F472799

General Info

Members Datasets Scaffolds Average Seq Length
653 323 1306 138

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0457958|Ga0495634_0457958_260_742
Length 160
Sequence VLHQRGAGGAAVRGADPVEDENMKKSGASQGQSASELISNRIAELGDWRGETLGRMRQLIKHADPDVVEEWKWMNPVWSHDGIICTGESYKNHVKLTFAKGASLKDPARLFNSSLEGNVRRAIDIHEAEEVDESAFKALVRQAIALNSSTKSKPRKKAKS

Samples

Sample ID Description Type Environment
1 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
187 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
192 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
200 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
206 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
207 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
228 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
229 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
230 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
231 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
254 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
255 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
274 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
277 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
278 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
279 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
280 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
289 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
290 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
291 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
310 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
320 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.85
Metatranscriptomes 0
Isolates 0.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0.15
Rhizoplane 3.83
Rhizosphere 94.79
Stem 0
Stem Tuber 0
Unclassified 0.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495634_0457958 3300046642 Bacteria 752
2 Ga0065714_10226595 3300005288 Bacteria 790
3 Ga0065715_10009480 3300005293 Bacteria 2707
4 Ga0065715_11103926 3300005293 Bacteria 519
5 Ga0065707_10119369 3300005295 Bacteria 2161
6 Ga0065707_10123227 3300005295 Bacteria 2070
7 Ga0065707_10288179 3300005295 Bacteria 1031
8 Ga0065707_10403323 3300005295 Bacteria 850
9 Ga0065707_10579115 3300005295 Bacteria 703
10 Ga0065707_11055792 3300005295 Bacteria 526
11 Ga0070658_10137376 3300005327 Bacteria 2040
12 Ga0070683_100273208 3300005329 Bacteria 1608
13 Ga0070683_100900678 3300005329 Bacteria 848
14 Ga0070690_100000548 3300005330 Bacteria 18819
15 Ga0070690_100283405 3300005330 Bacteria 1183
16 Ga0070670_100004029 3300005331 Bacteria 12268
17 Ga0070670_100142861 3300005331 Bacteria 2070
18 Ga0070670_100240041 3300005331 Bacteria 1578
19 Ga0068869_100049676 3300005334 Bacteria 3038
20 Ga0068869_100400536 3300005334 Bacteria 1129
21 Ga0070666_10000883 3300005335 Bacteria 18203
22 Ga0070666_10017454 3300005335 Bacteria 4601
23 Ga0070666_10343707 3300005335 Bacteria 1067
24 Ga0070680_100137045 3300005336 Bacteria 2051
25 Ga0070680_100265982 3300005336 Bacteria 1451
26 Ga0070680_100756666 3300005336 Bacteria 837
27 Ga0070680_101086164 3300005336 Bacteria 691
28 Ga0070680_101260747 3300005336 Bacteria 640
29 Ga0070682_101071729 3300005337 Bacteria 673
30 Ga0068868_100005118 3300005338 Bacteria 9207
31 Ga0068868_100056434 3300005338 Bacteria 3101
32 Ga0068868_100761649 3300005338 Bacteria 871
33 Ga0070689_100000405 3300005340 Bacteria 25370
34 Ga0070689_100043023 3300005340 Bacteria 3470
35 Ga0070689_100422675 3300005340 Bacteria 1130
36 Ga0070689_100497693 3300005340 Bacteria 1044
37 Ga0070691_10224118 3300005341 Bacteria 998
38 Ga0070687_100040463 3300005343 Bacteria 2349
39 Ga0070661_100935293 3300005344 Bacteria 717
40 Ga0070692_10098037 3300005345 Bacteria 1603
41 Ga0070668_100031553 3300005347 Bacteria 4032
42 Ga0070668_100037892 3300005347 Bacteria 3684
43 Ga0070668_100044744 3300005347 Bacteria 3396
44 Ga0070668_100243158 3300005347 Bacteria 1491
45 Ga0070669_100002319 3300005353 Bacteria 13766
46 Ga0070669_100004210 3300005353 Bacteria 10406
47 Ga0070669_100786420 3300005353 Bacteria 808
48 Ga0070669_101011033 3300005353 Bacteria 714
49 Ga0070675_100073498 3300005354 Bacteria 2839
50 Ga0070675_100317704 3300005354 Bacteria 1375
51 Ga0070675_100345029 3300005354 Bacteria 1319
52 Ga0070675_101709465 3300005354 Bacteria 581
53 Ga0070671_100001832 3300005355 Bacteria 16175
54 Ga0070671_100002800 3300005355 Bacteria 13551
55 Ga0070671_100049239 3300005355 Bacteria 3506
56 Ga0070671_101503184 3300005355 Bacteria 596
57 Ga0070674_100232627 3300005356 Bacteria 1439
58 Ga0070674_100536328 3300005356 Bacteria 980
59 Ga0070673_100001966 3300005364 Bacteria 12395
60 Ga0070673_100039201 3300005364 Bacteria 3624
61 Ga0070673_101680306 3300005364 Bacteria 601
62 Ga0070688_100000601 3300005365 Bacteria 18010
63 Ga0070688_100026369 3300005365 Bacteria 3452
64 Ga0070659_100277047 3300005366 Bacteria 1395
65 Ga0070667_100001825 3300005367 Bacteria 18988
66 Ga0070667_100106296 3300005367 Bacteria 2429
67 Ga0070667_100109433 3300005367 Bacteria 2395
68 Ga0070667_100180623 3300005367 Bacteria 1866
69 Ga0070667_100187574 3300005367 Bacteria 1831
70 Ga0070667_100225943 3300005367 Bacteria 1668
71 Ga0070667_100554676 3300005367 Bacteria 1056
72 Ga0070703_10067698 3300005406 Bacteria 1185
73 Ga0070709_10090958 3300005434 Bacteria 2013
74 Ga0070709_10904495 3300005434 Bacteria 698
75 Ga0070713_100004644 3300005436 Bacteria 9264
76 Ga0070713_100006863 3300005436 Bacteria 7935
77 Ga0070710_10019617 3300005437 Bacteria 3497
78 Ga0070711_100013008 3300005439 Bacteria 5217
79 Ga0070705_100065158 3300005440 Bacteria 2180
80 Ga0070700_100002123 3300005441 Bacteria 10059
81 Ga0070700_100545437 3300005441 Bacteria 900
82 Ga0070700_100703470 3300005441 Bacteria 804
83 Ga0070694_100006817 3300005444 Bacteria 6939
84 Ga0070678_100002121 3300005456 Bacteria 10755
85 Ga0070678_100006881 3300005456 Bacteria 6707
86 Ga0070678_100219209 3300005456 Bacteria 1581
87 Ga0070678_100874458 3300005456 Bacteria 820
88 Ga0070678_100878184 3300005456 Bacteria 818
89 Ga0070662_100674523 3300005457 Bacteria 873
90 Ga0070681_11059158 3300005458 Bacteria 731
91 Ga0068867_100002614 3300005459 Bacteria 12702
