007667142 | 140 |
| 375 | 3300006358 | Ga0068871_100051028 | Ga0068871_1000510282 | 140 |
| 376 | 3300006358 | Ga0068871_100072257 | Ga0068871_1000722572 | 140 |
| 377 | 3300006358 | Ga0068871_100287788 | Ga0068871_1002877882 | 140 |
| 378 | 3300006358 | Ga0068871_100357150 | Ga0068871_1003571502 | 140 |
| 379 | 3300006358 | Ga0068871_100505512 | Ga0068871_1005055121 | 140 |
| 380 | 3300006844 | Ga0075428_100651253 | Ga0075428_1006512532 | 140 |
| 381 | 3300006844 | Ga0075428_100825245 | Ga0075428_1008252451 | 140 |
| 382 | 3300006844 | Ga0075428_101051954 | Ga0075428_1010519541 | 140 |
| 383 | 3300006852 | Ga0075433_10009068 | Ga0075433_100090687 | 140 |
| 384 | 3300006852 | Ga0075433_10029899 | Ga0075433_100298997 | 140 |
| 385 | 3300006852 | Ga0075433_10036743 | Ga0075433_100367434 | 140 |
| 386 | 3300006852 | Ga0075433_10601132 | Ga0075433_106011322 | 140 |
| 387 | 3300006852 | Ga0075433_10821816 | Ga0075433_108218162 | 140 |
| 388 | 3300006852 | Ga0075433_11791430 | Ga0075433_117914301 | 140 |
| 389 | 3300006871 | Ga0075434_100292511 | Ga0075434_1002925112 | 140 |
| 390 | 3300006871 | Ga0075434_100347233 | Ga0075434_1003472332 | 140 |
| 391 | 3300006871 | Ga0075434_100401017 | Ga0075434_1004010172 | 140 |
| 392 | 3300006871 | Ga0075434_100404417 | Ga0075434_1004044171 | 140 |
| 393 | 3300006871 | Ga0075434_100431136 | Ga0075434_1004311362 | 140 |
| 394 | 3300006871 | Ga0075434_101082346 | Ga0075434_1010823461 | 140 |
| 395 | 3300006880 | Ga0075429_100674754 | Ga0075429_1006747541 | 140 |
| 396 | 3300006881 | Ga0068865_100020372 | Ga0068865_1000203725 | 140 |
| 397 | 3300006914 | Ga0075436_100060059 | Ga0075436_1000600592 | 140 |
| 398 | 3300006931 | Ga0097620_100089880 | Ga0097620_1000898802 | 140 |
| 399 | 3300006931 | Ga0097620_100716726 | Ga0097620_1007167262 | 140 |
| 400 | 3300006931 | Ga0097620_100831636 | Ga0097620_1008316361 | 140 |
| 401 | 3300006931 | Ga0097620_101115230 | Ga0097620_1011152302 | 140 |
| 402 | 3300006931 | Ga0097620_102062961 | Ga0097620_1020629611 | 140 |
| 403 | 3300007076 | Ga0075435_100005188 | Ga0075435_1000051886 | 140 |
| 404 | 3300007076 | Ga0075435_100222828 | Ga0075435_1002228282 | 140 |
| 405 | 3300007076 | Ga0075435_100312131 | Ga0075435_1003121311 | 140 |
| 406 | 3300007265 | Ga0099794_10249847 | Ga0099794_102498472 | 140 |
| 407 | 3300009093 | Ga0105240_10661791 | Ga0105240_106617911 | 140 |
| 408 | 3300009094 | Ga0111539_10024118 | Ga0111539_100241187 | 140 |
| 409 | 3300009094 | Ga0111539_10076803 | Ga0111539_100768031 | 140 |
| 410 | 3300009094 | Ga0111539_10417045 | Ga0111539_104170452 | 140 |
| 411 | 3300009098 | Ga0105245_10005562 | Ga0105245_100055627 | 140 |
| 412 | 3300009098 | Ga0105245_10491066 | Ga0105245_104910662 | 140 |
| 413 | 3300009098 | Ga0105245_10634109 | Ga0105245_106341092 | 140 |
| 414 | 3300009098 | Ga0105245_12180346 | Ga0105245_121803461 | 140 |
| 415 | 3300009101 | Ga0105247_10044351 | Ga0105247_100443512 | 140 |
