F472882

General Info

Members Datasets Scaffolds Average Seq Length
654 259 654 151

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0108733|Ga0501031_0108733_72_494
Length 140
Sequence MARDRYAELRRILEERRREILGQVHEKIRDVRAEGANNPTTGVLDAAETSESDIQDDIEFALIQMKAETLSKIEEALRRLEAGTFGNCFECGEEISERRLRALPFALRCKDCEEAREVAQQRERMAQRRSSSALFMDVQG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
182 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
183 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
186 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
196 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
197 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
258 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.5
Metatranscriptomes 5.5
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 3.21
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 1.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10041870 3300002459 Unclassified 947
2 Ga0006759J45824_1087942 3300003163 Unclassified 503
3 Ga0007417J51691_1055896 3300003544 Bacteria 505
4 Ga0007409J51694_1029994 3300003575 Bacteria 531
5 Ga0007416J51690_1024618 3300003577 Unclassified 508
6 Ga0007416J51690_1032803 3300003577 Unclassified 557
7 Ga0007416J51690_1064437 3300003577 Bacteria 580
8 Ga0032354_1016568 3300003693 Bacteria 531
9 Ga0058859_10012198 3300004798 Bacteria 966
10 Ga0058859_10020515 3300004798 Unclassified 714
11 Ga0058859_10042413 3300004798 Bacteria 1120
12 Ga0058859_11724858 3300004798 Bacteria 898
13 Ga0058863_11855751 3300004799 Bacteria 795
14 Ga0058861_11956597 3300004800 Unclassified 1028
15 Ga0058860_10010261 3300004801 Bacteria 888
16 Ga0058860_10011861 3300004801 Unclassified 717
17 Ga0058860_10044748 3300004801 Bacteria 611
18 Ga0058860_12074596 3300004801 Unclassified 672
19 Ga0058860_12192347 3300004801 Bacteria 791
20 Ga0058862_12576226 3300004803 Bacteria 1137
21 Ga0065712_10080836 3300005290 Bacteria 3066
22 Ga0065707_10053155 3300005295 Bacteria 672
23 Ga0065707_10640402 3300005295 Unclassified 659
24 Ga0065707_10861655 3300005295 Unclassified 568
25 Ga0070676_10007361 3300005328 Bacteria 5906
26 Ga0070690_100336722 3300005330 Bacteria 1091
27 Ga0070670_100627779 3300005331 Bacteria 963
28 Ga0070670_100647936 3300005331 Bacteria 947
29 Ga0068869_100102397 3300005334 Bacteria 2167
30 Ga0068869_101429777 3300005334 Bacteria 613
31 Ga0068869_102114851 3300005334 Bacteria 506
32 Ga0070666_10015788 3300005335 Bacteria 4823
33 Ga0070666_10077364 3300005335 Bacteria 2271
34 Ga0070666_10440983 3300005335 Bacteria 939
35 Ga0070666_10980315 3300005335 Bacteria 626
36 Ga0070680_100307304 3300005336 Bacteria 1345
37 Ga0070680_101460501 3300005336 Unclassified 592
38 Ga0070682_100547364 3300005337 Bacteria 905
39 Ga0068868_100046061 3300005338 Bacteria 3413
40 Ga0068868_101981365 3300005338 Unclassified 552
41 Ga0070660_100000836 3300005339 Bacteria 20489
42 Ga0070689_100236365 3300005340 Bacteria 1504
43 Ga0070689_100411607 3300005340 Bacteria 1145
44 Ga0070691_10003956 3300005341 Bacteria 6703
45 Ga0070691_10144466 3300005341 Bacteria 1215
46 Ga0070687_100042608 3300005343 Bacteria 2301
47 Ga0070687_100140697 3300005343 Bacteria 1405
48 Ga0070687_100293952 3300005343 Unclassified 1028
49 Ga0070661_101036413 3300005344 Unclassified 682
50 Ga0070692_10642903 3300005345 Archaea 707
51 Ga0070692_10796043 3300005345 Bacteria 645
52 Ga0070692_11100254 3300005345 Bacteria 561
53 Ga0070668_100040765 3300005347 Bacteria 3554
54 Ga0070668_100085032 3300005347 Bacteria 2486
55 Ga0070668_100150652 3300005347 Bacteria 1881
56 Ga0070669_100009946 3300005353 Bacteria 6767
57 Ga0070669_100296388 3300005353 Bacteria 1300
58 Ga0070669_100341152 3300005353 Unclassified 1214
59 Ga0070669_100521645 3300005353 Bacteria 988
60 Ga0070669_100598340 3300005353 Bacteria 924
61 Ga0070675_100013846 3300005354 Bacteria 6350
62 Ga0070675_100190115 3300005354 Bacteria 1779
63 Ga0070675_100271732 3300005354 Bacteria 1488
64 Ga0070675_101364225 3300005354 Unclassified 654
65 Ga0070675_101495716 3300005354 Bacteria 623
66 Ga0070671_100107942 3300005355 Bacteria 2338
67 Ga0070674_100021954 3300005356 Bacteria 4110
68 Ga0070674_100628172 3300005356 Bacteria 911
69 Ga0070674_100804627 3300005356 Bacteria 812
70 Ga0070673_100008513 3300005364 Bacteria 6824
71 Ga0070673_100215837 3300005364 Bacteria 1658
72 Ga0070673_100220997 3300005364 Bacteria 1639
73 Ga0070673_100853521 3300005364 Bacteria 843
74 Ga0070688_100027444 3300005365 Bacteria 3393
75 Ga0070659_100045929 3300005366 Bacteria 3423
76 Ga0070667_100003098 3300005367 Bacteria 14304
77 Ga0070701_10014844 3300005438 Bacteria 3580
78 Ga0070701_10342811 3300005438 Unclassified 931
79 Ga0070701_11042617 3300005438 Bacteria 573
80 Ga0070705_100006397 3300005440 Bacteria 5774
81 Ga0070705_100306733 3300005440 Bacteria 1140
82 Ga0070700_100009994 3300005441 Bacteria 5223
83 Ga0070700_100235780 3300005441 Bacteria 1305
84 Ga0070694_100043331 3300005444 Bacteria 3009
85 Ga0070694_100055461 3300005444 Bacteria 2688
86 Ga0070694_100075315 3300005444 Bacteria 2334
87 Ga0070694_100842449 3300005444 Bacteria 754
88 Ga0070694_100988679 3300005444 Unclassified 698
89 Ga0070708_100226522 3300005445 Unclassified 1754
90 Ga0070708_100575575 3300005445 Unclassified 1062
91 Ga0070708_100590834 3300005445 Bacteria 1047
92 Ga0070662_100073811 3300005457 Bacteria 2522
93 Ga0070662_100212252 3300005457 Bacteria 1541
94 Ga0068867_100017807 3300005459 Bacteria 5045
95 Ga0068867_100035895 3300005459 Bacteria 3598
96 Ga0068867_100450432 3300005459 Bacteria 1096
97 Ga0068867_100601924 3300005459 Unclassified 959
98 Ga0070685_10050645 3300005466 Bacteria 2399
99 Ga0070685_10399112 3300005466 Bacteria 952
100 Ga0070706_100881929 3300005467 Bacteria 827
101 Ga0070706_101408595 3300005467 Bacteria 638
102 Ga0070707_100055131 3300005468 Bacteria 3811
103 Ga0070707_100063602 3300005468 Bacteria 3541
104 Ga0070707_100529782 3300005468 Bacteria 1140
105 Ga0070707_100535022 3300005468 Bacteria 1134
106 Ga0070707_101718690 3300005468 Unclassified 595
107 Ga0070698_101351453 3300005471 Bacteria 663
108 Ga0070699_100005856 3300005518 Bacteria 10738
109 Ga0070699_100059185 3300005518 Bacteria 3319
110 Ga0070699_100081109 3300005518 Bacteria 2828
111 Ga0070699_100124073 3300005518 Bacteria 2273
112 Ga0070699_101365233 3300005518 Unclassified 650
113 Ga0070679_100009668 3300005530 Bacteria 9122
114 Ga0070684_100429266 3300005535 Bacteria 1220
115 Ga0070684_100658896 3300005535 Bacteria 975
116 Ga0070697_100044923 3300005536 Bacteria 3579
117 Ga0070697_100123547 3300005536 Bacteria 2167
118 Ga0070697_100205846 3300005536 Bacteria 1674
119 Ga0070697_100262271 3300005536 Bacteria 1480
120 Ga0070697_100273294 3300005536 Bacteria 1449
121 Ga0070697_100470142 3300005536 Bacteria 1097
122 Ga0068853_100374852 3300005539 Unclassified 1328
123 Ga0068853_100920749 3300005539 Unclassified 840
124 Ga0070672_100217440 3300005543 Bacteria 1602
125 Ga0070672_100282374 3300005543 Bacteria 1404
126 Ga0070672_101851940 3300005543 Bacteria 543
127 Ga0070686_100001079 3300005544 Bacteria 15728
128 Ga0070686_100026480 3300005544 Bacteria 3500
129 Ga0070686_100218156 3300005544 Bacteria 1377
130 Ga0070686_100860001 3300005544 Unclassified 735
131 Ga0070695_100003966 3300005545 Bacteria 8646
132 Ga0070695_100059171 3300005545 Bacteria 2480
133 Ga0070696_100004210 3300005546 Bacteria 9582
134 Ga0070696_100196948 3300005546 Bacteria 1502
135 Ga0070696_100557541 3300005546 Bacteria 919
136 Ga0070696_100892769 3300005546 Unclassified 737
137 Ga0070665_100001584 3300005548 Bacteria 26229
138 Ga0070665_100046665 3300005548 Bacteria 4350
139 Ga0070665_100337790 3300005548 Bacteria 1511
140 Ga0070704_100006282 3300005549 Bacteria 6993
141 Ga0070704_100024925 3300005549 Bacteria 3931
142 Ga0070704_100084274 3300005549 Bacteria 2349
143 Ga0070704_100264554 3300005549 Bacteria 1418
144 Ga0070704_101087673 3300005549 Bacteria 726
145 Ga0068855_100035602 3300005563 Bacteria 5929
146 Ga0070664_100351389 3300005564 Unclassified 1341
147 Ga0070664_100455017 3300005564 Bacteria 1176
148 Ga0070664_100811939 3300005564 Unclassified 875
149 Ga0068857_101955190 3300005577 Bacteria 575
150 Ga0068854_100028184 3300005578 Bacteria 3878
151 Ga0068854_101469754 3300005578 Bacteria 618
152 Ga0068856_101130914 3300005614 Bacteria 800
153 Ga0070702_100010666 3300005615 Bacteria 4537
154 Ga0070702_100576059 3300005615 Bacteria 840
155 Ga0068852_100703189 3300005616 Bacteria 1021
156 Ga0068859_100089881 3300005617 Bacteria 3122
157 Ga0068859_100121126 3300005617 Bacteria 2682
158 Ga0068859_100716758 3300005617 Bacteria 1090
159 Ga0068859_100831624 3300005617 Bacteria 1010
160 Ga0068859_101115345 3300005617 Unclassified 868
161 Ga0068859_102062956 3300005617 Bacteria 629
162 Ga0068864_100007222 3300005618 Bacteria 9129
163 Ga0068864_100520188 3300005618 Bacteria 1147
164 Ga0068864_100837469 3300005618 Unclassified 906
165 Ga0068864_100897840 3300005618 Unclassified 875
166 Ga0068866_10189424 3300005718 Bacteria 1221
167 Ga0068866_10312683 3300005718 Unclassified 985
168 Ga0068866_10381775 3300005718 Bacteria 904