92 Ga0068867_101290466 3300005459 Bacteria 674
93 Ga0070685_10009344 3300005466 Bacteria 5063
94 Ga0070685_10138893 3300005466 Bacteria 1527
95 Ga0070706_100549754 3300005467 Bacteria 1074
96 Ga0070707_100492015 3300005468 Bacteria 1188
97 Ga0070707_101572563 3300005468 Bacteria 624
98 Ga0070699_100000901 3300005518 Bacteria 27725
99 Ga0070699_100027688 3300005518 Bacteria 4886
100 Ga0070699_100079576 3300005518 Bacteria 2855
101 Ga0070699_100175626 3300005518 Archaea 1899
102 Ga0070699_102172835 3300005518 Bacteria 506
103 Ga0070679_100145154 3300005530 Bacteria 2351
104 Ga0070679_101039358 3300005530 Bacteria 763
105 Ga0070684_100210843 3300005535 Bacteria 1770
106 Ga0070684_100281187 3300005535 Bacteria 1524
107 Ga0070684_100660459 3300005535 Bacteria 973
108 Ga0070684_101342799 3300005535 Bacteria 673
109 Ga0070697_100105470 3300005536 Bacteria 2344
110 Ga0070697_100307710 3300005536 Bacteria 1363
111 Ga0068853_100812683 3300005539 Bacteria 896
112 Ga0068853_100925828 3300005539 Bacteria 838
113 Ga0070672_100058191 3300005543 Bacteria 3036
114 Ga0070672_100189024 3300005543 Bacteria 1718
115 Ga0070672_100466043 3300005543 Bacteria 1090
116 Ga0070672_100554027 3300005543 Bacteria 998
117 Ga0070686_100038237 3300005544 Bacteria 2982
118 Ga0070695_100055355 3300005545 Bacteria 2556
119 Ga0070695_100062952 3300005545 Bacteria 2410
120 Ga0070696_100005257 3300005546 Bacteria 8641
121 Ga0070696_100216798 3300005546 Bacteria 1434
122 Ga0070696_100353448 3300005546 Bacteria 1139
123 Ga0070696_100490727 3300005546 Unclassified 975
124 Ga0070693_100703332 3300005547 Bacteria 740
125 Ga0070665_100006938 3300005548 Bacteria 11514
126 Ga0070665_100016409 3300005548 Bacteria 7427
127 Ga0070665_100501032 3300005548 Bacteria 1225
128 Ga0070665_100568730 3300005548 Bacteria 1146
129 Ga0070704_100145265 3300005549 Bacteria 1858
130 Ga0068855_100039677 3300005563 Bacteria 5589
131 Ga0068855_100076769 3300005563 Bacteria 3876
132 Ga0068855_100677094 3300005563 Bacteria 1106
133 Ga0070664_100196023 3300005564 Bacteria 1800
134 Ga0070664_100628120 3300005564 Bacteria 997
135 Ga0070664_100637404 3300005564 Bacteria 990
136 Ga0068857_100090730 3300005577 Bacteria 2734
137 Ga0068857_100373365 3300005577 Bacteria 1323
138 Ga0068854_100671582 3300005578 Bacteria 891
139 Ga0068854_100677760 3300005578 Bacteria 888
140 Ga0068856_100047830 3300005614 Bacteria 4215
141 Ga0068856_100057627 3300005614 Bacteria 3836
142 Ga0068856_100584819 3300005614 Bacteria 1138
143 Ga0070702_100001986 3300005615 Bacteria 8613
144 Ga0068852_100156343 3300005616 Bacteria 2124
145 Ga0068859_100008846 3300005617 Bacteria 10168
146 Ga0068859_100014970 3300005617 Bacteria 7787
147 Ga0068859_100070574 3300005617 Bacteria 3529
148 Ga0068859_100120491 3300005617 Bacteria 2691
149 Ga0068864_100005808 3300005618 Bacteria 10125
150 Ga0068864_100016829 3300005618 Bacteria 6093
151 Ga0068866_10402983 3300005718 Bacteria 883
152 Ga0068866_10465369 3300005718 Bacteria 830
153 Ga0068861_100004297 3300005719 Bacteria 9557
154 Ga0068851_10080837 3300005834 Bacteria 1697
155 Ga0068870_10024010 3300005840 Bacteria 3013
156 Ga0068870_10110299 3300005840 Bacteria 1570
157 Ga0068863_100002751 3300005841 Bacteria 17409
158 Ga0068863_100038988 3300005841 Bacteria 4521
159 Ga0068863_100042062 3300005841 Bacteria 4343
160 Ga0068863_100438539 3300005841 Bacteria 1281
161 Ga0068858_100004388 3300005842 Bacteria 13844
162 Ga0068858_100047188 3300005842 Bacteria 3993
163 Ga0068858_100195040 3300005842 Bacteria 1914
164 Ga0068858_100416233 3300005842 Bacteria 1292
165 Ga0068860_100013263 3300005843 Bacteria 8087
166 Ga0068860_100308427 3300005843 Bacteria 1552
167 Ga0068862_100004600 3300005844 Bacteria 11628
168 Ga0068862_100186782 3300005844 Bacteria 1863
169 Ga0068862_100441730 3300005844 Bacteria 1225
170 Ga0068862_101029044 3300005844 Bacteria 816
171 Ga0070715_10698378 3300006163 Bacteria 606
172 Ga0075366_10830197 3300006195 Bacteria 575
173 Ga0097621_100424750 3300006237 Bacteria 1193
174 Ga0068871_100008514 3300006358 Bacteria 7375
175 Ga0068871_100013772 3300006358 Bacteria 6012
176 Ga0068871_100213142 3300006358 Bacteria 1671
177 Ga0068871_100347219 3300006358 Bacteria 1312
178 Ga0068871_100685930 3300006358 Bacteria 937
179 Ga0075428_100031707 3300006844 Bacteria 5839
180 Ga0075428_100121386 3300006844 Bacteria 2846
181 Ga0075428_101953844 3300006844 Bacteria 609
182 Ga0075430_100008489 3300006846 Bacteria 8679
183 Ga0075430_100181649 3300006846 Bacteria 1750
184 Ga0075431_100286972 3300006847 Bacteria 1666
185 Ga0075433_10034996 3300006852 Bacteria 4317
186 Ga0075434_100218848 3300006871 Bacteria 1924
187 Ga0075434_100735048 3300006871 Bacteria 1004
188 Ga0075434_102459497 3300006871 Bacteria 522
189 Ga0075429_100032387 3300006880 Bacteria 4543
190 Ga0068865_100001819 3300006881 Bacteria 12528
191 Ga0068865_100662513 3300006881 Bacteria 888
192 Ga0068865_100919829 3300006881 Bacteria 762
193 Ga0097620_100008846 3300006931 Bacteria 10168
194 Ga0097620_100014970 3300006931 Bacteria 7787
195 Ga0097620_100070572 3300006931 Bacteria 3529
196 Ga0097620_100120493 3300006931 Bacteria 2691
197 Ga0075435_100468131 3300007076 Bacteria 1088
198 Ga0099795_10056299 3300007788 Bacteria 1446
199 Ga0105240_10000499 3300009093 Bacteria 72315
200 Ga0105240_10809658 3300009093 Bacteria 1014
201 Ga0111539_10050307 3300009094 Bacteria 4964
202 Ga0111539_10202003 3300009094 Bacteria 2318
203 Ga0111539_10325676 3300009094 Bacteria 1788
204 Ga0105245_10012238 3300009098 Bacteria 7465
205 Ga0105245_10825041 3300009098 Bacteria 966
206 Ga0114129_10274400 3300009147 Bacteria 2255
207 Ga0114129_10949113 3300009147 Bacteria 1086
208 Ga0105243_10002935 3300009148 Bacteria 14105
209 Ga0105243_11345329 3300009148 Bacteria 733
210 Ga0105241_10056325 3300009174 Bacteria 3014
211 Ga0105242_10334651 3300009176 Bacteria 1393
212 Ga0105242_10398439 3300009176 Bacteria 1284
213 Ga0105242_10537957 3300009176 Bacteria 1118
214 Ga0105242_11617178 3300009176 Bacteria 682
215 Ga0105248_10004875 3300009177 Bacteria 14836
216 Ga0105248_10008797 3300009177 Bacteria 11088
217 Ga0105248_10069220 3300009177 Bacteria 3962
218 Ga0105248_10336496 3300009177 Bacteria 1700