| 416 | 3300009101 | Ga0105247_10076554 | Ga0105247_100765543 | 140 |
| 417 | 3300009101 | Ga0105247_10967077 | Ga0105247_109670771 | 140 |
| 418 | 3300009147 | Ga0114129_10001158 | Ga0114129_100011588 | 140 |
| 419 | 3300009147 | Ga0114129_10002835 | Ga0114129_1000283514 | 140 |
| 420 | 3300009147 | Ga0114129_10004994 | Ga0114129_1000499419 | 140 |
| 421 | 3300009147 | Ga0114129_10058744 | Ga0114129_100587442 | 140 |
| 422 | 3300009147 | Ga0114129_10078869 | Ga0114129_100788692 | 140 |
| 423 | 3300009147 | Ga0114129_10221600 | Ga0114129_102216005 | 140 |
| 424 | 3300009147 | Ga0114129_10606629 | Ga0114129_106066292 | 140 |
| 425 | 3300009148 | Ga0105243_10031944 | Ga0105243_100319446 | 140 |
| 426 | 3300009148 | Ga0105243_10070836 | Ga0105243_100708363 | 140 |
| 427 | 3300009174 | Ga0105241_10214886 | Ga0105241_102148861 | 140 |
| 428 | 3300009174 | Ga0105241_10369205 | Ga0105241_103692051 | 140 |
| 429 | 3300009176 | Ga0105242_10059020 | Ga0105242_100590205 | 140 |
| 430 | 3300009176 | Ga0105242_10069666 | Ga0105242_100696662 | 140 |
| 431 | 3300009176 | Ga0105242_10116565 | Ga0105242_101165652 | 140 |
| 432 | 3300009177 | Ga0105248_10001680 | Ga0105248_100016807 | 140 |
| 433 | 3300009177 | Ga0105248_10024153 | Ga0105248_100241537 | 140 |
| 434 | 3300009177 | Ga0105248_10330143 | Ga0105248_103301432 | 140 |
| 435 | 3300009177 | Ga0105248_10476273 | Ga0105248_104762731 | 140 |
| 436 | 3300009177 | Ga0105248_10709429 | Ga0105248_107094291 | 140 |
| 437 | 3300009177 | Ga0105248_10857596 | Ga0105248_108575961 | 140 |
| 438 | 3300009545 | Ga0105237_10880228 | Ga0105237_108802282 | 140 |
| 439 | 3300009551 | Ga0105238_11020777 | Ga0105238_110207772 | 140 |
| 440 | 3300009551 | Ga0105238_11185358 | Ga0105238_111853582 | 140 |
| 441 | 3300009553 | Ga0105249_10140625 | Ga0105249_101406252 | 140 |
| 442 | 3300010375 | Ga0105239_10492690 | Ga0105239_104926902 | 140 |
| 443 | 3300011119 | Ga0105246_10434521 | Ga0105246_104345211 | 140 |
| 444 | 3300011119 | Ga0105246_10523396 | Ga0105246_105233961 | 140 |
| 445 | 3300011119 | Ga0105246_10784600 | Ga0105246_107846001 | 140 |
| 446 | 3300013296 | Ga0157374_10002908 | Ga0157374_100029089 | 140 |
| 447 | 3300013297 | Ga0157378_10113074 | Ga0157378_101130742 | 140 |
| 448 | 3300013297 | Ga0157378_10701634 | Ga0157378_107016342 | 140 |
| 449 | 3300013306 | Ga0163162_10091514 | Ga0163162_100915142 | 140 |
| 450 | 3300013306 | Ga0163162_10300919 | Ga0163162_103009191 | 140 |
| 451 | 3300013306 | Ga0163162_10621117 | Ga0163162_106211171 | 140 |
| 452 | 3300013306 | Ga0163162_11472843 | Ga0163162_114728431 | 140 |
| 453 | 3300013308 | Ga0157375_10164112 | Ga0157375_101641122 | 140 |
| 454 | 3300013308 | Ga0157375_10422062 | Ga0157375_104220622 | 140 |
| 455 | 3300014325 | Ga0163163_10025482 | Ga0163163_100254824 | 140 |
| 456 | 3300014325 | Ga0163163_10641094 | Ga0163163_106410941 | 140 |