169 Ga0068866_10807512 3300005718 Bacteria 653
170 Ga0068861_100020467 3300005719 Bacteria 4740
171 Ga0068861_100048067 3300005719 Bacteria 3223
172 Ga0068861_100187867 3300005719 Unclassified 1725
173 Ga0068861_100516354 3300005719 Bacteria 1083
174 Ga0068870_10184499 3300005840 Unclassified 1255
175 Ga0068863_100024942 3300005841 Bacteria 5703
176 Ga0068863_100316245 3300005841 Bacteria 1516
177 Ga0068863_100433449 3300005841 Bacteria 1289
178 Ga0068858_100005983 3300005842 Bacteria 11881
179 Ga0068858_100028204 3300005842 Bacteria 5216
180 Ga0068858_100091242 3300005842 Unclassified 2835
181 Ga0068858_100232073 3300005842 Bacteria 1750
182 Ga0068858_100305907 3300005842 Bacteria 1517
183 Ga0068858_100514591 3300005842 Unclassified 1157
184 Ga0068858_100548122 3300005842 Unclassified 1119
185 Ga0068858_100953519 3300005842 Unclassified 840
186 Ga0068858_101384016 3300005842 Bacteria 693
187 Ga0068860_100147694 3300005843 Bacteria 2263
188 Ga0068860_100339257 3300005843 Bacteria 1477
189 Ga0068860_101395326 3300005843 Unclassified 722
190 Ga0068862_100010134 3300005844 Bacteria 7780
191 Ga0068862_100090251 3300005844 Bacteria 2667
192 Ga0068862_100159220 3300005844 Bacteria 2014
193 Ga0068862_100239710 3300005844 Bacteria 1648
194 Ga0068862_100607829 3300005844 Unclassified 1050
195 Ga0081540_1109273 3300005983 Bacteria 1173
196 Ga0081539_10150201 3300005985 Bacteria 1121
197 Ga0081539_10354510 3300005985 Unclassified 616
198 Ga0070717_11019278 3300006028 Unclassified 754
199 Ga0075432_10050940 3300006058 Bacteria 1461
200 Ga0097621_100023036 3300006237 Bacteria 4843
201 Ga0097621_100039877 3300006237 Bacteria 3773
202 Ga0097621_100152114 3300006237 Bacteria 1984
203 Ga0097621_100766714 3300006237 Unclassified 892
204 Ga0068871_100051028 3300006358 Bacteria 3348
205 Ga0068871_100072257 3300006358 Bacteria 2841
206 Ga0068871_100287788 3300006358 Bacteria 1439
207 Ga0068871_100357150 3300006358 Unclassified 1294
208 Ga0068871_100505512 3300006358 Bacteria 1090
209 Ga0075428_100651253 3300006844 Bacteria 1123
210 Ga0075428_100825245 3300006844 Bacteria 985
211 Ga0075428_101051954 3300006844 Bacteria 861
212 Ga0075433_10009068 3300006852 Bacteria 7947
213 Ga0075433_10029899 3300006852 Bacteria 4644
214 Ga0075433_10036743 3300006852 Bacteria 4221
215 Ga0075433_10544341 3300006852 Bacteria 1021
216 Ga0075433_10601132 3300006852 Unclassified 966
217 Ga0075433_10821816 3300006852 Unclassified 812
218 Ga0075433_11037467 3300006852 Bacteria 714
219 Ga0075433_11791430 3300006852 Unclassified 528
220 Ga0075434_100001358 3300006871 Bacteria 20536
221 Ga0075434_100212446 3300006871 Bacteria 1955
222 Ga0075434_100292511 3300006871 Bacteria 1649
223 Ga0075434_100347233 3300006871 Bacteria 1505
224 Ga0075434_100401017 3300006871 Unclassified 1392
225 Ga0075434_100404417 3300006871 Unclassified 1386
226 Ga0075434_100431136 3300006871 Bacteria 1339
227 Ga0075434_100440153 3300006871 Bacteria 1325
228 Ga0075434_101082346 3300006871 Bacteria 815
229 Ga0075434_101655586 3300006871 Bacteria 648
230 Ga0075429_100674754 3300006880 Unclassified 905
231 Ga0068865_100020372 3300006881 Bacteria 4299
232 Ga0075436_100022532 3300006914 Bacteria 4325
233 Ga0075436_100060059 3300006914 Unclassified 2626
234 Ga0075436_100394688 3300006914 Unclassified 1002
235 Ga0097620_100089880 3300006931 Bacteria 3122
236 Ga0097620_100121124 3300006931 Bacteria 2682
237 Ga0097620_100716726 3300006931 Bacteria 1090
238 Ga0097620_100831636 3300006931 Bacteria 1010
239 Ga0097620_101115230 3300006931 Unclassified 868
240 Ga0097620_102062961 3300006931 Bacteria 629
241 Ga0075435_100005188 3300007076 Bacteria 9061
242 Ga0075435_100010927 3300007076 Bacteria 6653
243 Ga0075435_100011725 3300007076 Bacteria 6466
244 Ga0075435_100216351 3300007076 Bacteria 1626
245 Ga0075435_100222828 3300007076 Bacteria 1602
246 Ga0075435_100312131 3300007076 Bacteria 1346
247 Ga0099794_10013634 3300007265 Bacteria 3543
248 Ga0099794_10249847 3300007265 Unclassified 914
249 Ga0105240_10026532 3300009093 Bacteria 7600
250 Ga0105240_10261493 3300009093 Bacteria 1996
251 Ga0105240_10527742 3300009093 Bacteria 1309
252 Ga0105240_10661791 3300009093 Unclassified 1143
253 Ga0111539_10024118 3300009094 Bacteria 7470
254 Ga0111539_10076803 3300009094 Bacteria 3932
255 Ga0111539_10417045 3300009094 Bacteria 1564
256 Ga0105245_10005562 3300009098 Bacteria 11072
257 Ga0105245_10340071 3300009098 Unclassified 1484
258 Ga0105245_10491066 3300009098 Bacteria 1242
259 Ga0105245_10634109 3300009098 Bacteria 1098
260 Ga0105245_11906782 3300009098 Unclassified 647
261 Ga0105245_12180346 3300009098 Bacteria 608
262 Ga0105247_10044351 3300009101 Bacteria 2727
263 Ga0105247_10076554 3300009101 Unclassified 2101
264 Ga0105247_10499227 3300009101 Unclassified 886
265 Ga0105247_10967077 3300009101 Bacteria 662
266 Ga0114129_10001158 3300009147 Bacteria 34926
267 Ga0114129_10002835 3300009147 Bacteria 24213
268 Ga0114129_10004994 3300009147 Bacteria 18697
269 Ga0114129_10013237 3300009147 Bacteria 11749
270 Ga0114129_10058744 3300009147 Bacteria 5380
271 Ga0114129_10078869 3300009147 Bacteria 4579
272 Ga0114129_10113794 3300009147 Bacteria 3731
273 Ga0114129_10221600 3300009147 Unclassified 2551
274 Ga0114129_10606629 3300009147 Unclassified 1417
275 Ga0114129_10650462 3300009147 Bacteria 1360
276 Ga0105243_10031944 3300009148 Bacteria 4063
277 Ga0105243_10070836 3300009148 Bacteria 2817
278 Ga0105243_10682484 3300009148 Bacteria 999
279 Ga0105241_10098154 3300009174 Bacteria 2324
280 Ga0105241_10214886 3300009174 Bacteria 1613
281 Ga0105241_10369205 3300009174 Bacteria 1251
282 Ga0105242_10059020 3300009176 Bacteria 3147
283 Ga0105242_10069666 3300009176 Bacteria 2914
284 Ga0105242_10116565 3300009176 Bacteria 2285
285 Ga0105242_11022379 3300009176 Unclassified 836
286 Ga0105242_11149823 3300009176 Unclassified 793
287 Ga0105248_10001680 3300009177 Bacteria 24638
288 Ga0105248_10024153 3300009177 Bacteria 6755
289 Ga0105248_10042724 3300009177 Bacteria 5083
290 Ga0105248_10238539 3300009177 Bacteria 2047
291 Ga0105248_10330143 3300009177 Bacteria 1718
292 Ga0105248_10476273 3300009177 Bacteria 1407
293 Ga0105248_10709429 3300009177 Bacteria 1135
294 Ga0105248_10857596 3300009177 Bacteria 1025
295 Ga0105248_11268784 3300009177 Bacteria 833
296 Ga0105237_10880228 3300009545 Unclassified 902
297 Ga0105238_10259192 3300009551 Bacteria 1718
298 Ga0105238_10703068 3300009551 Unclassified 1023
299 Ga0105238_11020777 3300009551 Unclassified 848
300 Ga0105238_11185358 3300009551 Unclassified 788
301 Ga0105249_10140625 3300009553 Unclassified 2314
302 Ga0105239_10492690 3300010375 Bacteria 1393
303 Ga0105246_10434521 3300011119 Bacteria 1099
304 Ga0105246_10523396 3300011119 Bacteria 1011
305 Ga0105246_10784600 3300011119 Unclassified 844
306 Ga0157374_10002908 3300013296 Bacteria 14342
307 Ga0157374_10576824 3300013296 Bacteria 1134
308 Ga0157374_10612772 3300013296 Bacteria 1099
309 Ga0157378_10113074 3300013297 Bacteria 2492
310 Ga0157378_10619841 3300013297 Unclassified 1095
311 Ga0157378_10701634 3300013297 Bacteria 1031
312 Ga0157378_10782445 3300013297 Bacteria 979
313 Ga0157378_12034972 3300013297 Unclassified 624
314 Ga0163162_10091514 3300013306 Bacteria 3125
315 Ga0163162_10300919 3300013306 Bacteria 1736
316 Ga0163162_10621117 3300013306 Bacteria 1206
317 Ga0163162_10794438 3300013306 Bacteria 1064
318 Ga0163162_11472843 3300013306 Bacteria 775
319 Ga0157375_10164112 3300013308 Bacteria 2365
320 Ga0157375_10422062 3300013308 Bacteria 1500
321 Ga0163163_10025482 3300014325 Bacteria 5638
322 Ga0163163_10641094 3300014325 Unclassified 1126
323 Ga0157380_10057779 3300014326 Bacteria 3091
324 Ga0157380_10058080 3300014326 Bacteria 3083
325 Ga0157380_10062361 3300014326 Bacteria 2986
326 Ga0157380_10168723 3300014326 Bacteria 1910
327 Ga0157380_10704218 3300014326 Bacteria 1015
328 Ga0157377_10061537 3300014745 Bacteria 2146
329 Ga0157377_10144034 3300014745 Bacteria 1467
330 Ga0157379_10021810 3300014968 Bacteria 5674
331 Ga0157379_10035792 3300014968 Bacteria 4427
332 Ga0157379_10137202 3300014968 Bacteria 2204
333 Ga0157379_10404943 3300014968 Bacteria 1255
334 Ga0157379_11897119 3300014968 Bacteria 587
335 Ga0157376_10197336 3300014969 Bacteria 1849
336 Ga0197907_10089739 3300020069 Unclassified 803
337 Ga0206356_10536623 3300020070 Bacteria 507
338 Ga0206349_1538291 3300020075 Bacteria 843
339 Ga0206351_10264964 3300020077 Bacteria 886
340 Ga0206352_10542349 3300020078 Bacteria 580
341 Ga0206350_10392355 3300020080 Bacteria 651
342 Ga0206350_10997823 3300020080 Unclassified 765
343 Ga0206354_10661468 3300020081 Bacteria 843
344 Ga0154015_1520739 3300020610 Bacteria 704
345 Ga0207642_10021957 3300025899 Bacteria 2522
346 Ga0207642_10054388 3300025899 Bacteria 1826
347 Ga0207710_10052308 3300025900 Unclassified 1836
348 Ga0207688_10018413 3300025901 Bacteria 3801
349 Ga0207680_10037738 3300025903 Bacteria 2791
350 Ga0207680_10060092 3300025903 Bacteria 2312
351 Ga0207680_10208049 3300025903 Bacteria 1336
352 Ga0207680_10245895 3300025903 Bacteria 1234