219 Ga0105248_10420221 3300009177 Bacteria 1506
220 Ga0105237_10627944 3300009545 Bacteria 1081
221 Ga0105238_10522801 3300009551 Bacteria 1189
222 Ga0105238_10987321 3300009551 Bacteria 863
223 Ga0105249_10028823 3300009553 Bacteria 5011
224 Ga0105249_10174290 3300009553 Bacteria 2088
225 Ga0105249_10233617 3300009553 Bacteria 1814
226 Ga0105249_10249023 3300009553 Bacteria 1761
227 Ga0105249_10408285 3300009553 Bacteria 1390
228 Ga0105249_10682030 3300009553 Bacteria 1087
229 Ga0105239_10011786 3300010375 Bacteria 9757
230 Ga0105246_10403090 3300011119 Bacteria 1136
231 Ga0105246_11339374 3300011119 Bacteria 665
232 Ga0157329_1020153 3300012491 Bacteria 618
233 Ga0157373_10030257 3300013100 Bacteria 3896
234 Ga0157370_10018251 3300013104 Bacteria 7057
235 Ga0157370_10801023 3300013104 Bacteria 857
236 Ga0157374_10073113 3300013296 Bacteria 3236
237 Ga0157374_10080152 3300013296 Bacteria 3096
238 Ga0157374_10804754 3300013296 Bacteria 956
239 Ga0157378_10070927 3300013297 Bacteria 3128
240 Ga0157378_10441500 3300013297 Bacteria 1290
241 Ga0163162_10112137 3300013306 Bacteria 2826
242 Ga0163162_10301740 3300013306 Bacteria 1733
243 Ga0163162_10365283 3300013306 Bacteria 1576
244 Ga0163162_10982265 3300013306 Bacteria 954
245 Ga0157372_10222397 3300013307 Bacteria 2188
246 Ga0157372_11297260 3300013307 Bacteria 840
247 Ga0157375_10004158 3300013308 Bacteria 12559
248 Ga0157375_10004909 3300013308 Bacteria 11628
249 Ga0157375_10080009 3300013308 Bacteria 3305
250 Ga0157375_10535620 3300013308 Bacteria 1334
251 Ga0157375_10982942 3300013308 Bacteria 984
252 Ga0157375_11679679 3300013308 Bacteria 752
253 Ga0163163_10025759 3300014325 Bacteria 5610
254 Ga0163163_10052947 3300014325 Bacteria 4006
255 Ga0157380_10024201 3300014326 Bacteria 4593
256 Ga0157380_10167170 3300014326 Bacteria 1918
257 Ga0157380_11091018 3300014326 Bacteria 837
258 Ga0157377_10014026 3300014745 Bacteria 4070
259 Ga0157379_10003561 3300014968 Bacteria 13196
260 Ga0157379_10010072 3300014968 Bacteria 8239
261 Ga0157379_10024131 3300014968 Bacteria 5397
262 Ga0157379_10353695 3300014968 Bacteria 1345
263 Ga0157376_10000317 3300014969 Bacteria 32318
264 Ga0157376_10003390 3300014969 Bacteria 10969
265 Ga0157376_10435568 3300014969 Bacteria 1275
266 Ga0157376_10709744 3300014969 Bacteria 1011
267 Ga0157376_10973274 3300014969 Bacteria 870
268 Ga0183362_10004 3300015683 Bacteria 569303
269 Ga0163161_10171457 3300017792 Bacteria 1659
270 Ga0207697_10135388 3300025315 Bacteria 1066
271 Ga0207653_10060440 3300025885 Bacteria 1277
272 Ga0207682_10126702 3300025893 Bacteria 1137
273 Ga0207642_10817753 3300025899 Bacteria 593
274 Ga0207688_10024946 3300025901 Bacteria 3281
275 Ga0207680_10000417 3300025903 Bacteria 20251
276 Ga0207680_10058027 3300025903 Bacteria 2345
277 Ga0207680_10316841 3300025903 Bacteria 1090
278 Ga0207685_10016883 3300025905 Bacteria 2346
279 Ga0207699_10490061 3300025906 Bacteria 886
280 Ga0207645_10160060 3300025907 Bacteria 1472
281 Ga0207645_10407340 3300025907 Bacteria 915
282 Ga0207643_10014208 3300025908 Bacteria 4323
283 Ga0207643_10090839 3300025908 Bacteria 1780
284 Ga0207705_10004312 3300025909 Bacteria 10765
285 Ga0207684_10011665 3300025910 Bacteria 7671
286 Ga0207684_10432582 3300025910 Bacteria 1130
287 Ga0207654_10206096 3300025911 Bacteria 1297
288 Ga0207707_10014058 3300025912 Bacteria 6978
289 Ga0207707_10033841 3300025912 Bacteria 4472
290 Ga0207695_10837972 3300025913 Bacteria 800
291 Ga0207663_10013794 3300025916 Bacteria 4403
292 Ga0207660_10001655 3300025917 Bacteria 14931
293 Ga0207660_10067664 3300025917 Bacteria 2588
294 Ga0207662_10011197 3300025918 Bacteria 4966
295 Ga0207662_10071369 3300025918 Bacteria 2103
296 Ga0207657_10581206 3300025919 Bacteria 875
297 Ga0207649_10758903 3300025920 Bacteria 755
298 Ga0207652_10011529 3300025921 Bacteria 7126
299 Ga0207652_10018960 3300025921 Bacteria 5649
300 Ga0207652_10462693 3300025921 Bacteria 1143
301 Ga0207646_10163354 3300025922 Archaea 2010
302 Ga0207681_10001355 3300025923 Bacteria 15822
303 Ga0207650_10028132 3300025925 Bacteria 4028
304 Ga0207650_10533564 3300025925 Bacteria 983
305 Ga0207650_10639115 3300025925 Bacteria 896
306 Ga0207650_10831269 3300025925 Bacteria 783
307 Ga0207659_10046817 3300025926 Bacteria 3056
308 Ga0207659_10639880 3300025926 Bacteria 908
309 Ga0207687_10000151 3300025927 Bacteria 46396
310 Ga0207687_10006424 3300025927 Bacteria 7766
311 Ga0207687_11283195 3300025927 Bacteria 629
312 Ga0207700_10042370 3300025928 Bacteria 3337
313 Ga0207644_10002837 3300025931 Bacteria 11179
314 Ga0207644_10003559 3300025931 Bacteria 10080
315 Ga0207644_10891375 3300025931 Bacteria 745
316 Ga0207644_11001448 3300025931 Bacteria 701
317 Ga0207686_10142831 3300025934 Bacteria 1657
318 Ga0207686_10254827 3300025934 Bacteria 1284
319 Ga0207686_10329457 3300025934 Bacteria 1143
320 Ga0207709_10032314 3300025935 Bacteria 3064
321 Ga0207709_10462843 3300025935 Bacteria 982
322 Ga0207670_10015295 3300025936 Bacteria 4581
323 Ga0207670_10086338 3300025936 Bacteria 2207
324 Ga0207669_10180016 3300025937 Bacteria 1514
325 Ga0207669_10182937 3300025937 Bacteria 1504
326 Ga0207669_10338707 3300025937 Bacteria 1158
327 Ga0207704_10006461 3300025938 Bacteria 5469
328 Ga0207704_11394850 3300025938 Bacteria 600
329 Ga0207665_10455236 3300025939 Bacteria 983
330 Ga0207691_10014726 3300025940 Bacteria 7455
331 Ga0207691_10038709 3300025940 Bacteria 4412
332 Ga0207691_10123918 3300025940 Bacteria 2288
333 Ga0207691_10316040 3300025940 Bacteria 1340
334 Ga0207691_10781100 3300025940 Bacteria 803
335 Ga0207711_10000206 3300025941 Bacteria 62928
336 Ga0207711_10120519 3300025941 Bacteria 2341
337 Ga0207711_10130430 3300025941 Bacteria 2253
338 Ga0207711_10163132 3300025941 Bacteria 2019
339 Ga0207711_11294790 3300025941 Bacteria 671
340 Ga0207689_10227344 3300025942 Bacteria 1542
341 Ga0207661_10725203 3300025944 Bacteria 915
342 Ga0207661_11026685 3300025944 Bacteria 759
343 Ga0207679_10190920 3300025945 Bacteria 1703
344 Ga0207667_10145977 3300025949 Bacteria 2435
345 Ga0207667_10213334 3300025949 Bacteria 1978
346 Ga0207651_10018251 3300025960 Bacteria 4169
347 Ga0207651_10284690 3300025960 Bacteria 1368
348 Ga0207651_10291840 3300025960 Bacteria 1352