| 457 | 3300014326 | Ga0157380_10057779 | Ga0157380_100577792 | 140 |
| 458 | 3300014326 | Ga0157380_10062361 | Ga0157380_100623615 | 140 |
| 459 | 3300014326 | Ga0157380_10168723 | Ga0157380_101687232 | 140 |
| 460 | 3300014745 | Ga0157377_10061537 | Ga0157377_100615372 | 140 |
| 461 | 3300014968 | Ga0157379_10021810 | Ga0157379_100218105 | 140 |
| 462 | 3300014968 | Ga0157379_10035792 | Ga0157379_100357922 | 140 |
| 463 | 3300014968 | Ga0157379_10137202 | Ga0157379_101372022 | 140 |
| 464 | 3300014968 | Ga0157379_10404943 | Ga0157379_104049431 | 140 |
| 465 | 3300014968 | Ga0157379_11897119 | Ga0157379_118971191 | 140 |
| 466 | 3300014969 | Ga0157376_10197336 | Ga0157376_101973362 | 140 |
| 467 | 3300025899 | Ga0207642_10021957 | Ga0207642_100219572 | 140 |
| 468 | 3300025899 | Ga0207642_10054388 | Ga0207642_100543881 | 140 |
| 469 | 3300025900 | Ga0207710_10052308 | Ga0207710_100523082 | 140 |
| 470 | 3300025901 | Ga0207688_10018413 | Ga0207688_100184132 | 140 |
| 471 | 3300025903 | Ga0207680_10060092 | Ga0207680_100600922 | 140 |
| 472 | 3300025903 | Ga0207680_10208049 | Ga0207680_102080492 | 140 |
| 473 | 3300025903 | Ga0207680_10245895 | Ga0207680_102458951 | 140 |
| 474 | 3300025907 | Ga0207645_10005026 | Ga0207645_100050264 | 140 |
| 475 | 3300025907 | Ga0207645_10066299 | Ga0207645_100662993 | 140 |
| 476 | 3300025907 | Ga0207645_10473116 | Ga0207645_104731162 | 140 |
| 477 | 3300025910 | Ga0207684_10620714 | Ga0207684_106207142 | 140 |
| 478 | 3300025911 | Ga0207654_10144423 | Ga0207654_101444232 | 140 |
| 479 | 3300025913 | Ga0207695_10666866 | Ga0207695_106668662 | 140 |
| 480 | 3300025918 | Ga0207662_10274011 | Ga0207662_102740112 | 140 |
| 481 | 3300025920 | Ga0207649_10668703 | Ga0207649_106687031 | 140 |
| 482 | 3300025922 | Ga0207646_10037144 | Ga0207646_100371442 | 140 |
| 483 | 3300025922 | Ga0207646_10542943 | Ga0207646_105429432 | 140 |
| 484 | 3300025922 | Ga0207646_10574360 | Ga0207646_105743601 | 140 |
| 485 | 3300025923 | Ga0207681_10011395 | Ga0207681_100113956 | 140 |
| 486 | 3300025923 | Ga0207681_10023797 | Ga0207681_100237975 | 140 |
| 487 | 3300025923 | Ga0207681_10056942 | Ga0207681_100569423 | 140 |
| 488 | 3300025924 | Ga0207694_10517427 | Ga0207694_105174271 | 140 |
| 489 | 3300025924 | Ga0207694_10840819 | Ga0207694_108408191 | 140 |
| 490 | 3300025925 | Ga0207650_10216343 | Ga0207650_102163431 | 140 |
| 491 | 3300025925 | Ga0207650_10714817 | Ga0207650_107148172 | 140 |
| 492 | 3300025926 | Ga0207659_10061202 | Ga0207659_100612023 | 140 |
| 493 | 3300025926 | Ga0207659_10613471 | Ga0207659_106134711 | 140 |
| 494 | 3300025927 | Ga0207687_10152252 | Ga0207687_101522522 | 140 |
| 495 | 3300025927 | Ga0207687_10967909 | Ga0207687_109679091 | 140 |
| 496 | 3300025931 | Ga0207644_10054463 | Ga0207644_100544632 | 140 |
| 497 | 3300025933 | Ga0207706_10044665 | Ga0207706_100446653 | 140 |
| 498 | 3300025933 | Ga0207706_10325930 | Ga0207706_103259302 | 140 |