353 Ga0207680_10591817 3300025903 Unclassified 793
354 Ga0207645_10005026 3300025907 Bacteria 9690
355 Ga0207645_10066299 3300025907 Bacteria 2308
356 Ga0207645_10091249 3300025907 Unclassified 1959
357 Ga0207645_10473116 3300025907 Unclassified 847
358 Ga0207684_10580735 3300025910 Unclassified 958
359 Ga0207684_10620714 3300025910 Bacteria 922
360 Ga0207654_10047220 3300025911 Bacteria 2459
361 Ga0207654_10144423 3300025911 Bacteria 1521
362 Ga0207695_10040063 3300025913 Bacteria 5029
363 Ga0207695_10387455 3300025913 Bacteria 1283
364 Ga0207695_10666866 3300025913 Unclassified 921
365 Ga0207660_10481175 3300025917 Bacteria 1006
366 Ga0207662_10040029 3300025918 Bacteria 2753
367 Ga0207662_10274011 3300025918 Bacteria 1114
368 Ga0207657_10002566 3300025919 Bacteria 19652
369 Ga0207649_10668703 3300025920 Bacteria 804
370 Ga0207652_10047748 3300025921 Bacteria 3657
371 Ga0207646_10037144 3300025922 Bacteria 4393
372 Ga0207646_10542943 3300025922 Bacteria 1046
373 Ga0207646_10574360 3300025922 Bacteria 1013
374 Ga0207681_10011395 3300025923 Bacteria 5464
375 Ga0207681_10023797 3300025923 Bacteria 3922
376 Ga0207681_10056942 3300025923 Bacteria 2669
377 Ga0207681_10407822 3300025923 Bacteria 1099
378 Ga0207681_10425010 3300025923 Unclassified 1077
379 Ga0207694_10174097 3300025924 Bacteria 1743
380 Ga0207694_10240751 3300025924 Bacteria 1479
381 Ga0207694_10517427 3300025924 Unclassified 1000
382 Ga0207694_10840819 3300025924 Bacteria 776
383 Ga0207650_10216343 3300025925 Bacteria 1540
384 Ga0207650_10714817 3300025925 Bacteria 847
385 Ga0207659_10012872 3300025926 Bacteria 5341
386 Ga0207659_10061202 3300025926 Bacteria 2712
387 Ga0207659_10613471 3300025926 Bacteria 928
388 Ga0207687_10152252 3300025927 Bacteria 1766
389 Ga0207687_10390822 3300025927 Bacteria 1142
390 Ga0207687_10444584 3300025927 Bacteria 1074
391 Ga0207687_10967909 3300025927 Bacteria 729
392 Ga0207644_10054463 3300025931 Bacteria 2881
393 Ga0207644_10509380 3300025931 Bacteria 993
394 Ga0207690_10238828 3300025932 Bacteria 1399
395 Ga0207706_10044665 3300025933 Bacteria 3927
396 Ga0207706_10325930 3300025933 Bacteria 1336
397 Ga0207686_10017277 3300025934 Bacteria 4064
398 Ga0207686_10132681 3300025934 Bacteria 1710
399 Ga0207686_10425479 3300025934 Bacteria 1017
400 Ga0207686_10528227 3300025934 Unclassified 919
401 Ga0207686_10742376 3300025934 Unclassified 783
402 Ga0207686_11315030 3300025934 Bacteria 594
403 Ga0207709_10013731 3300025935 Bacteria 4469
404 Ga0207709_10117654 3300025935 Bacteria 1789
405 Ga0207709_10423126 3300025935 Unclassified 1023
406 Ga0207670_10024968 3300025936 Bacteria 3743
407 Ga0207670_10091712 3300025936 Bacteria 2149
408 Ga0207669_10008920 3300025937 Bacteria 4740
409 Ga0207669_10017472 3300025937 Bacteria 3680
410 Ga0207669_10610922 3300025937 Bacteria 887
411 Ga0207669_10667734 3300025937 Bacteria 851
412 Ga0207669_10710235 3300025937 Unclassified 827
413 Ga0207704_10048575 3300025938 Bacteria 2545
414 Ga0207691_10152521 3300025940 Bacteria 2031
415 Ga0207691_10240168 3300025940 Bacteria 1566
416 Ga0207691_10251672 3300025940 Bacteria 1525
417 Ga0207691_10272470 3300025940 Bacteria 1457
418 Ga0207691_10467458 3300025940 Unclassified 1072
419 Ga0207691_11001790 3300025940 Bacteria 697
420 Ga0207691_11104369 3300025940 Bacteria 660
421 Ga0207711_10017070 3300025941 Bacteria 6030
422 Ga0207711_10326518 3300025941 Bacteria 1418
423 Ga0207711_10706805 3300025941 Bacteria 940
424 Ga0207711_10744584 3300025941 Bacteria 914
425 Ga0207711_11396234 3300025941 Archaea 643
426 Ga0207711_11689872 3300025941 Unclassified 576
427 Ga0207689_10062906 3300025942 Bacteria 3052
428 Ga0207689_10098021 3300025942 Bacteria 2408
429 Ga0207689_10126880 3300025942 Bacteria 2099
430 Ga0207689_10976221 3300025942 Unclassified 715
431 Ga0207689_11766422 3300025942 Bacteria 511
432 Ga0207679_10269235 3300025945 Bacteria 1456
433 Ga0207679_10377023 3300025945 Bacteria 1243
434 Ga0207667_10164877 3300025949 Bacteria 2278
435 Ga0207667_10510551 3300025949 Unclassified 1218
436 Ga0207651_10007618 3300025960 Bacteria 5778
437 Ga0207651_10067972 3300025960 Bacteria 2510
438 Ga0207651_10092515 3300025960 Bacteria 2218
439 Ga0207651_10894976 3300025960 Bacteria 790
440 Ga0207712_10160611 3300025961 Unclassified 1746
441 Ga0207712_10264383 3300025961 Bacteria 1397
442 Ga0207668_10020400 3300025972 Bacteria 4210
443 Ga0207668_10119492 3300025972 Bacteria 1993
444 Ga0207640_10016889 3300025981 Bacteria 4256
445 Ga0207640_10105381 3300025981 Bacteria 1987
446 Ga0207640_10481006 3300025981 Bacteria 1030
447 Ga0207658_10164689 3300025986 Bacteria 1820
448 Ga0207677_10049114 3300026023 Bacteria 2845
449 Ga0207677_10072435 3300026023 Unclassified 2435
450 Ga0207677_10293404 3300026023 Bacteria 1340
451 Ga0207703_10018700 3300026035 Bacteria 5412
452 Ga0207703_10029188 3300026035 Bacteria 4351
453 Ga0207703_10049343 3300026035 Bacteria 3403
454 Ga0207703_10098033 3300026035 Bacteria 2478
455 Ga0207703_10300439 3300026035 Unclassified 1464
456 Ga0207703_10832495 3300026035 Unclassified 882
457 Ga0207703_11322021 3300026035 Bacteria 693
458 Ga0207639_11918236 3300026041 Bacteria 553
459 Ga0207708_10007652 3300026075 Bacteria 7994
460 Ga0207708_10182024 3300026075 Bacteria 1669
461 Ga0207708_10858991 3300026075 Bacteria 784
462 Ga0207708_10887617 3300026075 Unclassified 771
463 Ga0207708_10979487 3300026075 Bacteria 734
464 Ga0207702_10324564 3300026078 Bacteria 1467
465 Ga0207702_10418180 3300026078 Bacteria 1296
466 Ga0207641_10003384 3300026088 Bacteria 14155
467 Ga0207641_10118665 3300026088 Bacteria 2357
468 Ga0207641_10334468 3300026088 Bacteria 1439
469 Ga0207641_10626651 3300026088 Bacteria 1055
470 Ga0207648_10010834 3300026089 Bacteria 8617
471 Ga0207648_10024894 3300026089 Bacteria 5337
472 Ga0207648_10255069 3300026089 Bacteria 1564
473 Ga0207648_10308876 3300026089 Unclassified 1419
474 Ga0207648_10728570 3300026089 Bacteria 920
475 Ga0207648_11385706 3300026089 Unclassified 661
476 Ga0207648_11481812 3300026089 Unclassified 638
477 Ga0207676_10124312 3300026095 Bacteria 2181
478 Ga0207676_10598833 3300026095 Bacteria 1058
479 Ga0207674_10769606 3300026116 Bacteria 929
480 Ga0207675_100009579 3300026118 Bacteria 9061
481 Ga0207675_100018853 3300026118 Bacteria 6439
482 Ga0207675_100090323 3300026118 Bacteria 2880
483 Ga0207675_100100456 3300026118 Bacteria 2725
484 Ga0207675_100123677 3300026118 Bacteria 2449
485 Ga0207675_100195166 3300026118 Unclassified 1943
486 Ga0207675_100293260 3300026118 Bacteria 1583
487 Ga0207675_101298793 3300026118 Bacteria 748
488 Ga0207683_10299021 3300026121 Bacteria 1472
489 Ga0207683_10368850 3300026121 Bacteria 1319
490 Ga0207698_10936022 3300026142 Unclassified 875
491 Ga0207428_10009852 3300027907 Bacteria 8558
492 Ga0207428_10197964 3300027907 Bacteria 1512
493 Ga0268266_10021105 3300028379 Bacteria 5549
494 Ga0268266_10027981 3300028379 Bacteria 4793
495 Ga0268266_10282492 3300028379 Bacteria 1544
496 Ga0268265_10037208 3300028380 Bacteria 3570
497 Ga0268265_10193941 3300028380 Bacteria 1756
498 Ga0268265_10195921 3300028380 Bacteria 1748
499 Ga0268265_10236695 3300028380 Unclassified 1608
500 Ga0268265_11225639 3300028380 Unclassified 748
501 Ga0268265_11955376 3300028380 Unclassified 593
502 Ga0268264_10261470 3300028381 Bacteria 1612
503 Ga0268264_11053213 3300028381 Unclassified 821
504 Ga0268264_11203960 3300028381 Unclassified 767
505 Ga0268264_11459379 3300028381 Bacteria 695
506 Ga0268264_11972105 3300028381 Unclassified 593
507 Ga0268264_12028678 3300028381 Bacteria 584
508 Ga0307513_10717989 3300031456 Unclassified 705
509 Ga0307408_100121216 3300031548 Bacteria 2026
510 Ga0307408_101254648 3300031548 Bacteria 693
511 Ga0307413_10154911 3300031824 Unclassified 1602
512 Ga0307410_10089499 3300031852 Bacteria 2181
513 Ga0307407_10030456 3300031903 Bacteria 2911
514 Ga0307412_10231257 3300031911 Bacteria 1424
515 Ga0307409_100036041 3300031995 Bacteria 3631
516 Ga0307414_10216335 3300032004 Unclassified 1570
517 Ga0373930_0003565 3300034816 Unclassified 2477
518 Ga0373950_0000568 3300034818 Bacteria 4538
519 Ga0373959_0004952 3300034820 Bacteria 2171
520 Ga0373929_0000093 3300035085 Bacteria 14945
521 Ga0373929_0016466 3300035085 Bacteria 1449
522 Ga0373940_0000166 3300035088 Bacteria 8802
523 Ga0373940_0097960 3300035088 Unclassified 887
524 Ga0373940_0173544 3300035088 Bacteria 698
525 Ga0373949_0001403 3300035090 Bacteria 6906
526 Ga0373952_0181907 3300035092 Bacteria 607
527 Ga0373932_0001847 3300035112 Bacteria 5673
528 Ga0373932_0187733 3300035112 Bacteria 729
529 Ga0373939_0000289 3300035114 Bacteria 13260
530 Ga0373939_0352510 3300035114 Bacteria 599
531 Ga0373941_0230637 3300035115 Bacteria 715
532 Ga0373956_0133396 3300035119 Bacteria 1164
533 Ga0373960_0001238 3300035121 Bacteria 5597
534 Ga0373960_0138099 3300035121 Unclassified 823
535 Ga0373946_0758373 3300035171 Bacteria 510
536 Ga0373961_0000432 3300035241 Bacteria 17284
537 Ga0373962_0000263 3300035242 Bacteria 11245
538 Ga0373962_0315067 3300035242 Bacteria 558
539 Ga0373924_0046697 3300035410 Bacteria 1785
540 Ga0373931_0055104 3300035691 Bacteria 2126
541 Ga0373931_0107654 3300035691 Bacteria 1577
542 Ga0373935_1060319 3300035692 Unclassified 603
543 Ga0373927_0751605 3300035695 Unclassified 644
544 Ga0373937_0068808 3300036401 Bacteria 3264
545 Ga0373937_0184799 3300036401 Bacteria 1958
546 Ga0373937_0321999 3300036401 Bacteria 1463
547 Ga0373925_0367122 3300037068 Bacteria 1171
548 Ga0373925_0443496 3300037068 Bacteria 1062
549 Ga0436363_0281232 3300039450 Bacteria 680
550 Ga0439445_0174142 3300042004 Bacteria 631
551 Ga0450894_081456 3300042131 Unclassified 505
552 Ga0451576_0004321 3300045051 Bacteria 18561
553 Ga0451576_0310116 3300045051 Unclassified 1651
554 Ga0495641_0460703 3300046461 Bacteria 579
555 Ga0495580_0153602 3300046472 Unclassified 1595
556 Ga0495664_0356325 3300046477 Unclassified 881
557 Ga0495618_0346744 3300046514 Unclassified 916
558 Ga0495640_0220040 3300046533 Bacteria 1198
559 Ga0495645_0068194 3300046543 Bacteria 2568
560 Ga0495667_0258020 3300046559 Bacteria 1109
561 Ga0495668_0236712 3300046616 Bacteria 1000
562 Ga0495647_0413367 3300046681 Bacteria 621
563 Ga0495647_0524008 3300046681 Unclassified 553
564 Ga0495658_0152615 3300046683 Bacteria 1420
565 Ga0495600_0742621 3300046809 Unclassified 588
566 Ga0495684_0131470 3300047471 Bacteria 1880
567 Ga0496102_1025027 3300048905 Unclassified 746
568 Ga0496104_0653946 3300048907 Unclassified 960
569 Ga0496104_0988985 3300048907 Bacteria 745
570 Ga0496105_1136171 3300048908 Bacteria 578
571 Ga0496106_0369990 3300048909 Bacteria 1152
572 Ga0496106_0422208 3300048909 Bacteria 1072
573 Ga0496106_0529286 3300048909 Bacteria 946
574 Ga0496106_1387091 3300048909 Bacteria 543
575 Ga0496108_0007563 3300048911 Bacteria 8804
576 Ga0496109_0452958 3300048912 Bacteria 1212
577 Ga0496109_0699732 3300048912 Unclassified 951
578 Ga0496109_1106733 3300048912 Bacteria 729
579 Ga0496110_0638281 3300048913 Unclassified 964
580 Ga0496110_1795235 3300048913 Bacteria 523
581 Ga0496112_0020537 3300048915 Bacteria 6263
582 Ga0496112_0025438 3300048915 Bacteria 5684
583 Ga0496112_0216684 3300048915 Bacteria 1871
584 Ga0496112_0382647 3300048915 Bacteria 1348
585 Ga0496113_0004808 3300048916 Bacteria 8352
586 Ga0496114_0045288 3300048917 Bacteria 3654
587 Ga0496114_0834320 3300048917 Bacteria 801
588 Ga0501306_060890 3300049127 Bacteria 622
589 Ga0501308_048397 3300049128 Unclassified 617
590 Ga0501309_081377 3300049129 Unclassified 543
591 Ga0501310_067655 3300049130 Unclassified 542
592 Ga0501304_010001 3300049160 Unclassified 823
593 Ga0501314_048075 3300049530 Bacteria 511
594 Ga0501031_0108733 3300049568 Unclassified 1810
595 Ga0501071_0128455 3300049587 Bacteria 1882
596 Ga0501072_0509241 3300049588 Unclassified 952
597 Ga0501076_0293949 3300049592 Bacteria 1331
598 Ga0501235_116200 3300049669 Bacteria 666
599 nmdc:mga06z11_535730_c1 3300050494 Bacteria 710
600 nmdc:mga05p37_17259_c1 3300050507 Bacteria 8706
601 nmdc:mga05p37_198389_c1 3300050507 Bacteria 2432
602 nmdc:mga05p37_20496_c1 3300050507 Bacteria 7998
603 nmdc:mga05p37_29202_c1 3300050507 Bacteria 6732
604 nmdc:mga05p37_30035_c1 3300050507 Bacteria 6633
605 nmdc:mga05p37_55895_c1 3300050507 Bacteria 4859
606 nmdc:mga05p37_69327_c1 3300050507 Bacteria 4337
607 nmdc:mga05p37_70848_c1 3300050507 Unclassified 4288
608 nmdc:mga05p37_73549_c1 3300050507 Bacteria 4206
609 nmdc:mga09592_338518_c1 3300050508 Bacteria 1302
610 nmdc:mga0qj67_536003_c1 3300050509 Unclassified 939
611 nmdc:mga08y16_19023_c1 3300050511 Bacteria 7234
612 nmdc:mga08y16_9065_c1 3300050511 Bacteria 10444
613 nmdc:mga08y16_93277_c1 3300050511 Bacteria 3137
614 nmdc:mga0n895_106738_c1 3300050512 Unclassified 2814
615 nmdc:mga0n895_1179991_c1 3300050512 Bacteria 740
616 nmdc:mga0n895_163873_c1 3300050512 Bacteria 2255
617 nmdc:mga0n895_273931_c1 3300050512 Bacteria 1712
618 nmdc:mga0n895_299076_c1 3300050512 Bacteria 1631
619 nmdc:mga0n895_338122_c1 3300050512 Bacteria 1525
620 nmdc:mga0n895_350144_c1 3300050512 Unclassified 1496
621 nmdc:mga0n895_494994_c1 3300050512 Bacteria 1232
622 nmdc:mga0n895_64_c1 3300050512 Bacteria 62327
623 nmdc:mga0n895_69666_c1 3300050512 Bacteria 3485
624 nmdc:mga0rr50_119_c1 3300050513 Bacteria 43382
625 nmdc:mga0rr50_262953_c1 3300050513 Bacteria 1436
626 nmdc:mga0rr50_44470_c1 3300050513 Bacteria 3258
627 nmdc:mga0rr50_558371_c1 3300050513 Bacteria 975
628 nmdc:mga0rr50_87_c1 3300050513 Bacteria 52403
629 nmdc:mga08x19_126_c1 3300050514 Bacteria 67080
630 nmdc:mga08x19_17287_c1 3300050514 Bacteria 4412
631 nmdc:mga08x19_193570_c1 3300050514 Bacteria 1392
632 nmdc:mga08x19_343713_c1 3300050514 Unclassified 1041
633 nmdc:mga0a205_1227128_c1 3300050515 Unclassified 598
634 nmdc:mga0a205_20926_c1 3300050515 Bacteria 6181
635 nmdc:mga0a205_27457_c1 3300050515 Bacteria 5436
636 nmdc:mga0a205_568775_c1 3300050515 Bacteria 988
637 nmdc:mga0a205_74538_c1 3300050515 Bacteria 3279
638 nmdc:mga0a205_849265_c1 3300050515 Bacteria 760
639 nmdc:mga0a205_910058_c1 3300050515 Bacteria 726
640 nmdc:mga0a205_969162_c1 3300050515 Bacteria 697
641 Ga0495601_0067328 3300053077 Bacteria 2281
642 Ga0495595_0295601 3300053084 Unclassified 814
643 Ga0495619_0025143 3300053085 Bacteria 3822
644 Ga0495619_0033592 3300053085 Bacteria 3332
645 Ga0500566_0359688 3300053094 Bacteria 664
646 Ga0500658_0265274 3300053134 Unclassified 789
647 Ga0590071_000072 3300059421 Bacteria 27433
648 Ga0590074_006648 3300059423 Unclassified 1919
649 Ga0590075_001644 3300059424 Bacteria 5511
650 Ga0590075_034501 3300059424 Bacteria 1287
651 Ga0590077_000044 3300059426 Bacteria 28687
652 Ga0590077_018619 3300059426 Bacteria 1467
653 Ga0587082_089334 3300059504 Bacteria 655
654 Ga0587115_039711 3300059626 Unclassified 731

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049568 Ga0501031_0108733 Ga0501031_0108733_72_494 126
2 3300049587 Ga0501071_0128455 Ga0501071_0128455_1040_1462 126
3 3300049588 Ga0501072_0509241 Ga0501072_0509241_445_867 126
4 3300049592 Ga0501076_0293949 Ga0501076_0293949_82_504 126
5 3300009177 Ga0105248_11268784 Ga0105248_112687841 127
6 3300009101 Ga0105247_10499227 Ga0105247_104992271 128
7 3300009147 Ga0114129_10013237 Ga0114129_1001323710 128
8 3300009148 Ga0105243_10682484 Ga0105243_106824842 128
9 3300009177 Ga0105248_10042724 Ga0105248_100427242 128
10 3300013297 Ga0157378_12034972 Ga0157378_120349721 128
11 3300035085 Ga0373929_0016466 Ga0373929_0016466_613_1035 128
12 3300035121 Ga0373960_0138099 Ga0373960_0138099_59_481 128
13 3300048909 Ga0496106_0369990 Ga0496106_0369990_709_1131 128
14 3300048915 Ga0496112_0216684 Ga0496112_0216684_796_1218 128
15 3300050507 nmdc:mga05p37_29202_c1 nmdc:mga05p37_29202_c1_5569_5991 128
16 3300050512 nmdc:mga0n895_163873_c1 nmdc:mga0n895_163873_c1_686_1108 128
17 3300050513 nmdc:mga0rr50_558371_c1 nmdc:mga0rr50_558371_c1_119_541 128
18 3300050515 nmdc:mga0a205_20926_c1 nmdc:mga0a205_20926_c1_1087_1509 128
19 3300050515 nmdc:mga0a205_849265_c1 nmdc:mga0a205_849265_c1_130_552 128
20 3300050515 nmdc:mga0a205_910058_c1 nmdc:mga0a205_910058_c1_240_662 128
21 3300031548 Ga0307408_100121216 Ga0307408_1001212161 130
22 3300050508 nmdc:mga09592_338518_c1 nmdc:mga09592_338518_c1_226_690 130
23 3300005543 Ga0070672_100217440 Ga0070672_1002174402 131
24 3300005719 Ga0068861_100187867 Ga0068861_1001878672 131
25 3300025913 Ga0207695_10387455 Ga0207695_103874552 131
26 3300025931 Ga0207644_10509380 Ga0207644_105093801 131
27 3300025940 Ga0207691_10272470 Ga0207691_102724702 131
28 3300025981 Ga0207640_10105381 Ga0207640_101053812 131
29 3300031548 Ga0307408_101254648 Ga0307408_1012546481 131
30 3300031824 Ga0307413_10154911 Ga0307413_101549112 131
31 3300031911 Ga0307412_10231257 Ga0307412_102312571 131
32 3300034816 Ga0373930_0003565 Ga0373930_0003565_159_677 131
33 3300034818 Ga0373950_0000568 Ga0373950_0000568_1388_1906 131
34 3300034820 Ga0373959_0004952 Ga0373959_0004952_633_1151 131
35 3300035090 Ga0373949_0001403 Ga0373949_0001403_2909_3427 131
36 3300035112 Ga0373932_0001847 Ga0373932_0001847_2812_3330 131
37 3300035121 Ga0373960_0001238 Ga0373960_0001238_110_628 131
38 3300035241 Ga0373961_0000432 Ga0373961_0000432_15931_16449 131
39 3300035242 Ga0373962_0000263 Ga0373962_0000263_2599_3117 131
40 3300035691 Ga0373931_0055104 Ga0373931_0055104_38_556 131
41 3300048909 Ga0496106_0422208 Ga0496106_0422208_221_676 131
42 3300049127 Ga0501306_060890 Ga0501306_060890_135_578 131
43 3300049128 Ga0501308_048397 Ga0501308_048397_41_484 131
44 3300049129 Ga0501309_081377 Ga0501309_081377_45_488 131
45 3300049130 Ga0501310_067655 Ga0501310_067655_45_488 131
46 3300049160 Ga0501304_010001 Ga0501304_010001_318_761 131
47 3300049530 Ga0501314_048075 Ga0501314_048075_28_471 131
48 3300049669 Ga0501235_116200 Ga0501235_116200_150_593 131
49 3300006871 Ga0075434_100212446 Ga0075434_1002124462 132
50 3300006914 Ga0075436_100394688 Ga0075436_1003946881 132
51 3300007076 Ga0075435_100010927 Ga0075435_1000109277 132
52 3300007265 Ga0099794_10013634 Ga0099794_100136342 132
53 3300009093 Ga0105240_10261493 Ga0105240_102614932 132
54 3300013296 Ga0157374_10612772 Ga0157374_106127722 132
55 3300013306 Ga0163162_10794438 Ga0163162_107944381 132
56 3300025918 Ga0207662_10040029 Ga0207662_100400293 132
57 3300026118 Ga0207675_100123677 Ga0207675_1001236772 132
58 3300035085 Ga0373929_0000093 Ga0373929_0000093_14381_14899 132
59 3300035088 Ga0373940_0000166 Ga0373940_0000166_166_684 132
60 3300035114 Ga0373939_0000289 Ga0373939_0000289_10797_11315 132
61 3300035115 Ga0373941_0230637 Ga0373941_0230637_54_572 132
62 3300045051 Ga0451576_0004321 Ga0451576_0004321_7049_7567 132
63 3300050512 nmdc:mga0n895_69666_c1 nmdc:mga0n895_69666_c1_2004_2459 132
64 3300050513 nmdc:mga0rr50_87_c1 nmdc:mga0rr50_87_c1_48384_48839 132
65 3300050514 nmdc:mga08x19_343713_c1 nmdc:mga08x19_343713_c1_535_990 132
66 3300005459 Ga0068867_100450432 Ga0068867_1004504321 133
67 3300005468 Ga0070707_101718690 Ga0070707_1017186901 133
68 3300009176 Ga0105242_11022379 Ga0105242_110223792 133
69 3300026089 Ga0207648_11385706 Ga0207648_113857061 133
70 3300042004 Ga0439445_0174142 Ga0439445_0174142_88_558 133
71 3300059421 Ga0590071_000072 Ga0590071_000072_17444_17893 133
72 3300059423 Ga0590074_006648 Ga0590074_006648_831_1280 133
73 3300059424 Ga0590075_001644 Ga0590075_001644_2275_2724 133
74 3300059424 Ga0590075_034501 Ga0590075_034501_688_1137 133
75 3300059426 Ga0590077_000044 Ga0590077_000044_8952_9401 133
76 3300059426 Ga0590077_018619 Ga0590077_018619_924_1373 133
77 3300009177 Ga0105248_10238539 Ga0105248_102385392 134
78 3300025941 Ga0207711_11689872 Ga0207711_116898721 134
79 3300031852 Ga0307410_10089499 Ga0307410_100894992 134
80 3300031903 Ga0307407_10030456 Ga0307407_100304562 134
81 3300031995 Ga0307409_100036041 Ga0307409_1000360413 134
82 3300032004 Ga0307414_10216335 Ga0307414_102163352 134
83 3300042131 Ga0450894_081456 Ga0450894_081456_16_468 134
84 3300004799 Ga0058863_11855751 Ga0058863_118557511 137
85 3300004800 Ga0058861_11956597 Ga0058861_119565972 137
86 3300004803 Ga0058862_12576226 Ga0058862_125762262 137
87 3300005336 Ga0070680_100307304 Ga0070680_1003073042 137
88 3300005337 Ga0070682_100547364 Ga0070682_1005473641 137
89 3300005339 Ga0070660_100000836 Ga0070660_10000083615 137
90 3300005345 Ga0070692_10796043 Ga0070692_107960431 137
91 3300005366 Ga0070659_100045929 Ga0070659_1000459291 137
92 3300005530 Ga0070679_100009668 Ga0070679_1000096685 137
93 3300005563 Ga0068855_100035602 Ga0068855_1000356022 137
94 3300005578 Ga0068854_101469754 Ga0068854_1014697541 137
95 3300009093 Ga0105240_10026532 Ga0105240_100265326 137
96 3300009551 Ga0105238_10259192 Ga0105238_102591922 137
97 3300014326 Ga0157380_10704218 Ga0157380_107042183 137
98 3300020069 Ga0197907_10089739 Ga0197907_100897392 137
99 3300020070 Ga0206356_10536623 Ga0206356_105366231 137
100 3300020075 Ga0206349_1538291 Ga0206349_15382911 137
101 3300020077 Ga0206351_10264964 Ga0206351_102649641 137
102 3300020078 Ga0206352_10542349 Ga0206352_105423491 137
103 3300020080 Ga0206350_10392355 Ga0206350_103923551 137
104 3300020080 Ga0206350_10997823 Ga0206350_109978231 137
105 3300020081 Ga0206354_10661468 Ga0206354_106614681 137
106 3300020610 Ga0154015_1520739 Ga0154015_15207391 137
107 3300025910 Ga0207684_10580735 Ga0207684_105807351 137
108 3300025913 Ga0207695_10040063 Ga0207695_100400634 137
109 3300025917 Ga0207660_10481175 Ga0207660_104811751 137
110 3300025919 Ga0207657_10002566 Ga0207657_100025665 137
111 3300025921 Ga0207652_10047748 Ga0207652_100477485 137
112 3300025924 Ga0207694_10174097 Ga0207694_101740971 137
113 3300025924 Ga0207694_10240751 Ga0207694_102407511 137
114 3300025932 Ga0207690_10238828 Ga0207690_102388281 137
115 3300025941 Ga0207711_11396234 Ga0207711_113962341 137
116 3300025949 Ga0207667_10164877 Ga0207667_101648772 137
117 3300025949 Ga0207667_10510551 Ga0207667_105105511 137
118 3300026078 Ga0207702_10324564 Ga0207702_103245642 137
119 3300026118 Ga0207675_100100456 Ga0207675_1001004562 137
120 3300050512 nmdc:mga0n895_64_c1 nmdc:mga0n895_64_c1_57746_58213 137
121 3300050513 nmdc:mga0rr50_119_c1 nmdc:mga0rr50_119_c1_33274_33741 137
122 3300050514 nmdc:mga08x19_126_c1 nmdc:mga08x19_126_c1_8877_9344 137
123 3300050515 nmdc:mga0a205_969162_c1 nmdc:mga0a205_969162_c1_87_554 137
124 3300059504 Ga0587082_089334 Ga0587082_089334_123_575 137
125 3300005518 Ga0070699_100124073 Ga0070699_1001240732 138
126 3300005518 Ga0070699_101365233 Ga0070699_1013652331 138
127 3300005536 Ga0070697_100273294 Ga0070697_1002732943 138
128 3300005536 Ga0070697_100470142 Ga0070697_1004701422 138
129 3300006852 Ga0075433_11037467 Ga0075433_110374671 138
130 3300006871 Ga0075434_100440153 Ga0075434_1004401531 138
131 3300059626 Ga0587115_039711 Ga0587115_039711_30_551 138
132 3300004798 Ga0058859_11724858 Ga0058859_117248582 139
133 3300005335 Ga0070666_10015788 Ga0070666_100157882 139
134 3300005343 Ga0070687_100140697 Ga0070687_1001406971 139
135 3300005353 Ga0070669_100341152 Ga0070669_1003411522 139
136 3300005354 Ga0070675_100013846 Ga0070675_1000138463 139
137 3300005354 Ga0070675_101364225 Ga0070675_1013642251 139
138 3300005364 Ga0070673_100008513 Ga0070673_1000085132 139
139 3300005444 Ga0070694_100075315 Ga0070694_1000753154 139
140 3300005444 Ga0070694_100988679 Ga0070694_1009886791 139
141 3300005445 Ga0070708_100226522 Ga0070708_1002265222 139
142 3300005445 Ga0070708_100575575 Ga0070708_1005755752 139
143 3300005459 Ga0068867_100601924 Ga0068867_1006019241 139
144 3300005518 Ga0070699_100005856 Ga0070699_1000058564 139
145 3300005518 Ga0070699_100081109 Ga0070699_1000811092 139
146 3300005535 Ga0070684_100658896 Ga0070684_1006588962 139
147 3300005539 Ga0068853_100374852 Ga0068853_1003748522 139
148 3300005539 Ga0068853_100920749 Ga0068853_1009207492 139
149 3300005544 Ga0070686_100001079 Ga0070686_1000010799 139
150 3300005545 Ga0070695_100059171 Ga0070695_1000591714 139
151 3300005549 Ga0070704_100264554 Ga0070704_1002645541 139
152 3300005564 Ga0070664_100351389 Ga0070664_1003513892 139
153 3300005578 Ga0068854_100028184 Ga0068854_1000281842 139
154 3300005614 Ga0068856_101130914 Ga0068856_1011309142 139
155 3300005617 Ga0068859_100121126 Ga0068859_1001211261 139
156 3300005842 Ga0068858_100028204 Ga0068858_1000282046 139
157 3300005842 Ga0068858_100514591 Ga0068858_1005145912 139
158 3300006237 Ga0097621_100152114 Ga0097621_1001521142 139
159 3300006852 Ga0075433_10544341 Ga0075433_105443412 139
160 3300006871 Ga0075434_100001358 Ga0075434_10000135818 139
161 3300006871 Ga0075434_101655586 Ga0075434_1016555861 139
162 3300006914 Ga0075436_100022532 Ga0075436_1000225321 139
163 3300006931 Ga0097620_100121124 Ga0097620_1001211241 139
164 3300007076 Ga0075435_100011725 Ga0075435_1000117256 139
165 3300007076 Ga0075435_100216351 Ga0075435_1002163512 139
166 3300009093 Ga0105240_10527742 Ga0105240_105277422 139
167 3300009098 Ga0105245_10340071 Ga0105245_103400712 139
168 3300009098 Ga0105245_11906782 Ga0105245_119067821 139
169 3300009147 Ga0114129_10113794 Ga0114129_101137942 139
170 3300009147 Ga0114129_10650462 Ga0114129_106504621 139
171 3300009174 Ga0105241_10098154 Ga0105241_100981542 139
172 3300009176 Ga0105242_11149823 Ga0105242_111498232 139
173 3300009551 Ga0105238_10703068 Ga0105238_107030682 139
174 3300013296 Ga0157374_10576824 Ga0157374_105768241 139
175 3300013297 Ga0157378_10619841 Ga0157378_106198412 139
176 3300013297 Ga0157378_10782445 Ga0157378_107824451 139
177 3300014326 Ga0157380_10058080 Ga0157380_100580804 139
178 3300014745 Ga0157377_10144034 Ga0157377_101440342 139
179 3300025903 Ga0207680_10037738 Ga0207680_100377382 139
180 3300025903 Ga0207680_10591817 Ga0207680_105918172 139
181 3300025907 Ga0207645_10091249 Ga0207645_100912492 139
182 3300025911 Ga0207654_10047220 Ga0207654_100472202 139
183 3300025923 Ga0207681_10407822 Ga0207681_104078222 139
184 3300025923 Ga0207681_10425010 Ga0207681_104250101 139
185 3300025926 Ga0207659_10012872 Ga0207659_100128721 139
186 3300025927 Ga0207687_10390822 Ga0207687_103908221 139
187 3300025927 Ga0207687_10444584 Ga0207687_104445841 139
188 3300025940 Ga0207691_10467458 Ga0207691_104674581 139
189 3300025945 Ga0207679_10377023 Ga0207679_103770232 139
190 3300025960 Ga0207651_10007618 Ga0207651_100076182 139
191 3300025981 Ga0207640_10016889 Ga0207640_100168892 139
192 3300026035 Ga0207703_10029188 Ga0207703_100291886 139
193 3300026035 Ga0207703_10300439 Ga0207703_103004392 139
194 3300026075 Ga0207708_10887617 Ga0207708_108876171 139
195 3300026078 Ga0207702_10418180 Ga0207702_104181802 139
196 3300026088 Ga0207641_10626651 Ga0207641_106266511 139
197 3300026089 Ga0207648_10308876 Ga0207648_103088762 139
198 3300026089 Ga0207648_11481812 Ga0207648_114818121 139
199 3300026118 Ga0207675_100293260 Ga0207675_1002932602 139
200 3300035119 Ga0373956_0133396 Ga0373956_0133396_554_1009 139
201 3300035410 Ga0373924_0046697 Ga0373924_0046697_713_1168 139
202 3300035691 Ga0373931_0107654 Ga0373931_0107654_19_480 139
203 3300036401 Ga0373937_0068808 Ga0373937_0068808_1229_1684 139
204 3300039450 Ga0436363_0281232 Ga0436363_0281232_170_631 139
205 3300045051 Ga0451576_0310116 Ga0451576_0310116_850_1311 139
206 3300046461 Ga0495641_0460703 Ga0495641_0460703_61_516 139
207 3300046472 Ga0495580_0153602 Ga0495580_0153602_80_538 139
208 3300046477 Ga0495664_0356325 Ga0495664_0356325_269_724 139
209 3300046533 Ga0495640_0220040 Ga0495640_0220040_660_1115 139
210 3300046543 Ga0495645_0068194 Ga0495645_0068194_1361_1816 139
211 3300046559 Ga0495667_0258020 Ga0495667_0258020_352_807 139
212 3300047471 Ga0495684_0131470 Ga0495684_0131470_895_1350 139
213 3300048908 Ga0496105_1136171 Ga0496105_1136171_56_511 139
214 3300050514 nmdc:mga08x19_17287_c1 nmdc:mga08x19_17287_c1_3824_4282 139
215 3300053077 Ga0495601_0067328 Ga0495601_0067328_650_1105 139
216 3300053084 Ga0495595_0295601 Ga0495595_0295601_326_781 139
217 3300053085 Ga0495619_0025143 Ga0495619_0025143_266_721 139
218 3300002459 JGI24751J29686_10041870 JGI24751J29686_100418701 140
219 3300003163 Ga0006759J45824_1087942 Ga0006759J45824_10879421 140
220 3300003544 Ga0007417J51691_1055896 Ga0007417J51691_10558961 140
221 3300003575 Ga0007409J51694_1029994 Ga0007409J51694_10299941 140
222 3300003577 Ga0007416J51690_1024618 Ga0007416J51690_10246181 140
223 3300003577 Ga0007416J51690_1032803 Ga0007416J51690_10328031 140
224 3300003577 Ga0007416J51690_1064437 Ga0007416J51690_10644371 140
225 3300003693 Ga0032354_1016568 Ga0032354_10165681 140
226 3300004798 Ga0058859_10012198 Ga0058859_100121982 140
227 3300004798 Ga0058859_10020515 Ga0058859_100205151 140
228 3300004798 Ga0058859_10042413 Ga0058859_100424131 140
229 3300004801 Ga0058860_10010261 Ga0058860_100102611 140
230 3300004801 Ga0058860_10011861 Ga0058860_100118611 140
231 3300004801 Ga0058860_10044748 Ga0058860_100447481 140
232 3300004801 Ga0058860_12074596 Ga0058860_120745961 140
233 3300004801 Ga0058860_12192347 Ga0058860_121923471 140
234 3300005290 Ga0065712_10080836 Ga0065712_100808364 140
235 3300005295 Ga0065707_10053155 Ga0065707_100531551 140
236 3300005295 Ga0065707_10640402 Ga0065707_106404021 140
237 3300005295 Ga0065707_10861655 Ga0065707_108616551 140
238 3300005328 Ga0070676_10007361 Ga0070676_100073617 140
239 3300005330 Ga0070690_100336722 Ga0070690_1003367222 140
240 3300005331 Ga0070670_100627779 Ga0070670_1006277791 140
241 3300005331 Ga0070670_100647936 Ga0070670_1006479361 140
242 3300005334 Ga0068869_100102397 Ga0068869_1001023972 140
243 3300005334 Ga0068869_101429777 Ga0068869_1014297771 140
244 3300005334 Ga0068869_102114851 Ga0068869_1021148511 140
245 3300005335 Ga0070666_10077364 Ga0070666_100773642 140
246 3300005335 Ga0070666_10440983 Ga0070666_104409831 140
247 3300005335 Ga0070666_10980315 Ga0070666_109803151 140
248 3300005336 Ga0070680_101460501 Ga0070680_1014605011 140
249 3300005338 Ga0068868_100046061 Ga0068868_1000460611 140
250 3300005338 Ga0068868_101981365 Ga0068868_1019813651 140
251 3300005340 Ga0070689_100236365 Ga0070689_1002363652 140
252 3300005340 Ga0070689_100411607 Ga0070689_1004116071 140
253 3300005341 Ga0070691_10003956 Ga0070691_100039562 140
254 3300005341 Ga0070691_10144466 Ga0070691_101444662 140
255 3300005343 Ga0070687_100042608 Ga0070687_1000426082 140
256 3300005343 Ga0070687_100293952 Ga0070687_1002939522 140
257 3300005344 Ga0070661_101036413 Ga0070661_1010364131 140
258 3300005345 Ga0070692_10642903 Ga0070692_106429031 140
259 3300005345 Ga0070692_11100254 Ga0070692_111002541 140
260 3300005347 Ga0070668_100040765 Ga0070668_1000407655 140
261 3300005347 Ga0070668_100085032 Ga0070668_1000850322 140
262 3300005347 Ga0070668_100150652 Ga0070668_1001506521 140
263 3300005353 Ga0070669_100009946 Ga0070669_1000099462 140
264 3300005353 Ga0070669_100296388 Ga0070669_1002963881 140
265 3300005353 Ga0070669_100521645 Ga0070669_1005216451 140
266 3300005353 Ga0070669_100598340 Ga0070669_1005983401 140
267 3300005354 Ga0070675_100190115 Ga0070675_1001901152 140
268 3300005354 Ga0070675_100271732 Ga0070675_1002717322 140
269 3300005354 Ga0070675_101495716 Ga0070675_1014957161 140
270 3300005355 Ga0070671_100107942 Ga0070671_1001079422 140
271 3300005356 Ga0070674_100021954 Ga0070674_1000219542 140
272 3300005356 Ga0070674_100628172 Ga0070674_1006281722 140
273 3300005356 Ga0070674_100804627 Ga0070674_1008046271 140
274 3300005364 Ga0070673_100215837 Ga0070673_1002158372 140
275 3300005364 Ga0070673_100220997 Ga0070673_1002209971 140
276 3300005364 Ga0070673_100853521 Ga0070673_1008535211 140
277 3300005365 Ga0070688_100027444 Ga0070688_1000274441 140
278 3300005367 Ga0070667_100003098 Ga0070667_10000309810 140
279 3300005438 Ga0070701_10014844 Ga0070701_100148445 140
280 3300005438 Ga0070701_10342811 Ga0070701_103428111 140
281 3300005438 Ga0070701_11042617 Ga0070701_110426171 140
282 3300005440 Ga0070705_100006397 Ga0070705_1000063976 140
283 3300005440 Ga0070705_100306733 Ga0070705_1003067331 140
284 3300005441 Ga0070700_100009994 Ga0070700_1000099942 140
285 3300005441 Ga0070700_100235780 Ga0070700_1002357801 140
286 3300005444 Ga0070694_100043331 Ga0070694_1000433313 140
287 3300005444 Ga0070694_100055461 Ga0070694_1000554612 140
288 3300005444 Ga0070694_100842449 Ga0070694_1008424491 140
289 3300005445 Ga0070708_100590834 Ga0070708_1005908341 140
290 3300005457 Ga0070662_100073811 Ga0070662_1000738112 140
291 3300005457 Ga0070662_100212252 Ga0070662_1002122522 140
292 3300005459 Ga0068867_100017807 Ga0068867_1000178076 140
293 3300005459 Ga0068867_100035895 Ga0068867_1000358954 140
294 3300005466 Ga0070685_10050645 Ga0070685_100506452 140
295 3300005466 Ga0070685_10399112 Ga0070685_103991121 140
296 3300005467 Ga0070706_100881929 Ga0070706_1008819291 140
297 3300005467 Ga0070706_101408595 Ga0070706_1014085951 140
298 3300005468 Ga0070707_100055131 Ga0070707_1000551312 140
299 3300005468 Ga0070707_100063602 Ga0070707_1000636022 140
300 3300005468 Ga0070707_100529782 Ga0070707_1005297822 140
301 3300005468 Ga0070707_100535022 Ga0070707_1005350221 140
302 3300005471 Ga0070698_101351453 Ga0070698_1013514531 140
303 3300005518 Ga0070699_100059185 Ga0070699_1000591853 140
304 3300005535 Ga0070684_100429266 Ga0070684_1004292662 140
305 3300005536 Ga0070697_100044923 Ga0070697_1000449231 140
306 3300005536 Ga0070697_100123547 Ga0070697_1001235472 140
307 3300005536 Ga0070697_100205846 Ga0070697_1002058462 140
308 3300005536 Ga0070697_100262271 Ga0070697_1002622711 140
309 3300005543 Ga0070672_100282374 Ga0070672_1002823742 140
310 3300005543 Ga0070672_101851940 Ga0070672_1018519401 140
311 3300005544 Ga0070686_100026480 Ga0070686_1000264802 140
312 3300005544 Ga0070686_100218156 Ga0070686_1002181562 140
313 3300005544 Ga0070686_100860001 Ga0070686_1008600011 140
314 3300005545 Ga0070695_100003966 Ga0070695_1000039666 140
315 3300005546 Ga0070696_100004210 Ga0070696_1000042102 140
316 3300005546 Ga0070696_100196948 Ga0070696_1001969482 140
317 3300005546 Ga0070696_100557541 Ga0070696_1005575412 140
318 3300005546 Ga0070696_100892769 Ga0070696_1008927691 140
319 3300005548 Ga0070665_100001584 Ga0070665_1000015847 140
320 3300005548 Ga0070665_100046665 Ga0070665_1000466653 140
321 3300005548 Ga0070665_100337790 Ga0070665_1003377902 140
322 3300005549 Ga0070704_100006282 Ga0070704_1000062822 140
323 3300005549 Ga0070704_100024925 Ga0070704_1000249253 140
324 3300005549 Ga0070704_100084274 Ga0070704_1000842742 140
325 3300005549 Ga0070704_101087673 Ga0070704_1010876731 140
326 3300005564 Ga0070664_100455017 Ga0070664_1004550172 140
327 3300005564 Ga0070664_100811939 Ga0070664_1008119392 140
328 3300005577 Ga0068857_101955190 Ga0068857_1019551901 140
329 3300005615 Ga0070702_100010666 Ga0070702_1000106664 140
330 3300005615 Ga0070702_100576059 Ga0070702_1005760591 140
331 3300005616 Ga0068852_100703189 Ga0068852_1007031892 140
332 3300005617 Ga0068859_100089881 Ga0068859_1000898812 140
333 3300005617 Ga0068859_100716758 Ga0068859_1007167582 140
334 3300005617 Ga0068859_100831624 Ga0068859_1008316241 140
335 3300005617 Ga0068859_101115345 Ga0068859_1011153451 140
336 3300005617 Ga0068859_102062956 Ga0068859_1020629561 140
337 3300005618 Ga0068864_100007222 Ga0068864_1000072226 140
338 3300005618 Ga0068864_100520188 Ga0068864_1005201882 140
339 3300005618 Ga0068864_100837469 Ga0068864_1008374691 140
340 3300005618 Ga0068864_100897840 Ga0068864_1008978401 140
341 3300005718 Ga0068866_10189424 Ga0068866_101894241 140
342 3300005718 Ga0068866_10312683 Ga0068866_103126832 140
343 3300005718 Ga0068866_10381775 Ga0068866_103817751 140
344 3300005718 Ga0068866_10807512 Ga0068866_108075121 140
345 3300005719 Ga0068861_100020467 Ga0068861_1000204672 140
346 3300005719 Ga0068861_100048067 Ga0068861_1000480674 140
347 3300005719 Ga0068861_100516354 Ga0068861_1005163542 140
348 3300005840 Ga0068870_10184499 Ga0068870_101844991 140
349 3300005841 Ga0068863_100024942 Ga0068863_1000249424 140
350 3300005841 Ga0068863_100316245 Ga0068863_1003162452 140
351 3300005841 Ga0068863_100433449 Ga0068863_1004334492 140
352 3300005842 Ga0068858_100005983 Ga0068858_1000059832 140
353 3300005842 Ga0068858_100091242 Ga0068858_1000912422 140
354 3300005842 Ga0068858_100232073 Ga0068858_1002320732 140
355 3300005842 Ga0068858_100305907 Ga0068858_1003059072 140
356 3300005842 Ga0068858_100548122 Ga0068858_1005481222 140
357 3300005842 Ga0068858_100953519 Ga0068858_1009535191 140
358 3300005842 Ga0068858_101384016 Ga0068858_1013840161 140
359 3300005843 Ga0068860_100147694 Ga0068860_1001476942 140
360 3300005843 Ga0068860_100339257 Ga0068860_1003392571 140
361 3300005843 Ga0068860_101395326 Ga0068860_1013953261 140
362 3300005844 Ga0068862_100010134 Ga0068862_1000101343 140
363 3300005844 Ga0068862_100090251 Ga0068862_1000902512 140
364 3300005844 Ga0068862_100159220 Ga0068862_1001592202 140
365 3300005844 Ga0068862_100239710 Ga0068862_1002397102 140
366 3300005844 Ga0068862_100607829 Ga0068862_1006078291 140
367 3300005983 Ga0081540_1109273 Ga0081540_11092732 140
368 3300005985 Ga0081539_10150201 Ga0081539_101502012 140
369 3300005985 Ga0081539_10354510 Ga0081539_103545101 140
370 3300006028 Ga0070717_11019278 Ga0070717_110192781 140
371 3300006058 Ga0075432_10050940 Ga0075432_100509402 140
372 3300006237 Ga0097621_100023036 Ga0097621_1000230362 140
373 3300006237 Ga0097621_100039877 Ga0097621_1000398772 140
374 3300006237 Ga0097621_100766714 Ga0097621_1007667142 140
375 3300006358 Ga0068871_100051028 Ga0068871_1000510282 140
376 3300006358 Ga0068871_100072257 Ga0068871_1000722572 140
377 3300006358 Ga0068871_100287788 Ga0068871_1002877882 140
378 3300006358 Ga0068871_100357150 Ga0068871_1003571502 140
379 3300006358 Ga0068871_100505512 Ga0068871_1005055121 140
380 3300006844 Ga0075428_100651253 Ga0075428_1006512532 140
381 3300006844 Ga0075428_100825245 Ga0075428_1008252451 140
382 3300006844 Ga0075428_101051954 Ga0075428_1010519541 140
383 3300006852 Ga0075433_10009068 Ga0075433_100090687 140
384 3300006852 Ga0075433_10029899 Ga0075433_100298997 140
385 3300006852 Ga0075433_10036743 Ga0075433_100367434 140
386 3300006852 Ga0075433_10601132 Ga0075433_106011322 140
387 3300006852 Ga0075433_10821816 Ga0075433_108218162 140
388 3300006852 Ga0075433_11791430 Ga0075433_117914301 140
389 3300006871 Ga0075434_100292511 Ga0075434_1002925112 140
390 3300006871 Ga0075434_100347233 Ga0075434_1003472332 140
391 3300006871 Ga0075434_100401017 Ga0075434_1004010172 140
392 3300006871 Ga0075434_100404417 Ga0075434_1004044171 140
393 3300006871 Ga0075434_100431136 Ga0075434_1004311362 140
394 3300006871 Ga0075434_101082346 Ga0075434_1010823461 140
395 3300006880 Ga0075429_100674754 Ga0075429_1006747541 140
396 3300006881 Ga0068865_100020372 Ga0068865_1000203725 140
397 3300006914 Ga0075436_100060059 Ga0075436_1000600592 140
398 3300006931 Ga0097620_100089880 Ga0097620_1000898802 140
399 3300006931 Ga0097620_100716726 Ga0097620_1007167262 140
400 3300006931 Ga0097620_100831636 Ga0097620_1008316361 140
401 3300006931 Ga0097620_101115230 Ga0097620_1011152302 140
402 3300006931 Ga0097620_102062961 Ga0097620_1020629611 140
403 3300007076 Ga0075435_100005188 Ga0075435_1000051886 140
404 3300007076 Ga0075435_100222828 Ga0075435_1002228282 140
405 3300007076 Ga0075435_100312131 Ga0075435_1003121311 140
406 3300007265 Ga0099794_10249847 Ga0099794_102498472 140
407 3300009093 Ga0105240_10661791 Ga0105240_106617911 140
408 3300009094 Ga0111539_10024118 Ga0111539_100241187 140
409 3300009094 Ga0111539_10076803 Ga0111539_100768031 140
410 3300009094 Ga0111539_10417045 Ga0111539_104170452 140
411 3300009098 Ga0105245_10005562 Ga0105245_100055627 140
412 3300009098 Ga0105245_10491066 Ga0105245_104910662 140
413 3300009098 Ga0105245_10634109 Ga0105245_106341092 140
414 3300009098 Ga0105245_12180346 Ga0105245_121803461 140
415 3300009101 Ga0105247_10044351 Ga0105247_100443512 140
416 3300009101 Ga0105247_10076554 Ga0105247_100765543 140
417 3300009101 Ga0105247_10967077 Ga0105247_109670771 140
418 3300009147 Ga0114129_10001158 Ga0114129_100011588 140
419 3300009147 Ga0114129_10002835 Ga0114129_1000283514 140
420 3300009147 Ga0114129_10004994 Ga0114129_1000499419 140
421 3300009147 Ga0114129_10058744 Ga0114129_100587442 140
422 3300009147 Ga0114129_10078869 Ga0114129_100788692 140
423 3300009147 Ga0114129_10221600 Ga0114129_102216005 140
424 3300009147 Ga0114129_10606629 Ga0114129_106066292 140
425 3300009148 Ga0105243_10031944 Ga0105243_100319446 140
426 3300009148 Ga0105243_10070836 Ga0105243_100708363 140
427 3300009174 Ga0105241_10214886 Ga0105241_102148861 140
428 3300009174 Ga0105241_10369205 Ga0105241_103692051 140
429 3300009176 Ga0105242_10059020 Ga0105242_100590205 140
430 3300009176 Ga0105242_10069666 Ga0105242_100696662 140
431 3300009176 Ga0105242_10116565 Ga0105242_101165652 140
432 3300009177 Ga0105248_10001680 Ga0105248_100016807 140
433 3300009177 Ga0105248_10024153 Ga0105248_100241537 140
434 3300009177 Ga0105248_10330143 Ga0105248_103301432 140
435 3300009177 Ga0105248_10476273 Ga0105248_104762731 140
436 3300009177 Ga0105248_10709429 Ga0105248_107094291 140
437 3300009177 Ga0105248_10857596 Ga0105248_108575961 140
438 3300009545 Ga0105237_10880228 Ga0105237_108802282 140
439 3300009551 Ga0105238_11020777 Ga0105238_110207772 140
440 3300009551 Ga0105238_11185358 Ga0105238_111853582 140
441 3300009553 Ga0105249_10140625 Ga0105249_101406252 140
442 3300010375 Ga0105239_10492690 Ga0105239_104926902 140
443 3300011119 Ga0105246_10434521 Ga0105246_104345211 140
444 3300011119 Ga0105246_10523396 Ga0105246_105233961 140
445 3300011119 Ga0105246_10784600 Ga0105246_107846001 140
446 3300013296 Ga0157374_10002908 Ga0157374_100029089 140
447 3300013297 Ga0157378_10113074 Ga0157378_101130742 140
448 3300013297 Ga0157378_10701634 Ga0157378_107016342 140
449 3300013306 Ga0163162_10091514 Ga0163162_100915142 140
450 3300013306 Ga0163162_10300919 Ga0163162_103009191 140
451 3300013306 Ga0163162_10621117 Ga0163162_106211171 140
452 3300013306 Ga0163162_11472843 Ga0163162_114728431 140
453 3300013308 Ga0157375_10164112 Ga0157375_101641122 140
454 3300013308 Ga0157375_10422062 Ga0157375_104220622 140
455 3300014325 Ga0163163_10025482 Ga0163163_100254824 140
456 3300014325 Ga0163163_10641094 Ga0163163_106410941 140
457 3300014326 Ga0157380_10057779 Ga0157380_100577792 140
458 3300014326 Ga0157380_10062361 Ga0157380_100623615 140
459 3300014326 Ga0157380_10168723 Ga0157380_101687232 140
460 3300014745 Ga0157377_10061537 Ga0157377_100615372 140
461 3300014968 Ga0157379_10021810 Ga0157379_100218105 140
462 3300014968 Ga0157379_10035792 Ga0157379_100357922 140
463 3300014968 Ga0157379_10137202 Ga0157379_101372022 140
464 3300014968 Ga0157379_10404943 Ga0157379_104049431 140
465 3300014968 Ga0157379_11897119 Ga0157379_118971191 140
466 3300014969 Ga0157376_10197336 Ga0157376_101973362 140
467 3300025899 Ga0207642_10021957 Ga0207642_100219572 140
468 3300025899 Ga0207642_10054388 Ga0207642_100543881 140
469 3300025900 Ga0207710_10052308 Ga0207710_100523082 140
470 3300025901 Ga0207688_10018413 Ga0207688_100184132 140
471 3300025903 Ga0207680_10060092 Ga0207680_100600922 140
472 3300025903 Ga0207680_10208049 Ga0207680_102080492 140
473 3300025903 Ga0207680_10245895 Ga0207680_102458951 140
474 3300025907 Ga0207645_10005026 Ga0207645_100050264 140
475 3300025907 Ga0207645_10066299 Ga0207645_100662993 140
476 3300025907 Ga0207645_10473116 Ga0207645_104731162 140
477 3300025910 Ga0207684_10620714 Ga0207684_106207142 140
478 3300025911 Ga0207654_10144423 Ga0207654_101444232 140
479 3300025913 Ga0207695_10666866 Ga0207695_106668662 140
480 3300025918 Ga0207662_10274011 Ga0207662_102740112 140
481 3300025920 Ga0207649_10668703 Ga0207649_106687031 140
482 3300025922 Ga0207646_10037144 Ga0207646_100371442 140
483 3300025922 Ga0207646_10542943 Ga0207646_105429432 140
484 3300025922 Ga0207646_10574360 Ga0207646_105743601 140
485 3300025923 Ga0207681_10011395 Ga0207681_100113956 140
486 3300025923 Ga0207681_10023797 Ga0207681_100237975 140
487 3300025923 Ga0207681_10056942 Ga0207681_100569423 140
488 3300025924 Ga0207694_10517427 Ga0207694_105174271 140
489 3300025924 Ga0207694_10840819 Ga0207694_108408191 140
490 3300025925 Ga0207650_10216343 Ga0207650_102163431 140
491 3300025925 Ga0207650_10714817 Ga0207650_107148172 140
492 3300025926 Ga0207659_10061202 Ga0207659_100612023 140
493 3300025926 Ga0207659_10613471 Ga0207659_106134711 140
494 3300025927 Ga0207687_10152252 Ga0207687_101522522 140
495 3300025927 Ga0207687_10967909 Ga0207687_109679091 140
496 3300025931 Ga0207644_10054463 Ga0207644_100544632 140
497 3300025933 Ga0207706_10044665 Ga0207706_100446653 140
498 3300025933 Ga0207706_10325930 Ga0207706_103259302 140
499 3300025934 Ga0207686_10017277 Ga0207686_100172772 140
500 3300025934 Ga0207686_10132681 Ga0207686_101326812 140
501 3300025934 Ga0207686_10425479 Ga0207686_104254792 140
502 3300025934 Ga0207686_10528227 Ga0207686_105282271 140
503 3300025934 Ga0207686_10742376 Ga0207686_107423761 140
504 3300025934 Ga0207686_11315030 Ga0207686_113150301 140
505 3300025935 Ga0207709_10013731 Ga0207709_100137313 140
506 3300025935 Ga0207709_10117654 Ga0207709_101176542 140
507 3300025935 Ga0207709_10423126 Ga0207709_104231262 140
508 3300025936 Ga0207670_10024968 Ga0207670_100249682 140
509 3300025936 Ga0207670_10091712 Ga0207670_100917122 140
510 3300025937 Ga0207669_10008920 Ga0207669_100089203 140
511 3300025937 Ga0207669_10017472 Ga0207669_100174723 140
512 3300025937 Ga0207669_10610922 Ga0207669_106109221 140
513 3300025937 Ga0207669_10667734 Ga0207669_106677341 140
514 3300025937 Ga0207669_10710235 Ga0207669_107102352 140
515 3300025938 Ga0207704_10048575 Ga0207704_100485752 140
516 3300025940 Ga0207691_10152521 Ga0207691_101525212 140
517 3300025940 Ga0207691_10240168 Ga0207691_102401682 140
518 3300025940 Ga0207691_10251672 Ga0207691_102516722 140
519 3300025940 Ga0207691_11001790 Ga0207691_110017901 140
520 3300025940 Ga0207691_11104369 Ga0207691_111043692 140
521 3300025941 Ga0207711_10017070 Ga0207711_100170705 140
522 3300025941 Ga0207711_10326518 Ga0207711_103265182 140
523 3300025941 Ga0207711_10706805 Ga0207711_107068052 140
524 3300025941 Ga0207711_10744584 Ga0207711_107445841 140
525 3300025942 Ga0207689_10062906 Ga0207689_100629062 140
526 3300025942 Ga0207689_10098021 Ga0207689_100980211 140
527 3300025942 Ga0207689_10126880 Ga0207689_101268802 140
528 3300025942 Ga0207689_10976221 Ga0207689_109762211 140
529 3300025942 Ga0207689_11766422 Ga0207689_117664221 140
530 3300025945 Ga0207679_10269235 Ga0207679_102692351 140
531 3300025960 Ga0207651_10067972 Ga0207651_100679721 140
532 3300025960 Ga0207651_10092515 Ga0207651_100925152 140
533 3300025960 Ga0207651_10894976 Ga0207651_108949761 140
534 3300025961 Ga0207712_10160611 Ga0207712_101606112 140
535 3300025961 Ga0207712_10264383 Ga0207712_102643832 140
536 3300025972 Ga0207668_10020400 Ga0207668_100204006 140
537 3300025972 Ga0207668_10119492 Ga0207668_101194922 140
538 3300025981 Ga0207640_10481006 Ga0207640_104810062 140
539 3300025986 Ga0207658_10164689 Ga0207658_101646891 140
540 3300026023 Ga0207677_10049114 Ga0207677_100491145 140
541 3300026023 Ga0207677_10072435 Ga0207677_100724352 140
542 3300026023 Ga0207677_10293404 Ga0207677_102934042 140
543 3300026035 Ga0207703_10018700 Ga0207703_100187004 140
544 3300026035 Ga0207703_10049343 Ga0207703_100493432 140
545 3300026035 Ga0207703_10098033 Ga0207703_100980331 140
546 3300026035 Ga0207703_10832495 Ga0207703_108324951 140
547 3300026035 Ga0207703_11322021 Ga0207703_113220211 140
548 3300026041 Ga0207639_11918236 Ga0207639_119182361 140
549 3300026075 Ga0207708_10007652 Ga0207708_100076522 140
550 3300026075 Ga0207708_10182024 Ga0207708_101820242 140
551 3300026075 Ga0207708_10858991 Ga0207708_108589911 140
552 3300026075 Ga0207708_10979487 Ga0207708_109794871 140
553 3300026088 Ga0207641_10003384 Ga0207641_1000338412 140
554 3300026088 Ga0207641_10118665 Ga0207641_101186652 140
555 3300026088 Ga0207641_10334468 Ga0207641_103344681 140
556 3300026089 Ga0207648_10010834 Ga0207648_100108342 140
557 3300026089 Ga0207648_10024894 Ga0207648_100248942 140
558 3300026089 Ga0207648_10255069 Ga0207648_102550691 140
559 3300026089 Ga0207648_10728570 Ga0207648_107285701 140
560 3300026095 Ga0207676_10124312 Ga0207676_101243121 140
561 3300026095 Ga0207676_10598833 Ga0207676_105988331 140
562 3300026116 Ga0207674_10769606 Ga0207674_107696061 140
563 3300026118 Ga0207675_100009579 Ga0207675_1000095795 140
564 3300026118 Ga0207675_100018853 Ga0207675_1000188533 140
565 3300026118 Ga0207675_100090323 Ga0207675_1000903235 140
566 3300026118 Ga0207675_100195166 Ga0207675_1001951662 140
567 3300026118 Ga0207675_101298793 Ga0207675_1012987931 140
568 3300026121 Ga0207683_10299021 Ga0207683_102990211 140
569 3300026121 Ga0207683_10368850 Ga0207683_103688501 140
570 3300026142 Ga0207698_10936022 Ga0207698_109360222 140
571 3300027907 Ga0207428_10009852 Ga0207428_100098526 140
572 3300027907 Ga0207428_10197964 Ga0207428_101979642 140
573 3300028379 Ga0268266_10021105 Ga0268266_100211055 140
574 3300028379 Ga0268266_10027981 Ga0268266_100279811 140
575 3300028379 Ga0268266_10282492 Ga0268266_102824921 140
576 3300028380 Ga0268265_10037208 Ga0268265_100372082 140
577 3300028380 Ga0268265_10193941 Ga0268265_101939411 140
578 3300028380 Ga0268265_10195921 Ga0268265_101959212 140
579 3300028380 Ga0268265_10236695 Ga0268265_102366952 140
580 3300028380 Ga0268265_11225639 Ga0268265_112256391 140
581 3300028380 Ga0268265_11955376 Ga0268265_119553761 140
582 3300028381 Ga0268264_10261470 Ga0268264_102614701 140
583 3300028381 Ga0268264_11053213 Ga0268264_110532131 140
584 3300028381 Ga0268264_11203960 Ga0268264_112039602 140
585 3300028381 Ga0268264_11459379 Ga0268264_114593791 140
586 3300028381 Ga0268264_11972105 Ga0268264_119721051 140
587 3300028381 Ga0268264_12028678 Ga0268264_120286781 140
588 3300031456 Ga0307513_10717989 Ga0307513_107179891 140
589 3300035088 Ga0373940_0097960 Ga0373940_0097960_340_804 140
590 3300035088 Ga0373940_0173544 Ga0373940_0173544_218_679 140
591 3300035092 Ga0373952_0181907 Ga0373952_0181907_59_523 140
592 3300035112 Ga0373932_0187733 Ga0373932_0187733_162_620 140
593 3300035114 Ga0373939_0352510 Ga0373939_0352510_69_527 140
594 3300035171 Ga0373946_0758373 Ga0373946_0758373_33_491 140
595 3300035242 Ga0373962_0315067 Ga0373962_0315067_29_487 140
596 3300035692 Ga0373935_1060319 Ga0373935_1060319_83_541 140
597 3300035695 Ga0373927_0751605 Ga0373927_0751605_84_542 140
598 3300036401 Ga0373937_0184799 Ga0373937_0184799_638_1096 140
599 3300036401 Ga0373937_0321999 Ga0373937_0321999_914_1372 140
600 3300037068 Ga0373925_0367122 Ga0373925_0367122_576_1034 140
601 3300037068 Ga0373925_0443496 Ga0373925_0443496_108_566 140
602 3300046514 Ga0495618_0346744 Ga0495618_0346744_186_644 140
603 3300046616 Ga0495668_0236712 Ga0495668_0236712_452_910 140
604 3300046681 Ga0495647_0413367 Ga0495647_0413367_30_488 140
605 3300046681 Ga0495647_0524008 Ga0495647_0524008_51_509 140
606 3300046683 Ga0495658_0152615 Ga0495658_0152615_78_536 140
607 3300046809 Ga0495600_0742621 Ga0495600_0742621_69_527 140
608 3300048905 Ga0496102_1025027 Ga0496102_1025027_198_662 140
609 3300048907 Ga0496104_0653946 Ga0496104_0653946_325_783 140
610 3300048907 Ga0496104_0988985 Ga0496104_0988985_261_719 140
611 3300048909 Ga0496106_0529286 Ga0496106_0529286_94_570 140
612 3300048909 Ga0496106_1387091 Ga0496106_1387091_14_478 140
613 3300048911 Ga0496108_0007563 Ga0496108_0007563_6298_6756 140
614 3300048912 Ga0496109_0452958 Ga0496109_0452958_133_597 140
615 3300048912 Ga0496109_0699732 Ga0496109_0699732_109_567 140
616 3300048912 Ga0496109_1106733 Ga0496109_1106733_26_490 140
617 3300048913 Ga0496110_0638281 Ga0496110_0638281_50_508 140
618 3300048913 Ga0496110_1795235 Ga0496110_1795235_13_477 140
619 3300048915 Ga0496112_0020537 Ga0496112_0020537_383_847 140
620 3300048915 Ga0496112_0025438 Ga0496112_0025438_1618_2076 140
621 3300048915 Ga0496112_0382647 Ga0496112_0382647_119_595 140
622 3300048916 Ga0496113_0004808 Ga0496113_0004808_3397_3855 140
623 3300048917 Ga0496114_0045288 Ga0496114_0045288_556_1014 140
624 3300048917 Ga0496114_0834320 Ga0496114_0834320_133_591 140
625 3300050494 nmdc:mga06z11_535730_c1 nmdc:mga06z11_535730_c1_49_507 140
626 3300050507 nmdc:mga05p37_17259_c1 nmdc:mga05p37_17259_c1_3673_4137 140
627 3300050507 nmdc:mga05p37_198389_c1 nmdc:mga05p37_198389_c1_1321_1779 140
628 3300050507 nmdc:mga05p37_20496_c1 nmdc:mga05p37_20496_c1_2651_3118 140
629 3300050507 nmdc:mga05p37_30035_c1 nmdc:mga05p37_30035_c1_1479_1943 140
630 3300050507 nmdc:mga05p37_55895_c1 nmdc:mga05p37_55895_c1_850_1311 140
631 3300050507 nmdc:mga05p37_69327_c1 nmdc:mga05p37_69327_c1_1171_1638 140
632 3300050507 nmdc:mga05p37_70848_c1 nmdc:mga05p37_70848_c1_629_1096 140
633 3300050507 nmdc:mga05p37_73549_c1 nmdc:mga05p37_73549_c1_2787_3251 140
634 3300050509 nmdc:mga0qj67_536003_c1 nmdc:mga0qj67_536003_c1_295_753 140
635 3300050511 nmdc:mga08y16_19023_c1 nmdc:mga08y16_19023_c1_4067_4525 140
636 3300050511 nmdc:mga08y16_9065_c1 nmdc:mga08y16_9065_c1_2310_2774 140
637 3300050511 nmdc:mga08y16_93277_c1 nmdc:mga08y16_93277_c1_2399_2857 140
638 3300050512 nmdc:mga0n895_106738_c1 nmdc:mga0n895_106738_c1_2267_2728 140
639 3300050512 nmdc:mga0n895_1179991_c1 nmdc:mga0n895_1179991_c1_186_644 140
640 3300050512 nmdc:mga0n895_273931_c1 nmdc:mga0n895_273931_c1_180_644 140
641 3300050512 nmdc:mga0n895_299076_c1 nmdc:mga0n895_299076_c1_818_1282 140
642 3300050512 nmdc:mga0n895_338122_c1 nmdc:mga0n895_338122_c1_833_1291 140
643 3300050512 nmdc:mga0n895_350144_c1 nmdc:mga0n895_350144_c1_613_1074 140
644 3300050512 nmdc:mga0n895_494994_c1 nmdc:mga0n895_494994_c1_717_1181 140
645 3300050513 nmdc:mga0rr50_262953_c1 nmdc:mga0rr50_262953_c1_254_712 140
646 3300050513 nmdc:mga0rr50_44470_c1 nmdc:mga0rr50_44470_c1_681_1142 140
647 3300050514 nmdc:mga08x19_193570_c1 nmdc:mga08x19_193570_c1_700_1161 140
648 3300050515 nmdc:mga0a205_1227128_c1 nmdc:mga0a205_1227128_c1_41_502 140
649 3300050515 nmdc:mga0a205_27457_c1 nmdc:mga0a205_27457_c1_2507_2971 140
650 3300050515 nmdc:mga0a205_568775_c1 nmdc:mga0a205_568775_c1_424_888 140
651 3300050515 nmdc:mga0a205_74538_c1 nmdc:mga0a205_74538_c1_2693_3160 140
652 3300053085 Ga0495619_0033592 Ga0495619_0033592_2796_3254 140
653 3300053094 Ga0500566_0359688 Ga0500566_0359688_62_520 140
654 3300053134 Ga0500658_0265274 Ga0500658_0265274_234_692 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

83

118

0.97

Feature Viewer

pLDDT pTM Quality
68.06 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map