349 Ga0207651_10878266 3300025960 Bacteria 798
350 Ga0207712_10005328 3300025961 Bacteria 8122
351 Ga0207712_10408130 3300025961 Bacteria 1143
352 Ga0207712_10408984 3300025961 Bacteria 1142
353 Ga0207712_10543079 3300025961 Bacteria 999
354 Ga0207668_10046547 3300025972 Bacteria 2964
355 Ga0207668_10065580 3300025972 Bacteria 2571
356 Ga0207668_10073947 3300025972 Bacteria 2444
357 Ga0207668_10120996 3300025972 Bacteria 1982
358 Ga0207640_10003083 3300025981 Bacteria 8975
359 Ga0207640_11085826 3300025981 Bacteria 707
360 Ga0207658_10036512 3300025986 Bacteria 3524
361 Ga0207658_10091796 3300025986 Bacteria 2357
362 Ga0207658_10814942 3300025986 Bacteria 848
363 Ga0207677_10000980 3300026023 Bacteria 15778
364 Ga0207677_10028870 3300026023 Bacteria 3516
365 Ga0207677_10301144 3300026023 Bacteria 1324
366 Ga0207703_10001548 3300026035 Bacteria 20841
367 Ga0207703_10258821 3300026035 Bacteria 1572
368 Ga0207703_10333110 3300026035 Bacteria 1393
369 Ga0207678_10422296 3300026067 Bacteria 1156
370 Ga0207678_10461318 3300026067 Bacteria 1105
371 Ga0207708_10001370 3300026075 Bacteria 18328
372 Ga0207708_10394217 3300026075 Bacteria 1144
373 Ga0207702_10094635 3300026078 Bacteria 2623
374 Ga0207702_10150747 3300026078 Bacteria 2115
375 Ga0207641_10019444 3300026088 Bacteria 5576
376 Ga0207641_10072772 3300026088 Bacteria 2960
377 Ga0207641_10073290 3300026088 Bacteria 2951
378 Ga0207641_10288538 3300026088 Bacteria 1546
379 Ga0207648_10006874 3300026089 Bacteria 11280
380 Ga0207648_10227779 3300026089 Bacteria 1658
381 Ga0207676_10000384 3300026095 Bacteria 37732
382 Ga0207676_10077221 3300026095 Bacteria 2693
383 Ga0207676_11937906 3300026095 Bacteria 588
384 Ga0207674_10209358 3300026116 Bacteria 1899
385 Ga0207674_11291100 3300026116 Bacteria 699
386 Ga0207675_100002718 3300026118 Bacteria 17433
387 Ga0207675_101962090 3300026118 Bacteria 603
388 Ga0207675_102615151 3300026118 Bacteria 514
389 Ga0207683_10008204 3300026121 Bacteria 8937
390 Ga0207683_10012187 3300026121 Bacteria 7338
391 Ga0207683_10234461 3300026121 Bacteria 1674
392 Ga0207683_10416482 3300026121 Bacteria 1237
393 Ga0207683_10531493 3300026121 Bacteria 1087
394 Ga0207698_10534090 3300026142 Bacteria 1147
395 Ga0207428_10405035 3300027907 Bacteria 998
396 Ga0268266_10007645 3300028379 Bacteria 9719
397 Ga0268266_10500681 3300028379 Bacteria 1160
398 Ga0268266_11551942 3300028379 Bacteria 638
399 Ga0268265_10010433 3300028380 Bacteria 6273
400 Ga0268265_10208727 3300028380 Bacteria 1700
401 Ga0268265_11033895 3300028380 Bacteria 813
402 Ga0268265_11146108 3300028380 Bacteria 773
403 Ga0268264_10000781 3300028381 Bacteria 34982
404 Ga0307517_10350015 3300028786 Bacteria 803
405 Ga0307515_10137180 3300028794 Bacteria 2650
406 Ga0265332_10048422 3300031238 Bacteria 1828
407 Ga0265320_10005819 3300031240 Bacteria 7856
408 Ga0265320_10175128 3300031240 Bacteria 963
409 Ga0307513_10007080 3300031456 Bacteria 14580
410 Ga0307408_100279703 3300031548 Bacteria 1389
411 Ga0307514_10475080 3300031649 Bacteria 605
412 Ga0265314_10029639 3300031711 Bacteria 4063
413 Ga0307410_10973135 3300031852 Bacteria 730
414 Ga0307409_100497501 3300031995 Bacteria 1186
415 Ga0307416_100910473 3300032002 Bacteria 980
416 Ga0373934_0005200 3300035086 Bacteria 4815
417 Ga0373934_0013629 3300035086 Bacteria 3077
418 Ga0373949_0178314 3300035090 Bacteria 628
419 Ga0373923_0233889 3300035111 Bacteria 857
420 Ga0373939_0088312 3300035114 Bacteria 1043
421 Ga0373953_0050378 3300035117 Bacteria 1682
422 Ga0373953_0086124 3300035117 Bacteria 1311
423 Ga0373956_0197588 3300035119 Bacteria 953
424 Ga0373957_0112979 3300035120 Bacteria 1095
425 Ga0373946_0012328 3300035171 Bacteria 3198
426 Ga0373955_0027056 3300035172 Bacteria 2961
427 Ga0373955_0188974 3300035172 Bacteria 1224
428 Ga0373942_0115426 3300035207 Bacteria 834
429 Ga0373931_0062241 3300035691 Bacteria 2014
430 Ga0373931_0385400 3300035691 Bacteria 885
431 Ga0373935_0003548 3300035692 Bacteria 9084
432 Ga0373935_0236042 3300035692 Bacteria 1275
433 Ga0373927_0006648 3300035695 Bacteria 7868
434 Ga0373927_0038656 3300035695 Bacteria 3098
435 Ga0373927_0118094 3300035695 Bacteria 1730
436 Ga0373933_0005053 3300035724 Bacteria 7198
437 Ga0373947_0156229 3300035725 Bacteria 1472
438 Ga0373937_0009778 3300036401 Bacteria 8360
439 Ga0373937_0123295 3300036401 Bacteria 2416
440 Ga0373937_0329534 3300036401 Bacteria 1445
441 Ga0373925_0003856 3300037068 Bacteria 11481
442 Ga0373925_0022247 3300037068 Bacteria 4624
443 Ga0373925_0503905 3300037068 Bacteria 994
444 Ga0395899_0562629 3300037312 Bacteria 731
445 Ga0395901_0387883 3300038443 Bacteria 1437
446 Ga0242420_060515 3300038996 Bacteria 755
447 Ga0451791_0187571 3300041451 Bacteria 1114
448 Ga0451791_0942218 3300041451 Bacteria 601
449 Ga0451800_1380414 3300041459 Bacteria 1048
450 Ga0451807_1991881 3300041486 Bacteria 887
451 Ga0451853_2245260 3300041512 Bacteria 1851
452 Ga0439441_056445 3300042001 Bacteria 819
453 Ga0439441_112218 3300042001 Bacteria 619
454 Ga0439443_050920 3300042003 Bacteria 725
455 Ga0453683_0892248 3300044673 Bacteria 588
456 Ga0453684_0007059 3300044712 Bacteria 20989
457 Ga0453684_1668264 3300044712 Bacteria 652
458 Ga0466970_0465706 3300044765 Bacteria 726
459 Ga0495592_0091051 3300046454 Bacteria 2187
460 Ga0495592_0150443 3300046454 Bacteria 1610
461 Ga0495603_0256064 3300046455 Bacteria 1008
462 Ga0495603_0863244 3300046455 Bacteria 515
463 Ga0495591_000325 3300046458 Bacteria 43149
464 Ga0495629_0002254 3300046459 Bacteria 14859
465 Ga0495629_0081441 3300046459 Bacteria 2259
466 Ga0495638_0009305 3300046460 Bacteria 6905
467 Ga0495641_0054929 3300046461 Bacteria 1809
468 Ga0495651_0063790 3300046462 Bacteria 2815
469 Ga0495651_0070303 3300046462 Bacteria 2664
470 Ga0495651_0130169 3300046462 Bacteria 1838
471 Ga0495653_0015640 3300046463 Bacteria 6184
472 Ga0495653_0037885 3300046463 Bacteria 3786
473 Ga0495653_0040304 3300046463 Bacteria 3651
474 Ga0495653_0043656 3300046463 Bacteria 3484
475 Ga0495650_0022338 3300046471 Bacteria 3037
476 Ga0495580_0018921 3300046472 Bacteria 5123
477 Ga0495580_0022825 3300046472 Bacteria 4599
478 Ga0495580_0037073 3300046472 Bacteria 3500
479 Ga0495580_0086490 3300046472 Bacteria 2183