| 499 | 3300025934 | Ga0207686_10017277 | Ga0207686_100172772 | 140 |
| 500 | 3300025934 | Ga0207686_10132681 | Ga0207686_101326812 | 140 |
| 501 | 3300025934 | Ga0207686_10425479 | Ga0207686_104254792 | 140 |
| 502 | 3300025934 | Ga0207686_10528227 | Ga0207686_105282271 | 140 |
| 503 | 3300025934 | Ga0207686_10742376 | Ga0207686_107423761 | 140 |
| 504 | 3300025934 | Ga0207686_11315030 | Ga0207686_113150301 | 140 |
| 505 | 3300025935 | Ga0207709_10013731 | Ga0207709_100137313 | 140 |
| 506 | 3300025935 | Ga0207709_10117654 | Ga0207709_101176542 | 140 |
| 507 | 3300025935 | Ga0207709_10423126 | Ga0207709_104231262 | 140 |
| 508 | 3300025936 | Ga0207670_10024968 | Ga0207670_100249682 | 140 |
| 509 | 3300025936 | Ga0207670_10091712 | Ga0207670_100917122 | 140 |
| 510 | 3300025937 | Ga0207669_10008920 | Ga0207669_100089203 | 140 |
| 511 | 3300025937 | Ga0207669_10017472 | Ga0207669_100174723 | 140 |
| 512 | 3300025937 | Ga0207669_10610922 | Ga0207669_106109221 | 140 |
| 513 | 3300025937 | Ga0207669_10667734 | Ga0207669_106677341 | 140 |
| 514 | 3300025937 | Ga0207669_10710235 | Ga0207669_107102352 | 140 |
| 515 | 3300025938 | Ga0207704_10048575 | Ga0207704_100485752 | 140 |
| 516 | 3300025940 | Ga0207691_10152521 | Ga0207691_101525212 | 140 |
| 517 | 3300025940 | Ga0207691_10240168 | Ga0207691_102401682 | 140 |
| 518 | 3300025940 | Ga0207691_10251672 | Ga0207691_102516722 | 140 |
| 519 | 3300025940 | Ga0207691_11001790 | Ga0207691_110017901 | 140 |
| 520 | 3300025940 | Ga0207691_11104369 | Ga0207691_111043692 | 140 |
| 521 | 3300025941 | Ga0207711_10017070 | Ga0207711_100170705 | 140 |
| 522 | 3300025941 | Ga0207711_10326518 | Ga0207711_103265182 | 140 |
| 523 | 3300025941 | Ga0207711_10706805 | Ga0207711_107068052 | 140 |
| 524 | 3300025941 | Ga0207711_10744584 | Ga0207711_107445841 | 140 |
| 525 | 3300025942 | Ga0207689_10062906 | Ga0207689_100629062 | 140 |
| 526 | 3300025942 | Ga0207689_10098021 | Ga0207689_100980211 | 140 |
| 527 | 3300025942 | Ga0207689_10126880 | Ga0207689_101268802 | 140 |
| 528 | 3300025942 | Ga0207689_10976221 | Ga0207689_109762211 | 140 |
| 529 | 3300025942 | Ga0207689_11766422 | Ga0207689_117664221 | 140 |
| 530 | 3300025945 | Ga0207679_10269235 | Ga0207679_102692351 | 140 |
| 531 | 3300025960 | Ga0207651_10067972 | Ga0207651_100679721 | 140 |
| 532 | 3300025960 | Ga0207651_10092515 | Ga0207651_100925152 | 140 |
| 533 | 3300025960 | Ga0207651_10894976 | Ga0207651_108949761 | 140 |
| 534 | 3300025961 | Ga0207712_10160611 | Ga0207712_101606112 | 140 |
| 535 | 3300025961 | Ga0207712_10264383 | Ga0207712_102643832 | 140 |
| 536 | 3300025972 | Ga0207668_10020400 | Ga0207668_100204006 | 140 |
| 537 | 3300025972 | Ga0207668_10119492 | Ga0207668_101194922 | 140 |
| 538 | 3300025981 | Ga0207640_10481006 | Ga0207640_104810062 | 140 |
| 539 | 3300025986 | Ga0207658_10164689 | Ga0207658_101646891 | 140 |