480 Ga0495580_0464210 3300046472 Bacteria 848
481 Ga0495582_0129508 3300046473 Bacteria 1425
482 Ga0495582_0143722 3300046473 Bacteria 1353
483 Ga0495582_0319930 3300046473 Bacteria 892
484 Ga0495582_0473224 3300046473 Bacteria 724
485 Ga0495605_0004706 3300046474 Bacteria 7982
486 Ga0495639_0723462 3300046475 Bacteria 515
487 Ga0495662_0034672 3300046476 Bacteria 2435
488 Ga0495664_0041483 3300046477 Bacteria 2723
489 Ga0495664_0204527 3300046477 Bacteria 1196
490 Ga0495594_0135742 3300046499 Bacteria 1394
491 Ga0495594_0766486 3300046499 Bacteria 544
492 Ga0495596_0002393 3300046500 Bacteria 10137
493 Ga0495607_0044125 3300046501 Bacteria 2631
494 Ga0495608_0035203 3300046511 Bacteria 3378
495 Ga0495618_0001764 3300046514 Bacteria 14353
496 Ga0495618_0528825 3300046514 Bacteria 708
497 Ga0495618_0670127 3300046514 Bacteria 612
498 Ga0495628_0003529 3300046516 Bacteria 14005
499 Ga0495628_0006858 3300046516 Bacteria 9902
500 Ga0495628_0176201 3300046516 Bacteria 1619
501 Ga0495628_0192976 3300046516 Bacteria 1537
502 Ga0495628_0205250 3300046516 Bacteria 1484
503 Ga0495628_1014927 3300046516 Bacteria 570
504 Ga0495630_0012072 3300046517 Bacteria 6262
505 Ga0495631_0044241 3300046518 Bacteria 1963
506 Ga0495644_0208355 3300046523 Bacteria 754
507 Ga0495644_0389549 3300046523 Bacteria 551
508 Ga0495648_0004224 3300046524 Bacteria 12325
509 Ga0495663_0371554 3300046525 Bacteria 523
510 Ga0495666_0005640 3300046526 Bacteria 6302
511 Ga0495666_0070739 3300046526 Bacteria 1659
512 Ga0495642_0231004 3300046528 Bacteria 808
513 Ga0495652_0046466 3300046529 Bacteria 3728
514 Ga0495652_0058228 3300046529 Bacteria 3272
515 Ga0495665_0000428 3300046531 Bacteria 21430
516 Ga0495640_0014148 3300046533 Bacteria 6048
517 Ga0495586_0290758 3300046535 Bacteria 936
518 Ga0495586_0448840 3300046535 Bacteria 743
519 Ga0495587_0008908 3300046536 Bacteria 6439
520 Ga0495587_0009056 3300046536 Bacteria 6389
521 Ga0495621_0012847 3300046539 Bacteria 2618
522 Ga0495597_0125528 3300046542 Bacteria 1067
523 Ga0495645_0000477 3300046543 Bacteria 27714
524 Ga0495645_0086930 3300046543 Bacteria 2237
525 Ga0495645_0117878 3300046543 Bacteria 1873
526 Ga0495622_0000029 3300046557 Bacteria 130861
527 Ga0495622_0286273 3300046557 Bacteria 720
528 Ga0495667_0002140 3300046559 Bacteria 13164
529 Ga0495667_0195245 3300046559 Bacteria 1296
530 Ga0495667_0204167 3300046559 Bacteria 1264
531 Ga0495656_0000047 3300046615 Bacteria 59690
532 Ga0495634_0016785 3300046642 Bacteria 5229
533 Ga0495634_0085263 3300046642 Bacteria 2059
534 Ga0495635_0002492 3300046663 Bacteria 12570
535 Ga0495635_0030552 3300046663 Bacteria 3743
536 Ga0495635_0195720 3300046663 Bacteria 1372
537 Ga0495635_0302716 3300046663 Bacteria 1072
538 Ga0495659_0122357 3300046664 Bacteria 1026
539 Ga0495661_0009932 3300046665 Bacteria 6509
540 Ga0495588_0179618 3300046674 Bacteria 1118
541 Ga0495657_0041917 3300046675 Bacteria 3129
542 Ga0495657_0204222 3300046675 Bacteria 1203
543 Ga0495599_0000818 3300046678 Bacteria 17508
544 Ga0495599_0003940 3300046678 Bacteria 8732
545 Ga0495599_0015138 3300046678 Bacteria 4783
546 Ga0495623_0005647 3300046679 Bacteria 8164
547 Ga0495623_0126769 3300046679 Bacteria 1532
548 Ga0495623_0228703 3300046679 Bacteria 1056
549 Ga0495646_0001254 3300046680 Bacteria 14897
550 Ga0495646_0240774 3300046680 Bacteria 972
551 Ga0495647_0078360 3300046681 Bacteria 1336
552 Ga0495647_0360710 3300046681 Bacteria 663
553 Ga0495647_0532901 3300046681 Bacteria 548
554 Ga0495658_0022702 3300046683 Bacteria 3322
555 Ga0495658_0114265 3300046683 Bacteria 1627
556 Ga0495669_0011723 3300046684 Bacteria 3727
557 Ga0495669_0571331 3300046684 Bacteria 550
558 Ga0495613_0005215 3300046689 Bacteria 9761
559 Ga0495624_0015328 3300046690 Bacteria 5178
560 Ga0495624_0069277 3300046690 Bacteria 2197
561 Ga0495624_0345641 3300046690 Bacteria 895
562 Ga0495670_0686178 3300046691 Bacteria 558
563 Ga0495589_0008336 3300046794 Bacteria 5415
564 Ga0495589_0031769 3300046794 Bacteria 2657
565 Ga0495600_0001481 3300046809 Bacteria 13007
566 Ga0495600_0044549 3300046809 Bacteria 2894
567 Ga0495600_0077454 3300046809 Bacteria 2171
568 Ga0495600_0089061 3300046809 Bacteria 2013
569 Ga0495660_0038664 3300046810 Bacteria 2652
570 Ga0495581_0009248 3300047315 Bacteria 5702
571 Ga0495581_0012141 3300047315 Bacteria 4986
572 Ga0495581_0300779 3300047315 Bacteria 938
573 Ga0495604_0100044 3300047317 Bacteria 2132
574 Ga0495674_0050275 3300047319 Bacteria 3679
575 Ga0495674_0270488 3300047319 Bacteria 1394
576 Ga0495676_0015142 3300047321 Bacteria 6881
577 Ga0495680_0065373 3300047322 Bacteria 2785
578 Ga0495680_0085132 3300047322 Bacteria 2381
579 Ga0495683_0003029 3300047323 Bacteria 9882
580 Ga0495683_0096759 3300047323 Bacteria 1424
581 Ga0495687_083257 3300047443 Bacteria 1246
582 Ga0495675_0000980 3300047444 Bacteria 17320
583 Ga0495679_000078 3300047446 Bacteria 91220
584 Ga0495673_0003323 3300047469 Bacteria 10661
585 Ga0495684_0057010 3300047471 Bacteria 2977
586 Ga0495684_0337966 3300047471 Bacteria 1072
587 Ga0495593_0006054 3300047673 Bacteria 7114
588 Ga0495602_0062316 3300048088 Bacteria 3235
589 Ga0495602_0972412 3300048088 Bacteria 561
590 Ga0495614_0000980 3300048089 Bacteria 12132
591 Ga0495614_0026740 3300048089 Bacteria 2487
592 Ga0495614_0263367 3300048089 Bacteria 791
593 Ga0496100_0010475 3300048903 Bacteria 5249
594 Ga0496100_0106371 3300048903 Bacteria 1942
595 Ga0496100_0148363 3300048903 Bacteria 1670
596 Ga0496101_0843553 3300048904 Bacteria 722
597 Ga0496102_0678539 3300048905 Bacteria 953
598 Ga0496103_0238749 3300048906 Bacteria 1169
599 Ga0496103_0530178 3300048906 Bacteria 752
600 Ga0496104_0033967 3300048907 Bacteria 4755
601 Ga0496104_0105225 3300048907 Bacteria 2704
602 Ga0496105_0019878 3300048908 Bacteria 5419
603 Ga0496105_0076926 3300048908 Bacteria 2756
604 Ga0496106_0045928 3300048909 Bacteria 3282
605 Ga0496108_0117753 3300048911 Bacteria 2276
606 Ga0496109_0703998 3300048912 Bacteria 947
607 Ga0496110_0018180 3300048913 Bacteria 5890
608 Ga0496111_0044620 3300048914 Bacteria 3187
609 Ga0496112_0273460 3300048915 Bacteria 1637
610 Ga0496112_1019780 3300048915 Bacteria 747
611 Ga0496113_0612885 3300048916 Bacteria 871
612 Ga0496114_0007429 3300048917 Bacteria 8664
613 Ga0496115_0624382 3300048918 Bacteria 854
614 Ga0495682_0003827 3300049460 Bacteria 6600
615 Ga0501071_0844492 3300049587 Bacteria 706
616 Ga0501076_0176855 3300049592 Bacteria 1739
617 Ga0501217_229928 3300049661 Bacteria 590
618 Ga0501079_0116608 3300049741 Bacteria 2076
619 Ga0501044_1605041 3300049823 Bacteria 515
620 Ga0501045_1371665 3300049824 Bacteria 514
621 nmdc:mga05p37_191180_c1 3300050507 Bacteria 2485
622 nmdc:mga05p37_846925_c1 3300050507 Bacteria 994
623 nmdc:mga09592_203655_c1 3300050508 Bacteria 1714
624 nmdc:mga0qj67_14031_c1 3300050509 Bacteria 6052
625 nmdc:mga0qj67_146883_c1 3300050509 Bacteria 1912
626 nmdc:mga0qj67_36746_c1 3300050509 Bacteria 3834
627 nmdc:mga06r32_18546_c1 3300050510 Bacteria 6373
628 nmdc:mga06r32_211945_c1 3300050510 Bacteria 1925
629 nmdc:mga06r32_376062_c1 3300050510 Bacteria 1403
630 nmdc:mga06r32_41807_c1 3300050510 Bacteria 4356
631 nmdc:mga06r32_833860_c1 3300050510 Bacteria 881
632 nmdc:mga08y16_1203761_c1 3300050511 Archaea 728
633 nmdc:mga08y16_183042_c1 3300050511 Bacteria 2175
634 nmdc:mga08y16_253785_c1 3300050511 Bacteria 1817
635 nmdc:mga08y16_986009_c1 3300050511 Bacteria 823
636 nmdc:mga0n895_176185_c1 3300050512 Bacteria 2169
637 nmdc:mga0n895_210512_c1 3300050512 Bacteria 1974
638 nmdc:mga0n895_2114773_c1 3300050512 Bacteria 519
639 nmdc:mga0rr50_267824_c1 3300050513 Bacteria 1423
640 nmdc:mga0rr50_649129_c1 3300050513 Bacteria 900
641 nmdc:mga08x19_120_c1 3300050514 Bacteria 70057
642 nmdc:mga0a205_12922_c1 3300050515 Bacteria 7746
643 Ga0495601_0012041 3300053077 Bacteria 5184
644 Ga0495601_0018499 3300053077 Bacteria 4242
645 Ga0495601_0066356 3300053077 Bacteria 2297
646 Ga0495601_0262831 3300053077 Bacteria 1126
647 Ga0495655_0345575 3300053083 Bacteria 520
648 Ga0495619_0111350 3300053085 Bacteria 1871
649 Ga0500595_007641 3300053119 Bacteria 4475
650 Ga0500619_002984 3300053154 Bacteria 3373
651 Ga0501084_1206071 3300054114 Bacteria 635
652 Ga0501082_0330618 3300060353 Bacteria 1328
653 8055269226 8055266321 Bacteria 7999742
654 Ga0495634_0457958
655 Ga0065714_10226595
656 Ga0065715_10009480
657 Ga0065715_11103926
658 Ga0065707_10119369
659 Ga0065707_10123227
660 Ga0065707_10288179
661 Ga0065707_10403323
662 Ga0065707_10579115
663 Ga0065707_11055792
664 Ga0070658_10137376
665 Ga0070683_100273208
666 Ga0070683_100900678
667 Ga0070690_100000548
668 Ga0070690_100283405
669 Ga0070670_100004029
670 Ga0070670_100142861
671 Ga0070670_100240041
672 Ga0068869_100049676
673 Ga0068869_100400536
674 Ga0070666_10000883
675 Ga0070666_10017454
676 Ga0070666_10343707
677 Ga0070680_100137045
678 Ga0070680_100265982
679 Ga0070680_100756666
680 Ga0070680_101086164
681 Ga0070680_101260747
682 Ga0070682_101071729
683 Ga0068868_100005118
684 Ga0068868_100056434
685 Ga0068868_100761649
686 Ga0070689_100000405
687 Ga0070689_100043023
688 Ga0070689_100422675
689 Ga0070689_100497693
690 Ga0070691_10224118
691 Ga0070687_100040463
692 Ga0070661_100935293
693 Ga0070692_10098037
694 Ga0070668_100031553
695 Ga0070668_100037892
696 Ga0070668_100044744
697 Ga0070668_100243158
698 Ga0070669_100002319
699 Ga0070669_100004210
700 Ga0070669_100786420
701 Ga0070669_101011033
702 Ga0070675_100073498
703 Ga0070675_100317704
704 Ga0070675_100345029
705 Ga0070675_101709465
706 Ga0070671_100001832
707 Ga0070671_100002800
708 Ga0070671_100049239
709 Ga0070671_101503184
710 Ga0070674_100232627
711 Ga0070674_100536328
712 Ga0070673_100001966
713 Ga0070673_100039201
714 Ga0070673_101680306
715 Ga0070688_100000601
716 Ga0070688_100026369
717 Ga0070659_100277047
718 Ga0070667_100001825
719 Ga0070667_100106296
720 Ga0070667_100109433
721 Ga0070667_100180623
722 Ga0070667_100187574
723 Ga0070667_100225943
724 Ga0070667_100554676
725 Ga0070703_10067698
726 Ga0070709_10090958
727 Ga0070709_10904495
728 Ga0070713_100004644
729 Ga0070713_100006863
730 Ga0070710_10019617
731 Ga0070711_100013008
732 Ga0070705_100065158
733 Ga0070700_100002123
734 Ga0070700_100545437
735 Ga0070700_100703470
736 Ga0070694_100006817
737 Ga0070678_100002121
738 Ga0070678_100006881
739 Ga0070678_100219209
740 Ga0070678_100874458
741 Ga0070678_100878184
742 Ga0070662_100674523
743 Ga0070681_11059158
744 Ga0068867_100002614
745 Ga0068867_101290466
746 Ga0070685_10009344
747 Ga0070685_10138893
748 Ga0070706_100549754
749 Ga0070707_100492015
750 Ga0070707_101572563
751 Ga0070699_100000901
752 Ga0070699_100027688
753 Ga0070699_100079576
754 Ga0070699_100175626
755 Ga0070699_102172835
756 Ga0070679_100145154
757 Ga0070679_101039358
758 Ga0070684_100210843
759 Ga0070684_100281187
760 Ga0070684_100660459
761 Ga0070684_101342799
762 Ga0070697_100105470
763 Ga0070697_100307710
764 Ga0068853_100812683
765 Ga0068853_100925828
766 Ga0070672_100058191
767 Ga0070672_100189024
768 Ga0070672_100466043
769 Ga0070672_100554027
770 Ga0070686_100038237
771 Ga0070695_100055355
772 Ga0070695_100062952
773 Ga0070696_100005257
774 Ga0070696_100216798
775 Ga0070696_100353448
776 Ga0070696_100490727
777 Ga0070693_100703332
778 Ga0070665_100006938
779 Ga0070665_100016409
780 Ga0070665_100501032
781 Ga0070665_100568730
782 Ga0070704_100145265
783 Ga0068855_100039677
784 Ga0068855_100076769
785 Ga0068855_100677094
786 Ga0070664_100196023
787 Ga0070664_100628120
788 Ga0070664_100637404
789 Ga0068857_100090730
790 Ga0068857_100373365
791 Ga0068854_100671582
792 Ga0068854_100677760
793 Ga0068856_100047830
794 Ga0068856_100057627
795 Ga0068856_100584819
796 Ga0070702_100001986
797 Ga0068852_100156343
798 Ga0068859_100008846
799 Ga0068859_100014970
800 Ga0068859_100070574
801 Ga0068859_100120491
802 Ga0068864_100005808
803 Ga0068864_100016829
804 Ga0068866_10402983
805 Ga0068866_10465369
806 Ga0068861_100004297
807 Ga0068851_10080837
808 Ga0068870_10024010
809 Ga0068870_10110299
810 Ga0068863_100002751
811 Ga0068863_100038988
812 Ga0068863_100042062
813 Ga0068863_100438539
814 Ga0068858_100004388
815 Ga0068858_100047188
816 Ga0068858_100195040
817 Ga0068858_100416233
818 Ga0068860_100013263
819 Ga0068860_100308427
820 Ga0068862_100004600
821 Ga0068862_100186782
822 Ga0068862_100441730
823 Ga0068862_101029044
824 Ga0070715_10698378
825 Ga0075366_10830197
826 Ga0097621_100424750
827 Ga0068871_100008514
828 Ga0068871_100013772
829 Ga0068871_100213142
830 Ga0068871_100347219
831 Ga0068871_100685930
832 Ga0075428_100031707
833 Ga0075428_100121386
834 Ga0075428_101953844
835 Ga0075430_100008489
836 Ga0075430_100181649
837 Ga0075431_100286972
838 Ga0075433_10034996
839 Ga0075434_100218848
840 Ga0075434_100735048
841 Ga0075434_102459497
842 Ga0075429_100032387
843 Ga0068865_100001819
844 Ga0068865_100662513
845 Ga0068865_100919829
846 Ga0097620_100008846
847 Ga0097620_100014970
848 Ga0097620_100070572
849 Ga0097620_100120493
850 Ga0075435_100468131
851 Ga0099795_10056299
852 Ga0105240_10000499
853 Ga0105240_10809658
854 Ga0111539_10050307
855 Ga0111539_10202003
856 Ga0111539_10325676
857 Ga0105245_10012238
858 Ga0105245_10825041
859 Ga0114129_10274400
860 Ga0114129_10949113
861 Ga0105243_10002935
862 Ga0105243_11345329
863 Ga0105241_10056325
864 Ga0105242_10334651
865 Ga0105242_10398439
866 Ga0105242_10537957
867 Ga0105242_11617178
868 Ga0105248_10004875
869 Ga0105248_10008797
870 Ga0105248_10069220
871 Ga0105248_10336496
872 Ga0105248_10420221
873 Ga0105237_10627944
874 Ga0105238_10522801
875 Ga0105238_10987321
876 Ga0105249_10028823
877 Ga0105249_10174290
878 Ga0105249_10233617
879 Ga0105249_10249023
880 Ga0105249_10408285
881 Ga0105249_10682030
882 Ga0105239_10011786
883 Ga0105246_10403090
884 Ga0105246_11339374
885 Ga0157329_1020153
886 Ga0157373_10030257
887 Ga0157370_10018251
888 Ga0157370_10801023
889 Ga0157374_10073113
890 Ga0157374_10080152
891 Ga0157374_10804754
892 Ga0157378_10070927
893 Ga0157378_10441500
894 Ga0163162_10112137
895 Ga0163162_10301740
896 Ga0163162_10365283
897 Ga0163162_10982265
898 Ga0157372_10222397
899 Ga0157372_11297260
900 Ga0157375_10004158
901 Ga0157375_10004909
902 Ga0157375_10080009
903 Ga0157375_10535620
904 Ga0157375_10982942
905 Ga0157375_11679679
906 Ga0163163_10025759
907 Ga0163163_10052947
908 Ga0157380_10024201
909 Ga0157380_10167170
910 Ga0157380_11091018
911 Ga0157377_10014026
912 Ga0157379_10003561
913 Ga0157379_10010072
914 Ga0157379_10024131
915 Ga0157379_10353695
916 Ga0157376_10000317
917 Ga0157376_10003390
918 Ga0157376_10435568
919 Ga0157376_10709744
920 Ga0157376_10973274
921 Ga0183362_10004
922 Ga0163161_10171457
923 Ga0207697_10135388
924 Ga0207653_10060440
925 Ga0207682_10126702
926 Ga0207642_10817753
927 Ga0207688_10024946
928 Ga0207680_10000417
929 Ga0207680_10058027
930 Ga0207680_10316841
931 Ga0207685_10016883
932 Ga0207699_10490061
933 Ga0207645_10160060
934 Ga0207645_10407340
935 Ga0207643_10014208
936 Ga0207643_10090839
937 Ga0207705_10004312
938 Ga0207684_10011665
939 Ga0207684_10432582
940 Ga0207654_10206096
941 Ga0207707_10014058
942 Ga0207707_10033841
943 Ga0207695_10837972
944 Ga0207663_10013794
945 Ga0207660_10001655
946 Ga0207660_10067664
947 Ga0207662_10011197
948 Ga0207662_10071369
949 Ga0207657_10581206
950 Ga0207649_10758903
951 Ga0207652_10011529
952 Ga0207652_10018960
953 Ga0207652_10462693
954 Ga0207646_10163354
955 Ga0207681_10001355
956 Ga0207650_10028132
957 Ga0207650_10533564
958 Ga0207650_10639115
959 Ga0207650_10831269
960 Ga0207659_10046817
961 Ga0207659_10639880
962 Ga0207687_10000151
963 Ga0207687_10006424
964 Ga0207687_11283195
965 Ga0207700_10042370
966 Ga0207644_10002837
967 Ga0207644_10003559
968 Ga0207644_10891375
969 Ga0207644_11001448
970 Ga0207686_10142831
971 Ga0207686_10254827
972 Ga0207686_10329457
973 Ga0207709_10032314
974 Ga0207709_10462843
975 Ga0207670_10015295
976 Ga0207670_10086338
977 Ga0207669_10180016
978 Ga0207669_10182937
979 Ga0207669_10338707
980 Ga0207704_10006461
981 Ga0207704_11394850
982 Ga0207665_10455236
983 Ga0207691_10014726
984 Ga0207691_10038709
985 Ga0207691_10123918
986 Ga0207691_10316040
987 Ga0207691_10781100
988 Ga0207711_10000206
989 Ga0207711_10120519
990 Ga0207711_10130430
991 Ga0207711_10163132
992 Ga0207711_11294790
993 Ga0207689_10227344
994 Ga0207661_10725203
995 Ga0207661_11026685
996 Ga0207679_10190920
997 Ga0207667_10145977
998 Ga0207667_10213334
999 Ga0207651_10018251
1000 Ga0207651_10284690
1001 Ga0207651_10291840
1002 Ga0207651_10878266
1003 Ga0207712_10005328
1004 Ga0207712_10408130
1005 Ga0207712_10408984
1006 Ga0207712_10543079
1007 Ga0207668_10046547
1008 Ga0207668_10065580
1009 Ga0207668_10073947
1010 Ga0207668_10120996
1011 Ga0207640_10003083
1012 Ga0207640_11085826
1013 Ga0207658_10036512
1014 Ga0207658_10091796
1015 Ga0207658_10814942
1016 Ga0207677_10000980
1017 Ga0207677_10028870
1018 Ga0207677_10301144
1019 Ga0207703_10001548
1020 Ga0207703_10258821
1021 Ga0207703_10333110
1022 Ga0207678_10422296
1023 Ga0207678_10461318
1024 Ga0207708_10001370
1025 Ga0207708_10394217
1026 Ga0207702_10094635
1027 Ga0207702_10150747
1028 Ga0207641_10019444
1029 Ga0207641_10072772
1030 Ga0207641_10073290
1031 Ga0207641_10288538
1032 Ga0207648_10006874
1033 Ga0207648_10227779
1034 Ga0207676_10000384
1035 Ga0207676_10077221
1036 Ga0207676_11937906
1037 Ga0207674_10209358
1038 Ga0207674_11291100
1039 Ga0207675_100002718
1040 Ga0207675_101962090
1041 Ga0207675_102615151
1042 Ga0207683_10008204
1043 Ga0207683_10012187
1044 Ga0207683_10234461
1045 Ga0207683_10416482
1046 Ga0207683_10531493
1047 Ga0207698_10534090
1048 Ga0207428_10405035
1049 Ga0268266_10007645
1050 Ga0268266_10500681
1051 Ga0268266_11551942
1052 Ga0268265_10010433
1053 Ga0268265_10208727
1054 Ga0268265_11033895
1055 Ga0268265_11146108
1056 Ga0268264_10000781
1057 Ga0307517_10350015
1058 Ga0307515_10137180
1059 Ga0265332_10048422
1060 Ga0265320_10005819
1061 Ga0265320_10175128
1062 Ga0307513_10007080
1063 Ga0307408_100279703
1064 Ga0307514_10475080
1065 Ga0265314_10029639
1066 Ga0307410_10973135
1067 Ga0307409_100497501
1068 Ga0307416_100910473
1069 Ga0373934_0005200
1070 Ga0373934_0013629
1071 Ga0373949_0178314
1072 Ga0373923_0233889
1073 Ga0373939_0088312
1074 Ga0373953_0050378
1075 Ga0373953_0086124
1076 Ga0373956_0197588
1077 Ga0373957_0112979
1078 Ga0373946_0012328
1079 Ga0373955_0027056
1080 Ga0373955_0188974
1081 Ga0373942_0115426
1082 Ga0373931_0062241
1083 Ga0373931_0385400
1084 Ga0373935_0003548
1085 Ga0373935_0236042
1086 Ga0373927_0006648
1087 Ga0373927_0038656
1088 Ga0373927_0118094
1089 Ga0373933_0005053
1090 Ga0373947_0156229
1091 Ga0373937_0009778
1092 Ga0373937_0123295
1093 Ga0373937_0329534