| 540 | 3300026023 | Ga0207677_10049114 | Ga0207677_100491145 | 140 |
| 541 | 3300026023 | Ga0207677_10072435 | Ga0207677_100724352 | 140 |
| 542 | 3300026023 | Ga0207677_10293404 | Ga0207677_102934042 | 140 |
| 543 | 3300026035 | Ga0207703_10018700 | Ga0207703_100187004 | 140 |
| 544 | 3300026035 | Ga0207703_10049343 | Ga0207703_100493432 | 140 |
| 545 | 3300026035 | Ga0207703_10098033 | Ga0207703_100980331 | 140 |
| 546 | 3300026035 | Ga0207703_10832495 | Ga0207703_108324951 | 140 |
| 547 | 3300026035 | Ga0207703_11322021 | Ga0207703_113220211 | 140 |
| 548 | 3300026041 | Ga0207639_11918236 | Ga0207639_119182361 | 140 |
| 549 | 3300026075 | Ga0207708_10007652 | Ga0207708_100076522 | 140 |
| 550 | 3300026075 | Ga0207708_10182024 | Ga0207708_101820242 | 140 |
| 551 | 3300026075 | Ga0207708_10858991 | Ga0207708_108589911 | 140 |
| 552 | 3300026075 | Ga0207708_10979487 | Ga0207708_109794871 | 140 |
| 553 | 3300026088 | Ga0207641_10003384 | Ga0207641_1000338412 | 140 |
| 554 | 3300026088 | Ga0207641_10118665 | Ga0207641_101186652 | 140 |
| 555 | 3300026088 | Ga0207641_10334468 | Ga0207641_103344681 | 140 |
| 556 | 3300026089 | Ga0207648_10010834 | Ga0207648_100108342 | 140 |
| 557 | 3300026089 | Ga0207648_10024894 | Ga0207648_100248942 | 140 |
| 558 | 3300026089 | Ga0207648_10255069 | Ga0207648_102550691 | 140 |
| 559 | 3300026089 | Ga0207648_10728570 | Ga0207648_107285701 | 140 |
| 560 | 3300026095 | Ga0207676_10124312 | Ga0207676_101243121 | 140 |
| 561 | 3300026095 | Ga0207676_10598833 | Ga0207676_105988331 | 140 |
| 562 | 3300026116 | Ga0207674_10769606 | Ga0207674_107696061 | 140 |
| 563 | 3300026118 | Ga0207675_100009579 | Ga0207675_1000095795 | 140 |
| 564 | 3300026118 | Ga0207675_100018853 | Ga0207675_1000188533 | 140 |
| 565 | 3300026118 | Ga0207675_100090323 | Ga0207675_1000903235 | 140 |
| 566 | 3300026118 | Ga0207675_100195166 | Ga0207675_1001951662 | 140 |
| 567 | 3300026118 | Ga0207675_101298793 | Ga0207675_1012987931 | 140 |
| 568 | 3300026121 | Ga0207683_10299021 | Ga0207683_102990211 | 140 |
| 569 | 3300026121 | Ga0207683_10368850 | Ga0207683_103688501 | 140 |
| 570 | 3300026142 | Ga0207698_10936022 | Ga0207698_109360222 | 140 |
| 571 | 3300027907 | Ga0207428_10009852 | Ga0207428_100098526 | 140 |
| 572 | 3300027907 | Ga0207428_10197964 | Ga0207428_101979642 | 140 |
| 573 | 3300028379 | Ga0268266_10021105 | Ga0268266_100211055 | 140 |
| 574 | 3300028379 | Ga0268266_10027981 | Ga0268266_100279811 | 140 |
| 575 | 3300028379 | Ga0268266_10282492 | Ga0268266_102824921 | 140 |
| 576 | 3300028380 | Ga0268265_10037208 | Ga0268265_100372082 | 140 |
| 577 | 3300028380 | Ga0268265_10193941 | Ga0268265_101939411 | 140 |
| 578 | 3300028380 | Ga0268265_10195921 | Ga0268265_101959212 | 140 |
| 579 | 3300028380 | Ga0268265_10236695 | Ga0268265_102366952 | 140 |
| 580 | 3300028380 | Ga0268265_11225639 | Ga0268265_112256391 | 140 |
| 581 | 3300028380 | Ga0268265_11955376 | Ga0268265_119553761 | 140 |
| 582 | 3300028381 | Ga0268264_10261470 | Ga0268264_102614701 | 140 |
| 583 | 3300028381 | Ga0268264_11053213 | Ga0268264_110532131 | 140 |
| 584 | 3300028381 | Ga0268264_11203960 | Ga0268264_112039602 | 140 |
| 585 | 3300028381 | Ga0268264_11459379 | Ga0268264_114593791 | 140 |
| 586 | 3300028381 | Ga0268264_11972105 | Ga0268264_119721051 | 140 |
| 587 | 3300028381 | Ga0268264_12028678 | Ga0268264_120286781 | 140 |
| 588 | 3300031456 | Ga0307513_10717989 | Ga0307513_107179891 | 140 |
| 589 | 3300035088 | Ga0373940_0097960 | Ga0373940_0097960_340_804 | 140 |
| 590 | 3300035088 | Ga0373940_0173544 | Ga0373940_0173544_218_679 | 140 |
| 591 | 3300035092 | Ga0373952_0181907 | Ga0373952_0181907_59_523 | 140 |
| 592 | 3300035112 | Ga0373932_0187733 | Ga0373932_0187733_162_620 | 140 |
| 593 | 3300035114 | Ga0373939_0352510 | Ga0373939_0352510_69_527 | 140 |
| 594 | 3300035171 | Ga0373946_0758373 | Ga0373946_0758373_33_491 | 140 |
| 595 | 3300035242 | Ga0373962_0315067 | Ga0373962_0315067_29_487 | 140 |
| 596 | 3300035692 | Ga0373935_1060319 | Ga0373935_1060319_83_541 | 140 |
| 597 | 3300035695 | Ga0373927_0751605 | Ga0373927_0751605_84_542 | 140 |
| 598 | 3300036401 | Ga0373937_0184799 | Ga0373937_0184799_638_1096 | 140 |
| 599 | 3300036401 | Ga0373937_0321999 | Ga0373937_0321999_914_1372 | 140 |
| 600 | 3300037068 | Ga0373925_0367122 | Ga0373925_0367122_576_1034 | 140 |
| 601 | 3300037068 | Ga0373925_0443496 | Ga0373925_0443496_108_566 | 140 |
| 602 | 3300046514 | Ga0495618_0346744 | Ga0495618_0346744_186_644 | 140 |
| 603 | 3300046616 | Ga0495668_0236712 | Ga0495668_0236712_452_910 | 140 |
| 604 | 3300046681 | Ga0495647_0413367 | Ga0495647_0413367_30_488 | 140 |
| 605 | 3300046681 | Ga0495647_0524008 | Ga0495647_0524008_51_509 | 140 |
| 606 | 3300046683 | Ga0495658_0152615 | Ga0495658_0152615_78_536 | 140 |
| 607 | 3300046809 | Ga0495600_0742621 | Ga0495600_0742621_69_527 | 140 |
| 608 | 3300048905 | Ga0496102_1025027 | Ga0496102_1025027_198_662 | 140 |
| 609 | 3300048907 | Ga0496104_0653946 | Ga0496104_0653946_325_783 | 140 |
| 610 | 3300048907 | Ga0496104_0988985 | Ga0496104_0988985_261_719 | 140 |
| 611 | 3300048909 | Ga0496106_0529286 | Ga0496106_0529286_94_570 | 140 |
| 612 | 3300048909 | Ga0496106_1387091 | Ga0496106_1387091_14_478 | 140 |
| 613 | 3300048911 | Ga0496108_0007563 | Ga0496108_0007563_6298_6756 | 140 |
| 614 | 3300048912 | Ga0496109_0452958 | Ga0496109_0452958_133_597 | 140 |
| 615 | 3300048912 | Ga0496109_0699732 | Ga0496109_0699732_109_567 | 140 |
| 616 | 3300048912 | Ga0496109_1106733 | Ga0496109_1106733_26_490 | 140 |
| 617 | 3300048913 | Ga0496110_0638281 | Ga0496110_0638281_50_508 | 140 |
| 618 | 3300048913 | Ga0496110_1795235 | Ga0496110_1795235_13_477 | 140 |
| 619 | 3300048915 | Ga0496112_0020537 | Ga0496112_0020537_383_847 | 140 |
| 620 | 3300048915 | Ga0496112_0025438 | Ga0496112_0025438_1618_2076 | 140 |