1094 Ga0373925_0003856
1095 Ga0373925_0022247
1096 Ga0373925_0503905
1097 Ga0395899_0562629
1098 Ga0395901_0387883
1099 Ga0242420_060515
1100 Ga0451791_0187571
1101 Ga0451791_0942218
1102 Ga0451800_1380414
1103 Ga0451807_1991881
1104 Ga0451853_2245260
1105 Ga0439441_056445
1106 Ga0439441_112218
1107 Ga0439443_050920
1108 Ga0453683_0892248
1109 Ga0453684_0007059
1110 Ga0453684_1668264
1111 Ga0466970_0465706
1112 Ga0495592_0091051
1113 Ga0495592_0150443
1114 Ga0495603_0256064
1115 Ga0495603_0863244
1116 Ga0495591_000325
1117 Ga0495629_0002254
1118 Ga0495629_0081441
1119 Ga0495638_0009305
1120 Ga0495641_0054929
1121 Ga0495651_0063790
1122 Ga0495651_0070303
1123 Ga0495651_0130169
1124 Ga0495653_0015640
1125 Ga0495653_0037885
1126 Ga0495653_0040304
1127 Ga0495653_0043656
1128 Ga0495650_0022338
1129 Ga0495580_0018921
1130 Ga0495580_0022825
1131 Ga0495580_0037073
1132 Ga0495580_0086490
1133 Ga0495580_0464210
1134 Ga0495582_0129508
1135 Ga0495582_0143722
1136 Ga0495582_0319930
1137 Ga0495582_0473224
1138 Ga0495605_0004706
1139 Ga0495639_0723462
1140 Ga0495662_0034672
1141 Ga0495664_0041483
1142 Ga0495664_0204527
1143 Ga0495594_0135742
1144 Ga0495594_0766486
1145 Ga0495596_0002393
1146 Ga0495607_0044125
1147 Ga0495608_0035203
1148 Ga0495618_0001764
1149 Ga0495618_0528825
1150 Ga0495618_0670127
1151 Ga0495628_0003529
1152 Ga0495628_0006858
1153 Ga0495628_0176201
1154 Ga0495628_0192976
1155 Ga0495628_0205250
1156 Ga0495628_1014927
1157 Ga0495630_0012072
1158 Ga0495631_0044241
1159 Ga0495644_0208355
1160 Ga0495644_0389549
1161 Ga0495648_0004224
1162 Ga0495663_0371554
1163 Ga0495666_0005640
1164 Ga0495666_0070739
1165 Ga0495642_0231004
1166 Ga0495652_0046466
1167 Ga0495652_0058228
1168 Ga0495665_0000428
1169 Ga0495640_0014148
1170 Ga0495586_0290758
1171 Ga0495586_0448840
1172 Ga0495587_0008908
1173 Ga0495587_0009056
1174 Ga0495621_0012847
1175 Ga0495597_0125528
1176 Ga0495645_0000477
1177 Ga0495645_0086930
1178 Ga0495645_0117878
1179 Ga0495622_0000029
1180 Ga0495622_0286273
1181 Ga0495667_0002140
1182 Ga0495667_0195245
1183 Ga0495667_0204167
1184 Ga0495656_0000047
1185 Ga0495634_0016785
1186 Ga0495634_0085263
1187 Ga0495635_0002492
1188 Ga0495635_0030552
1189 Ga0495635_0195720
1190 Ga0495635_0302716
1191 Ga0495659_0122357
1192 Ga0495661_0009932
1193 Ga0495588_0179618
1194 Ga0495657_0041917
1195 Ga0495657_0204222
1196 Ga0495599_0000818
1197 Ga0495599_0003940
1198 Ga0495599_0015138
1199 Ga0495623_0005647
1200 Ga0495623_0126769
1201 Ga0495623_0228703
1202 Ga0495646_0001254
1203 Ga0495646_0240774
1204 Ga0495647_0078360
1205 Ga0495647_0360710
1206 Ga0495647_0532901
1207 Ga0495658_0022702
1208 Ga0495658_0114265
1209 Ga0495669_0011723
1210 Ga0495669_0571331
1211 Ga0495613_0005215
1212 Ga0495624_0015328
1213 Ga0495624_0069277
1214 Ga0495624_0345641
1215 Ga0495670_0686178
1216 Ga0495589_0008336
1217 Ga0495589_0031769
1218 Ga0495600_0001481
1219 Ga0495600_0044549
1220 Ga0495600_0077454
1221 Ga0495600_0089061
1222 Ga0495660_0038664
1223 Ga0495581_0009248
1224 Ga0495581_0012141
1225 Ga0495581_0300779
1226 Ga0495604_0100044
1227 Ga0495674_0050275
1228 Ga0495674_0270488
1229 Ga0495676_0015142
1230 Ga0495680_0065373
1231 Ga0495680_0085132
1232 Ga0495683_0003029
1233 Ga0495683_0096759
1234 Ga0495687_083257
1235 Ga0495675_0000980
1236 Ga0495679_000078
1237 Ga0495673_0003323
1238 Ga0495684_0057010
1239 Ga0495684_0337966
1240 Ga0495593_0006054
1241 Ga0495602_0062316
1242 Ga0495602_0972412
1243 Ga0495614_0000980
1244 Ga0495614_0026740
1245 Ga0495614_0263367
1246 Ga0496100_0010475
1247 Ga0496100_0106371
1248 Ga0496100_0148363
1249 Ga0496101_0843553
1250 Ga0496102_0678539
1251 Ga0496103_0238749
1252 Ga0496103_0530178
1253 Ga0496104_0033967
1254 Ga0496104_0105225
1255 Ga0496105_0019878
1256 Ga0496105_0076926
1257 Ga0496106_0045928
1258 Ga0496108_0117753
1259 Ga0496109_0703998
1260 Ga0496110_0018180
1261 Ga0496111_0044620
1262 Ga0496112_0273460
1263 Ga0496112_1019780
1264 Ga0496113_0612885
1265 Ga0496114_0007429
1266 Ga0496115_0624382
1267 Ga0495682_0003827
1268 Ga0501071_0844492
1269 Ga0501076_0176855
1270 Ga0501217_229928
1271 Ga0501079_0116608
1272 Ga0501044_1605041
1273 Ga0501045_1371665
1274 nmdc:mga05p37_191180_c1
1275 nmdc:mga05p37_846925_c1
1276 nmdc:mga09592_203655_c1
1277 nmdc:mga0qj67_14031_c1
1278 nmdc:mga0qj67_146883_c1
1279 nmdc:mga0qj67_36746_c1
1280 nmdc:mga06r32_18546_c1
1281 nmdc:mga06r32_211945_c1
1282 nmdc:mga06r32_376062_c1
1283 nmdc:mga06r32_41807_c1
1284 nmdc:mga06r32_833860_c1
1285 nmdc:mga08y16_1203761_c1
1286 nmdc:mga08y16_183042_c1
1287 nmdc:mga08y16_253785_c1
1288 nmdc:mga08y16_986009_c1
1289 nmdc:mga0n895_176185_c1
1290 nmdc:mga0n895_210512_c1
1291 nmdc:mga0n895_2114773_c1
1292 nmdc:mga0rr50_267824_c1
1293 nmdc:mga0rr50_649129_c1
1294 nmdc:mga08x19_120_c1
1295 nmdc:mga0a205_12922_c1
1296 Ga0495601_0012041
1297 Ga0495601_0018499
1298 Ga0495601_0066356
1299 Ga0495601_0262831
1300 Ga0495655_0345575
1301 Ga0495619_0111350
1302 Ga0500595_007641
1303 Ga0500619_002984
1304 Ga0501084_1206071
1305 Ga0501082_0330618
1306 8055269226

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

49

144

0.98

PF18899

DUF5655

Domain of unknown function (DUF5655)

50

147

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7243 15 131
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6927 9 119
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6652 15 131
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6477 9 119
5v8w-assembly3.cif.gz_F crystal structure of human integrator ints9-ints11 ctd complex 0.6254 27 70
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7659 14 126 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7358 14 126 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7099 15 129 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6837 15 129 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6797 32 136 3.90.1150.30
ID Description Score Start End GO Terms
AF-I4W4N0-F1-model_v4 YdhG-like domain-containing protein 0.9957 12 136
AF-A0A4Q4BJ29-F1-model_v4 DUF1801 domain-containing protein 0.9939 7 75
AF-A0A349L252-F1-model_v4 YdhG-like domain-containing protein 0.9934 12 136
AF-A0A1Q3J442-F1-model_v4 deleted 0.9932 11 137
AF-A0A1E4DJ85-F1-model_v4 deleted 0.9929 9 136

Map