| 621 | 3300048915 | Ga0496112_0382647 | Ga0496112_0382647_119_595 | 140 |
| 622 | 3300048916 | Ga0496113_0004808 | Ga0496113_0004808_3397_3855 | 140 |
| 623 | 3300048917 | Ga0496114_0045288 | Ga0496114_0045288_556_1014 | 140 |
| 624 | 3300048917 | Ga0496114_0834320 | Ga0496114_0834320_133_591 | 140 |
| 625 | 3300050494 | nmdc:mga06z11_535730_c1 | nmdc:mga06z11_535730_c1_49_507 | 140 |
| 626 | 3300050507 | nmdc:mga05p37_17259_c1 | nmdc:mga05p37_17259_c1_3673_4137 | 140 |
| 627 | 3300050507 | nmdc:mga05p37_198389_c1 | nmdc:mga05p37_198389_c1_1321_1779 | 140 |
| 628 | 3300050507 | nmdc:mga05p37_20496_c1 | nmdc:mga05p37_20496_c1_2651_3118 | 140 |
| 629 | 3300050507 | nmdc:mga05p37_30035_c1 | nmdc:mga05p37_30035_c1_1479_1943 | 140 |
| 630 | 3300050507 | nmdc:mga05p37_55895_c1 | nmdc:mga05p37_55895_c1_850_1311 | 140 |
| 631 | 3300050507 | nmdc:mga05p37_69327_c1 | nmdc:mga05p37_69327_c1_1171_1638 | 140 |
| 632 | 3300050507 | nmdc:mga05p37_70848_c1 | nmdc:mga05p37_70848_c1_629_1096 | 140 |
| 633 | 3300050507 | nmdc:mga05p37_73549_c1 | nmdc:mga05p37_73549_c1_2787_3251 | 140 |
| 634 | 3300050509 | nmdc:mga0qj67_536003_c1 | nmdc:mga0qj67_536003_c1_295_753 | 140 |
| 635 | 3300050511 | nmdc:mga08y16_19023_c1 | nmdc:mga08y16_19023_c1_4067_4525 | 140 |
| 636 | 3300050511 | nmdc:mga08y16_9065_c1 | nmdc:mga08y16_9065_c1_2310_2774 | 140 |
| 637 | 3300050511 | nmdc:mga08y16_93277_c1 | nmdc:mga08y16_93277_c1_2399_2857 | 140 |
| 638 | 3300050512 | nmdc:mga0n895_106738_c1 | nmdc:mga0n895_106738_c1_2267_2728 | 140 |
| 639 | 3300050512 | nmdc:mga0n895_1179991_c1 | nmdc:mga0n895_1179991_c1_186_644 | 140 |
| 640 | 3300050512 | nmdc:mga0n895_273931_c1 | nmdc:mga0n895_273931_c1_180_644 | 140 |
| 641 | 3300050512 | nmdc:mga0n895_299076_c1 | nmdc:mga0n895_299076_c1_818_1282 | 140 |
| 642 | 3300050512 | nmdc:mga0n895_338122_c1 | nmdc:mga0n895_338122_c1_833_1291 | 140 |
| 643 | 3300050512 | nmdc:mga0n895_350144_c1 | nmdc:mga0n895_350144_c1_613_1074 | 140 |
| 644 | 3300050512 | nmdc:mga0n895_494994_c1 | nmdc:mga0n895_494994_c1_717_1181 | 140 |
| 645 | 3300050513 | nmdc:mga0rr50_262953_c1 | nmdc:mga0rr50_262953_c1_254_712 | 140 |
| 646 | 3300050513 | nmdc:mga0rr50_44470_c1 | nmdc:mga0rr50_44470_c1_681_1142 | 140 |
| 647 | 3300050514 | nmdc:mga08x19_193570_c1 | nmdc:mga08x19_193570_c1_700_1161 | 140 |
| 648 | 3300050515 | nmdc:mga0a205_1227128_c1 | nmdc:mga0a205_1227128_c1_41_502 | 140 |
| 649 | 3300050515 | nmdc:mga0a205_27457_c1 | nmdc:mga0a205_27457_c1_2507_2971 | 140 |
| 650 | 3300050515 | nmdc:mga0a205_568775_c1 | nmdc:mga0a205_568775_c1_424_888 | 140 |
| 651 | 3300050515 | nmdc:mga0a205_74538_c1 | nmdc:mga0a205_74538_c1_2693_3160 | 140 |
| 652 | 3300053085 | Ga0495619_0033592 | Ga0495619_0033592_2796_3254 | 140 |
| 653 | 3300053094 | Ga0500566_0359688 | Ga0500566_0359688_62_520 | 140 |
| 654 | 3300053134 | Ga0500658_0265274 | Ga0500658_0265274_234_692 | 140 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar