F472739

General Info

Members Datasets Scaffolds Average Seq Length
653 322 1306 124

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_102069738|Ga0068868_1020697381
Length 127
Sequence MAVSGGTHYNWEELPLEELNPMIGRRLVTGERMMIAHVYLQAGAIVPRHEHDNEQLTYILEGTLRLWLGPDEDEEMFDIRAGEVLHIPPNVPHRAEALENTLDVDVFSPPRSDWLDGSDAYLREQPS

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
179 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
180 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
185 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
192 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
210 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
216 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
219 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
220 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
239 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
257 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
258 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
259 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
260 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
261 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
262 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
263 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
266 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
267 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
268 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
269 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
270 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
271 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
272 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
273 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
274 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
275 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
276 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
277 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
278 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
279 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
280 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
281 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
282 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
283 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
284 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
285 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
286 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
287 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
288 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
289 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
290 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
291 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
292 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
293 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
297 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
298 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
299 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
300 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
301 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
302 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
303 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
304 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
305 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
306 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
307 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
319 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
320 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.61
Nodule 0
Rhizoplane 4.75
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 26.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_102069738 3300005338 Unclassified 541
2 CNAas_1000200 3300000532 Bacteria 5549
3 rootH1_10248251 3300003323 Bacteria 1890
4 Ga0007409J51694_1093102 3300003575 Bacteria 736
5 Ga0058862_11133370 3300004803 Unclassified 533
6 Ga0065715_10402407 3300005293 Unclassified 880
7 Ga0065715_10442517 3300005293 Bacteria 834
8 Ga0065715_10578070 3300005293 Unclassified 722
9 Ga0070676_10788017 3300005328 Unclassified 700
10 Ga0070676_11208807 3300005328 Unclassified 575
11 Ga0070683_100000337 3300005329 Bacteria 32237
12 Ga0070683_100010827 3300005329 Bacteria 7850
13 Ga0070683_100620504 3300005329 Unclassified 1035
14 Ga0070690_100032116 3300005330 Unclassified 3276
15 Ga0070690_100076729 3300005330 Bacteria 2181
16 Ga0070690_100897545 3300005330 Bacteria 693
17 Ga0070670_100022051 3300005331 Bacteria 5481
18 Ga0070677_10279587 3300005333 Bacteria 840
19 Ga0068869_100017104 3300005334 Bacteria 4907
20 Ga0068869_100049055 3300005334 Bacteria 3055
21 Ga0068869_100504152 3300005334 Bacteria 1011
22 Ga0070666_10059274 3300005335 Bacteria 2589
23 Ga0070666_10577710 3300005335 Unclassified 819
24 Ga0070680_100007829 3300005336 Bacteria 8145
25 Ga0070680_100030728 3300005336 Bacteria 4315
26 Ga0070680_100087486 3300005336 Bacteria 2577
27 Ga0070680_100099085 3300005336 Bacteria 2418
28 Ga0070680_100114150 3300005336 Unclassified 2250
29 Ga0070682_100009500 3300005337 Bacteria 5502
30 Ga0068868_100073929 3300005338 Bacteria 2722
31 Ga0068868_100424091 3300005338 Bacteria 1152
32 Ga0068868_100691065 3300005338 Unclassified 912
33 Ga0070660_100122475 3300005339 Bacteria 2076
34 Ga0070689_100017378 3300005340 Bacteria 5281
35 Ga0070689_100132605 3300005340 Unclassified 1998
36 Ga0070689_100568345 3300005340 Bacteria 979
37 Ga0070691_10144166 3300005341 Unclassified 1216
38 Ga0070691_10268402 3300005341 Bacteria 921
39 Ga0070691_10757294 3300005341 Bacteria 588
40 Ga0070687_100042195 3300005343 Bacteria 2310
41 Ga0070687_100069986 3300005343 Unclassified 1880
42 Ga0070687_100235531 3300005343 Unclassified 1129
43 Ga0070687_100251871 3300005343 Unclassified 1098
44 Ga0070687_100323436 3300005343 Bacteria 986
45 Ga0070661_100001846 3300005344 Bacteria 14670
46 Ga0070692_10007266 3300005345 Bacteria 4871
47 Ga0070692_10058801 3300005345 Bacteria 2019
48 Ga0070692_10076555 3300005345 Bacteria 1793
49 Ga0070692_10099959 3300005345 Unclassified 1589
50 Ga0070668_100117765 3300005347 Bacteria 2120
51 Ga0070668_100739423 3300005347 Bacteria 870
52 Ga0070669_100232784 3300005353 Bacteria 1461
53 Ga0070669_101082470 3300005353 Unclassified 690
54 Ga0070675_100002325 3300005354 Bacteria 14135
55 Ga0070675_100855852 3300005354 Bacteria 832
56 Ga0070671_100222830 3300005355 Bacteria 1600
57 Ga0070671_100223159 3300005355 Bacteria 1599
58 Ga0070674_100241920 3300005356 Bacteria 1413
59 Ga0070674_100636784 3300005356 Bacteria 905
60 Ga0070673_100107166 3300005364 Bacteria 2311
61 Ga0070673_100177669 3300005364 Bacteria 1821
62 Ga0070673_102182584 3300005364 Unclassified 526
63 Ga0070688_100374151 3300005365 Bacteria 1048
64 Ga0070659_100003444 3300005366 Bacteria 11269
65 Ga0070659_101116519 3300005366 Bacteria 695
66 Ga0070667_100259159 3300005367 Bacteria 1556
67 Ga0070667_100349060 3300005367 Bacteria 1339
68 Ga0070667_101010147 3300005367 Bacteria 776
69 Ga0070703_10002281 3300005406 Bacteria 5553
70 Ga0070709_10134749 3300005434 Bacteria 1690
71 Ga0070709_10623124 3300005434 Bacteria 833
72 Ga0070714_101877676 3300005435 Bacteria 585
73 Ga0070713_102298013 3300005436 Unclassified 522
74 Ga0070701_10096821 3300005438 Bacteria 1627
75 Ga0070701_10347813 3300005438 Bacteria 925
76 Ga0070701_11297913 3300005438 Bacteria 520
77 Ga0070705_100011609 3300005440 Unclassified 4451
78 Ga0070705_100110081 3300005440 Bacteria 1758
79 Ga0070700_100052812 3300005441 Unclassified 2535
80 Ga0070700_100060785 3300005441 Bacteria 2382
81 Ga0070700_100068534 3300005441 Bacteria 2256
82 Ga0070700_100086664 3300005441 Unclassified 2034
83 Ga0070694_100045480 3300005444 Bacteria 2942
84 Ga0070694_100085064 3300005444 Bacteria 2207
85 Ga0070694_100131441 3300005444 Bacteria 1809
86 Ga0070694_100345691 3300005444 Unclassified 1151
87 Ga0070694_100548123 3300005444 Unclassified 926
88 Ga0070694_101219569 3300005444 Bacteria 631
89 Ga0070708_100012542 3300005445 Bacteria 6918
90 Ga0070708_102191997 3300005445 Unclassified 510
91 Ga0070663_100092903 3300005455 Bacteria 2238
92 Ga0070663_100119508 3300005455 Bacteria 1989
93 Ga0070663_101296566 3300005455 Unclassified 642
94 Ga0070678_100214202 3300005456 Bacteria 1598
95 Ga0070678_101973132 3300005456 Unclassified 552
96 Ga0070662_100000810 3300005457 Bacteria 19256
97 Ga0070662_100067318 3300005457 Bacteria 2630
98 Ga0070662_100650755 3300005457 Unclassified 889
99 Ga0070681_10000041 3300005458 Bacteria 89178
100 Ga0070681_10006635 3300005458 Bacteria 11272
101 Ga0070681_10010527 3300005458 Bacteria 9132
102 Ga0070681_10346049 3300005458 Bacteria 1397
103 Ga0070681_10399478 3300005458 Bacteria 1286
104 Ga0068867_100064177 3300005459 Bacteria 2730
105 Ga0068867_100517846 3300005459 Bacteria 1028
106 Ga0068867_101373385 3300005459 Unclassified 654
107 Ga0070685_10399434 3300005466 Unclassified 952
108 Ga0070706_100031914 3300005467 Bacteria 4857
109 Ga0070706_101034996 3300005467 Unclassified 757
110 Ga0070698_100015037 3300005471 Bacteria 8181
111 Ga0070698_100024210 3300005471 Bacteria 6334
112 Ga0070699_100051609 3300005518 Bacteria 3561
113 Ga0070699_100312071 3300005518 Bacteria 1412
114 Ga0070699_101440192 3300005518 Bacteria 632
115 Ga0070679_100000074 3300005530 Bacteria 74890
116 Ga0070679_100016462 3300005530 Bacteria 7133
117 Ga0070679_100029822 3300005530 Bacteria 5383
118 Ga0070679_100299768 3300005530 Bacteria 1558
119 Ga0070679_100419024 3300005530 Bacteria 1284
120 Ga0070679_101997995 3300005530 Unclassified 529
121 Ga0070684_100007105 3300005535 Bacteria 8702
122 Ga0070684_100068647 3300005535 Bacteria 3116
123 Ga0070684_100106499 3300005535 Unclassified 2510
124 Ga0070684_100113620 3300005535 Unclassified 2430
125 Ga0070684_100125249 3300005535 Unclassified 2314
126 Ga0070697_100034174 3300005536 Bacteria 4098
127 Ga0070697_100076798 3300005536 Bacteria 2747
128 Ga0068853_100100256 3300005539 Bacteria 2560
129 Ga0070672_100099155 3300005543 Unclassified 2361
130 Ga0070672_100216047 3300005543 Bacteria 1607
131 Ga0070686_100105947 3300005544 Bacteria 1907
132 Ga0070686_100205865 3300005544 Bacteria 1413
133 Ga0070695_100037891 3300005545 Bacteria 3040
134 Ga0070695_100137523 3300005545 Bacteria 1690
135 Ga0070695_100277715 3300005545 Bacteria 1230
136 Ga0070695_100967264 3300005545 Unclassified 691
137 Ga0070695_101285703 3300005545 Unclassified 604
138 Ga0070696_100000539 3300005546 Bacteria 24051
139 Ga0070696_100027770 3300005546 Unclassified 3859
140 Ga0070696_101138216 3300005546 Unclassified 657
141 Ga0070696_101232465 3300005546 Unclassified 633
142 Ga0070696_101740556 3300005546 Unclassified 538
143 Ga0070693_100001583 3300005547 Bacteria 10249
144 Ga0070693_100002438 3300005547 Bacteria 8566
145 Ga0070665_100000513 3300005548 Bacteria 55553
146 Ga0070704_100043491 3300005549 Bacteria 3114
147 Ga0070704_101026246 3300005549 Unclassified 747
148 Ga0070704_101098975 3300005549 Bacteria 722
149 Ga0070704_101108067 3300005549 Unclassified 719
150 Ga0068855_100048518 3300005563 Bacteria 5011
151 Ga0068855_100085564 3300005563 Bacteria 3647
152 Ga0068855_100554083 3300005563 Bacteria 1244
153 Ga0068855_100838021 3300005563 Bacteria 975
154 Ga0068855_101311247 3300005563 Bacteria 749
155 Ga0068855_101539541 3300005563 Bacteria 682
156 Ga0070664_100238488 3300005564 Bacteria 1632
157 Ga0070664_100246646 3300005564 Bacteria 1604
158 Ga0070664_102195286 3300005564 Bacteria 524
159 Ga0068857_100008276 3300005577 Bacteria 8987
160 Ga0068857_100161450 3300005577 Bacteria 2033
161 Ga0068857_100559722 3300005577 Unclassified 1078
162 Ga0068857_101795130 3300005577 Bacteria 600
163 Ga0068854_100110935 3300005578 Unclassified 2069
164 Ga0068854_100262059 3300005578 Unclassified 1384
165 Ga0068854_100486508 3300005578 Bacteria 1037
166 Ga0068854_100741848 3300005578 Unclassified 851
167 Ga0068856_100003537 3300005614 Bacteria 15749
168 Ga0068856_100015191 3300005614 Bacteria 7438
169 Ga0068856_101562649 3300005614 Bacteria 673
170 Ga0068856_101821346 3300005614 Bacteria 620
171 Ga0070702_100009011 3300005615 Bacteria 4863
172 Ga0070702_100092407 3300005615 Bacteria 1838
173 Ga0070702_101291619 3300005615 Bacteria 592
174 Ga0068852_100049470 3300005616 Bacteria 3597
175 Ga0068852_100099610 3300005616 Bacteria 2620
176 Ga0068852_100105124 3300005616 Bacteria 2557
177 Ga0068852_100289557 3300005616 Unclassified 1582
178 Ga0068859_100000002 3300005617 Bacteria 541370
179 Ga0068859_100004552 3300005617 Bacteria 14139
180 Ga0068859_100009080 3300005617 Bacteria 10042
181 Ga0068859_100212557 3300005617 Bacteria 2021
182 Ga0068859_100708843 3300005617 Bacteria 1097
183 Ga0068864_100110007 3300005618 Bacteria 2453
184 Ga0068864_101205754 3300005618 Unclassified 755
185 Ga0068866_10376556 3300005718 Unclassified 909
186 Ga0068861_100551119 3300005719 Bacteria 1051
187 Ga0068861_101129077 3300005719 Bacteria 755
188 Ga0068861_101406819 3300005719 Unclassified 681
189 Ga0068851_10012223 3300005834 Unclassified 4042
190 Ga0068870_10072913 3300005840 Bacteria 1877
191 Ga0068863_100053308 3300005841 Bacteria 3833
192 Ga0068863_100334039 3300005841 Unclassified 1473
193 Ga0068863_101066564 3300005841 Bacteria 812
194 Ga0068858_100234845 3300005842 Bacteria 1739
195 Ga0068858_100406694 3300005842 Unclassified 1308
196 Ga0068858_100805388 3300005842 Bacteria 917
197 Ga0068858_101033254 3300005842 Bacteria 806
198 Ga0068860_100068012 3300005843 Bacteria 3384
199 Ga0068860_100182895 3300005843 Bacteria 2026
200 Ga0068862_100051776 3300005844 Bacteria 3512
201 Ga0068862_100057260 3300005844 Bacteria 3342
202 Ga0068862_100673004 3300005844 Bacteria 1000
203 Ga0070716_100917375 3300006173 Bacteria 687
204 Ga0070712_100015507 3300006175 Bacteria 4912
205 Ga0070712_100518633 3300006175 Bacteria 1001
206 Ga0097621_100056203 3300006237 Bacteria 3215
207 Ga0097621_100287593 3300006237 Bacteria 1448
208 Ga0097621_101159986 3300006237 Unclassified 727
209 Ga0097621_102033215 3300006237 Bacteria 549
210 Ga0068871_100010847 3300006358 Bacteria 6670
211 Ga0068871_100030165 3300006358 Bacteria 4268
212 Ga0075428_100094277 3300006844 Bacteria 3264
213 Ga0075428_100564179 3300006844 Bacteria 1217
214 Ga0075428_101038494 3300006844 Bacteria 867
215 Ga0075430_100007032 3300006846 Bacteria 9487
216 Ga0075430_100055805 3300006846 Bacteria 3322
217 Ga0075431_100353227 3300006847 Bacteria 1477
218 Ga0075433_10210554 3300006852 Bacteria 1727
219 Ga0075434_100195473 3300006871 Bacteria 2043
220 Ga0075434_100439814 3300006871 Unclassified 1325
221 Ga0075429_100016995 3300006880 Bacteria 6290
222 Ga0075429_100142989 3300006880 Bacteria 2094
223 Ga0075429_100349601 3300006880 Bacteria 1294
224 Ga0068865_100231313 3300006881 Bacteria 1450
225 Ga0097620_100000002 3300006931 Bacteria 541370
226 Ga0097620_100004552 3300006931 Bacteria 14139
227 Ga0097620_100009080 3300006931 Bacteria 10042
228 Ga0097620_100212551 3300006931 Bacteria 2021
229 Ga0097620_100708929 3300006931 Bacteria 1097
230 Ga0105240_10012385 3300009093 Bacteria 11778
231 Ga0105240_10042919 3300009093 Bacteria 5760
232 Ga0105240_10083956 3300009093 Bacteria 3907
233 Ga0105240_10119368 3300009093 Unclassified 3176
234 Ga0105240_10127845 3300009093 Bacteria 3051
235 Ga0105240_11269466 3300009093 Unclassified 778
236 Ga0105240_12634001 3300009093 Bacteria 519
237 Ga0111539_10005689 3300009094 Bacteria 16131
238 Ga0111539_10016357 3300009094 Bacteria 9198
239 Ga0111539_10161987 3300009094 Bacteria 2616
240 Ga0105245_10022771 3300009098 Bacteria 5498
241 Ga0105245_10027042 3300009098 Bacteria 5053
242 Ga0105245_10124676 3300009098 Unclassified 2410
243 Ga0105245_10165088 3300009098 Bacteria 2104
244 Ga0105245_10967966 3300009098 Bacteria 895
245 Ga0114129_10044644 3300009147 Bacteria 6234
246 Ga0114129_10076024 3300009147 Bacteria 4676
247 Ga0114129_10649577 3300009147 Bacteria 1362
248 Ga0114129_11746021 3300009147 Bacteria 758
249 Ga0105243_10064203 3300009148 Bacteria 2945
250 Ga0105243_10170862 3300009148 Bacteria 1882
251 Ga0105241_10070490 3300009174 Bacteria 2712
252 Ga0105241_10098226 3300009174 Bacteria 2323
253 Ga0105241_10240187 3300009174 Bacteria 1531
254 Ga0105241_11841746 3300009174 Unclassified 592
255 Ga0105242_10027983 3300009176 Unclassified 4483
256 Ga0105242_10057948 3300009176 Bacteria 3174
257 Ga0105248_10003597 3300009177 Bacteria 17182
258 Ga0105248_10560703 3300009177 Bacteria 1289
259 Ga0105248_10822237 3300009177 Bacteria 1049
260 Ga0105237_10001367 3300009545 Bacteria 32226
261 Ga0105237_10096648 3300009545 Bacteria 2944
262 Ga0105237_10530559 3300009545 Bacteria 1184
263 Ga0105237_10570737 3300009545 Bacteria 1138
264 Ga0105237_10703261 3300009545 Unclassified 1017
265 Ga0105238_10154079 3300009551 Unclassified 2273
266 Ga0105238_10962959 3300009551 Bacteria 873
267 Ga0105239_10886343 3300010375 Bacteria 1024
268 Ga0105239_12083437 3300010375 Bacteria 659
269 Ga0105246_10005127 3300011119 Bacteria 7963
270 Ga0105246_10042246 3300011119 Unclassified 3087
271 Ga0105246_10775690 3300011119 Unclassified 848
272 Ga0157373_10028865 3300013100 Bacteria 4000
273 Ga0157373_10509153 3300013100 Bacteria 870
274 Ga0157373_10657024 3300013100 Bacteria 766
275 Ga0157373_10999656 3300013100 Bacteria 624
276 Ga0157371_10011028 3300013102 Bacteria 7001
277 Ga0157370_10257666 3300013104 Unclassified 1612
278 Ga0157370_11952731 3300013104 Bacteria 526
279 Ga0157369_10077964 3300013105 Bacteria 3550
280 Ga0157369_10265439 3300013105 Bacteria 1790
281 Ga0157374_10005959 3300013296 Bacteria 10308
282 Ga0157374_10023151 3300013296 Bacteria 5551
283 Ga0157374_10168308 3300013296 Bacteria 2137
284 Ga0157374_10302223 3300013296 Bacteria 1583
285 Ga0157378_10429638 3300013297 Bacteria 1307
286 Ga0157378_10828152 3300013297 Bacteria 953
287 Ga0157378_12067728 3300013297 Bacteria 620
288 Ga0163162_10337119 3300013306 Bacteria 1640
289 Ga0157372_10010450 3300013307 Bacteria 9875
290 Ga0157372_10010550 3300013307 Bacteria 9825
291 Ga0157372_10079844 3300013307 Bacteria 3701
292 Ga0157375_10015456 3300013308 Bacteria 6835
293 Ga0157375_10219691 3300013308 Bacteria 2059
294 Ga0157375_10757366 3300013308 Bacteria 1122
295 Ga0163163_10175027 3300014325 Bacteria 2192
296 Ga0163163_10186437 3300014325 Bacteria 2122
297 Ga0163163_10912800 3300014325 Unclassified 942
298 Ga0157380_10002857 3300014326 Bacteria 11723
299 Ga0157380_10016633 3300014326 Bacteria 5430
300 Ga0157380_10235699 3300014326 Bacteria 1647
301 Ga0157377_10024236 3300014745 Bacteria 3224
302 Ga0157377_10547752 3300014745 Bacteria 817
303 Ga0157377_11662003 3300014745 Unclassified 514
304 Ga0157379_10201507 3300014968 Bacteria 1800
305 Ga0157379_10359881 3300014968 Bacteria 1333
306 Ga0157379_10793764 3300014968 Bacteria 893
307 Ga0157379_11117225 3300014968 Unclassified 755
308 Ga0157376_10024971 3300014969 Bacteria 4701
309 Ga0157376_10045369 3300014969 Bacteria 3618
310 Ga0157376_10110286 3300014969 Unclassified 2421
311 Ga0163161_10062973 3300017792 Unclassified 2702
312 Ga0207656_10031519 3300025321 Bacteria 2197
313 Ga0207653_10003550 3300025885 Bacteria 4909
314 Ga0207653_10118740 3300025885 Bacteria 950
315 Ga0207642_10205588 3300025899 Bacteria 1091
316 Ga0207642_10417156 3300025899 Unclassified 806
317 Ga0207680_10650266 3300025903 Unclassified 755
318 Ga0207699_10216121 3300025906 Bacteria 1306
319 Ga0207645_10575344 3300025907 Unclassified 764
320 Ga0207645_10934555 3300025907 Unclassified 589
321 Ga0207643_10121983 3300025908 Bacteria 1545
322 Ga0207684_10102372 3300025910 Bacteria 2449
323 Ga0207654_10114572 3300025911 Unclassified 1683
324 Ga0207654_10236609 3300025911 Unclassified 1218
325 Ga0207707_10000077 3300025912 Bacteria 100255
326 Ga0207707_10008984 3300025912 Bacteria 8680
327 Ga0207707_10015197 3300025912 Bacteria 6703
328 Ga0207707_10028214 3300025912 Bacteria 4906
329 Ga0207707_10039996 3300025912 Unclassified 4097
330 Ga0207707_10369976 3300025912 Bacteria 1233
331 Ga0207707_10396246 3300025912 Bacteria 1186
332 Ga0207695_10007946 3300025913 Bacteria 13383
333 Ga0207695_10074728 3300025913 Bacteria 3450
334 Ga0207695_10079063 3300025913 Bacteria 3335
335 Ga0207695_10086124 3300025913 Bacteria 3169
336 Ga0207695_10476412 3300025913 Bacteria 1130
337 Ga0207695_10583474 3300025913 Bacteria 999
338 Ga0207671_10011164 3300025914 Bacteria 7335
339 Ga0207671_10055217 3300025914 Bacteria 2943
340 Ga0207671_10424143 3300025914 Bacteria 1058
341 Ga0207693_10559885 3300025915 Bacteria 891
342 Ga0207693_10642828 3300025915 Bacteria 824
343 Ga0207660_10005318 3300025917 Bacteria 8367
344 Ga0207660_10009830 3300025917 Bacteria 6193
345 Ga0207660_10019945 3300025917 Bacteria 4492
346 Ga0207660_10024755 3300025917 Bacteria 4066
347 Ga0207660_10156729 3300025917 Unclassified 1753
348 Ga0207660_10376896 3300025917 Bacteria 1140
349 Ga0207660_10634899 3300025917 Bacteria 870
350 Ga0207662_10027141 3300025918 Bacteria 3305
351 Ga0207662_10040290 3300025918 Bacteria 2745
352 Ga0207662_10059473 3300025918 Bacteria 2290
353 Ga0207662_10313632 3300025918 Bacteria 1045
354 Ga0207649_10171133 3300025920 Unclassified 1513
355 Ga0207652_10000096 3300025921 Bacteria 96047
356 Ga0207652_10000449 3300025921 Bacteria 42477
357 Ga0207652_10013788 3300025921 Bacteria 6537
358 Ga0207652_10113226 3300025921 Bacteria 2408
359 Ga0207652_10723440 3300025921 Unclassified 887
360 Ga0207646_10048346 3300025922 Unclassified 3813
361 Ga0207646_10126496 3300025922 Bacteria 2298
362 Ga0207681_10841414 3300025923 Bacteria 767
363 Ga0207687_10347128 3300025927 Bacteria 1208
364 Ga0207687_10697002 3300025927 Unclassified 862
365 Ga0207700_10154010 3300025928 Bacteria 1903
366 Ga0207700_11696897 3300025928 Unclassified 557
367 Ga0207664_10148266 3300025929 Bacteria 1991
368 Ga0207644_10409406 3300025931 Bacteria 1110
369 Ga0207644_11012442 3300025931 Unclassified 697
370 Ga0207690_11462331 3300025932 Bacteria 571
371 Ga0207706_10046609 3300025933 Bacteria 3838
372 Ga0207706_10556056 3300025933 Unclassified 988
373 Ga0207706_10806144 3300025933 Bacteria 797
374 Ga0207686_10126181 3300025934 Bacteria 1749
375 Ga0207709_10239994 3300025935 Bacteria 1318
376 Ga0207670_10009739 3300025936 Bacteria 5499
377 Ga0207670_10547240 3300025936 Unclassified 945
378 Ga0207704_10044138 3300025938 Bacteria 2639
379 Ga0207665_10770325 3300025939 Bacteria 759
380 Ga0207691_10010752 3300025940 Bacteria 8785
381 Ga0207689_10011788 3300025942 Bacteria 7489
382 Ga0207689_11169726 3300025942 Bacteria 648
383 Ga0207661_10002298 3300025944 Bacteria 13165
384 Ga0207661_10002376 3300025944 Bacteria 12953
385 Ga0207661_10011612 3300025944 Bacteria 6390
386 Ga0207661_10575209 3300025944 Bacteria 1033
387 Ga0207667_10318237 3300025949 Bacteria 1589
388 Ga0207667_12090638 3300025949 Unclassified 525
389 Ga0207651_10096785 3300025960 Bacteria 2178
390 Ga0207668_10178032 3300025972 Bacteria 1675
391 Ga0207640_10002016 3300025981 Bacteria 10969
392 Ga0207640_10051038 3300025981 Bacteria 2687
393 Ga0207640_11048170 3300025981 Bacteria 719
394 Ga0207640_11294481 3300025981 Unclassified 651
395 Ga0207658_11423187 3300025986 Bacteria 634
396 Ga0207677_10191510 3300026023 Bacteria 1618
397 Ga0207677_10307361 3300026023 Bacteria 1312
398 Ga0207677_10948177 3300026023 Unclassified 778
399 Ga0207703_10112578 3300026035 Bacteria 2325
400 Ga0207703_10448812 3300026035 Bacteria 1204
401 Ga0207703_10830558 3300026035 Unclassified 883
402 Ga0207639_10972854 3300026041 Bacteria 794
403 Ga0207678_10063224 3300026067 Bacteria 3181
404 Ga0207678_11346394 3300026067 Unclassified 631
405 Ga0207708_10051724 3300026075 Bacteria 3128
406 Ga0207708_10094025 3300026075 Bacteria 2314
407 Ga0207708_10195817 3300026075 Bacteria 1610
408 Ga0207702_10211268 3300026078 Bacteria 1804
409 Ga0207702_12111654 3300026078 Bacteria 553
410 Ga0207641_10242402 3300026088 Bacteria 1680
411 Ga0207641_10355513 3300026088 Unclassified 1397
412 Ga0207648_10045018 3300026089 Bacteria 3872
413 Ga0207648_10184520 3300026089 Bacteria 1847
414 Ga0207648_10228306 3300026089 Bacteria 1655
415 Ga0207676_11045640 3300026095 Unclassified 806
416 Ga0207674_10103883 3300026116 Bacteria 2820
417 Ga0207674_10457778 3300026116 Bacteria 1233
418 Ga0207674_11194865 3300026116 Bacteria 730
419 Ga0207674_11299956 3300026116 Unclassified 697
420 Ga0207675_100028664 3300026118 Bacteria 5186
421 Ga0207675_100082946 3300026118 Bacteria 3006
422 Ga0207675_102672012 3300026118 Unclassified 508
423 Ga0207683_10414567 3300026121 Bacteria 1240
424 Ga0207683_11175576 3300026121 Bacteria 711
425 Ga0207698_10080279 3300026142 Bacteria 2627
426 Ga0207698_10117295 3300026142 Bacteria 2245
427 Ga0207698_10956040 3300026142 Bacteria 866
428 Ga0209969_1003478 3300027360 Bacteria 2181
429 Ga0209984_1006282 3300027424 Bacteria 1454
430 Ga0210000_1051026 3300027462 Unclassified 664
431 Ga0209968_1017787 3300027526 Bacteria 1136
432 Ga0209999_1008755 3300027543 Bacteria 1828
433 Ga0209588_1003267 3300027671 Bacteria 4481
434 Ga0209966_1015547 3300027695 Bacteria 1430
435 Ga0209974_10036364 3300027876 Bacteria 1636
436 Ga0207428_10064469 3300027907 Bacteria 2892
437 Ga0207428_10254717 3300027907 Bacteria 1308
438 Ga0268265_11034383 3300028380 Bacteria 813
439 Ga0268265_11366513 3300028380 Bacteria 710
440 Ga0268264_11701881 3300028381 Bacteria 641
441 Ga0265337_1038808 3300028556 Bacteria 1379
442 Ga0265318_10101478 3300028577 Bacteria 1058
443 Ga0265336_10005887 3300028666 Bacteria 4472
444 Ga0265338_10016447 3300028800 Bacteria 8049
445 Ga0265330_10049623 3300031235 Bacteria 1843
446 Ga0265325_10233199 3300031241 Bacteria 838
447 Ga0265340_10161164 3300031247 Bacteria 1019
448 Ga0265339_10028468 3300031249 Bacteria 3176
449 Ga0265331_10104014 3300031250 Bacteria 1305
450 Ga0265327_10098118 3300031251 Bacteria 1418
451 Ga0265316_10048141 3300031344 Bacteria 3368
452 Ga0307408_100066989 3300031548 Unclassified 2639
453 Ga0307408_100809132 3300031548 Bacteria 851
454 Ga0265313_10012796 3300031595 Bacteria 5092
455 Ga0265314_10005023 3300031711 Bacteria 12056
456 Ga0265342_10012497 3300031712 Bacteria 5748
457 Ga0307405_10108976 3300031731 Bacteria 1872
458 Ga0307405_10277693 3300031731 Unclassified 1259
459 Ga0307413_10031804 3300031824 Unclassified 2983
460 Ga0307413_10232067 3300031824 Bacteria 1356
461 Ga0307410_10173975 3300031852 Unclassified 1625
462 Ga0307406_10415709 3300031901 Unclassified 1070
463 Ga0307406_10746755 3300031901 Unclassified 821
464 Ga0307407_10195109 3300031903 Unclassified 1353
465 Ga0307412_10016580 3300031911 Bacteria 4393
466 Ga0307412_10154816 3300031911 Bacteria 1696
467 Ga0307412_11073969 3300031911 Bacteria 715
468 Ga0307409_100048366 3300031995 Bacteria 3236
469 Ga0307409_100120052 3300031995 Unclassified 2224
470 Ga0307409_102180715 3300031995 Unclassified 583
471 Ga0307409_102192480 3300031995 Unclassified 582
472 Ga0307416_100053075 3300032002 Bacteria 3250
473 Ga0307416_100172343 3300032002 Unclassified 2016
474 Ga0307414_10209793 3300032004 Bacteria 1591
475 Ga0307414_10462886 3300032004 Unclassified 1115
476 Ga0307411_10383636 3300032005 Bacteria 1156
477 Ga0307411_10486914 3300032005 Unclassified 1040
478 Ga0307415_100074395 3300032126 Bacteria 2401
479 Ga0373951_0174614 3300035091 Unclassified 614
480 Ga0373931_0173947 3300035691 Bacteria 1271
481 Ga0373931_0411598 3300035691 Unclassified 858
482 Ga0373947_0039438 3300035725 Bacteria 2810
483 Ga0373937_0754691 3300036401 Bacteria 920
484 Ga0373925_1573714 3300037068 Unclassified 537
485 Ga0395899_0051252 3300037312 Bacteria 3063
486 Ga0395900_0320095 3300037418 Bacteria 1531
487 Ga0395898_0744374 3300037466 Bacteria 921
488 Ga0395901_0341246 3300038443 Bacteria 1547
489 Ga0242420_008619 3300038996 Bacteria 1659
490 Ga0436365_0443550 3300039437 Unclassified 1224
491 Ga0436363_0198479 3300039450 Bacteria 1270
492 Ga0451804_0396918 3300041463 Bacteria 653
493 Ga0451807_1352813 3300041486 Unclassified 531
494 Ga0439455_0196116 3300042012 Bacteria 584
495 Ga0450898_038088 3300042134 Unclassified 902
496 Ga0439434_0146283 3300042435 Bacteria 781
497 Ga0451577_0243167 3300042876 Bacteria 1629
498 Ga0466963_0051639 3300044694 Bacteria 2726
499 Ga0466963_0104949 3300044694 Bacteria 1937
500 Ga0453684_1663748 3300044712 Unclassified 653
501 Ga0466957_0194069 3300044842 Unclassified 1331
502 Ga0451576_0127709 3300045051 Bacteria 2649
503 Ga0466958_0582605 3300045836 Unclassified 727
504 Ga0466967_0056152 3300045976 Bacteria 3471
505 Ga0495603_0235842 3300046455 Bacteria 1054
506 Ga0495629_0505705 3300046459 Bacteria 814
507 Ga0495629_0654632 3300046459 Bacteria 700
508 Ga0495580_0754594 3300046472 Unclassified 634
509 Ga0495582_0164411 3300046473 Unclassified 1263
510 Ga0495582_0893379 3300046473 Bacteria 514
511 Ga0495662_0377599 3300046476 Bacteria 696
512 Ga0495585_0523179 3300046492 Unclassified 562
513 Ga0495658_0051722 3300046683 Bacteria 2328
514 Ga0495613_0081959 3300046689 Bacteria 2343
515 Ga0495581_0686175 3300047315 Bacteria 591
516 Ga0495636_0132155 3300047318 Bacteria 1111
517 Ga0495672_0002225 3300047320 Bacteria 18040
518 Ga0495676_0054465 3300047321 Bacteria 3180
519 Ga0495684_0512605 3300047471 Bacteria 823
520 Ga0496100_0124165 3300048903 Bacteria 1810
521 Ga0496101_0234917 3300048904 Unclassified 1426
522 Ga0496102_0249080 3300048905 Bacteria 1675
523 Ga0496102_0342668 3300048905 Bacteria 1407
524 Ga0496102_1322035 3300048905 Unclassified 640
525 Ga0496102_1678543 3300048905 Bacteria 553
526 Ga0496103_0253235 3300048906 Bacteria 1133
527 Ga0496103_0559150 3300048906 Bacteria 730
528 Ga0496103_0634145 3300048906 Bacteria 680
529 Ga0496104_0032626 3300048907 Bacteria 4848
530 Ga0496104_0410320 3300048907 Bacteria 1267
531 Ga0496105_0046404 3300048908 Bacteria 3586
532 Ga0496107_0024626 3300048910 Bacteria 4258
533 Ga0496108_0434395 3300048911 Bacteria 1147
534 Ga0496109_0000842 3300048912 Bacteria 25648
535 Ga0496109_1943972 3300048912 Unclassified 520
536 Ga0496110_0000414 3300048913 Bacteria 29042
537 Ga0496110_0104176 3300048913 Bacteria 2545
538 Ga0496110_0345324 3300048913 Bacteria 1356
539 Ga0496111_0000134 3300048914 Bacteria 32642
540 Ga0496111_0108070 3300048914 Bacteria 2048
541 Ga0496112_0123960 3300048915 Unclassified 2555
542 Ga0496112_0185635 3300048915 Bacteria 2043
543 Ga0496112_0525262 3300048915 Bacteria 1118
544 Ga0496113_0011716 3300048916 Bacteria 5866
545 Ga0496113_0045059 3300048916 Bacteria 3270
546 Ga0496113_0205400 3300048916 Bacteria 1567
547 Ga0496114_0108487 3300048917 Bacteria 2376
548 Ga0496114_0130540 3300048917 Bacteria 2169
549 Ga0496125_0166145 3300048928 Bacteria 1491
550 Ga0495682_0310642 3300049460 Bacteria 556
551 Ga0501291_026943 3300049514 Unclassified 949
552 Ga0501292_016549 3300049515 Unclassified 1161
553 Ga0501292_017189 3300049515 Unclassified 1142
554 Ga0501296_000553 3300049519 Unclassified 3669
555 Ga0501298_065242 3300049521 Bacteria 777
556 Ga0501299_016648 3300049522 Unclassified 1304
557 Ga0501299_016841 3300049522 Unclassified 1298
558 Ga0501300_019125 3300049523 Unclassified 1001
559 Ga0501316_047544 3300049532 Unclassified 611
560 Ga0501076_0622973 3300049592 Bacteria 890
561 Ga0501198_016159 3300049649 Bacteria 1152
562 Ga0501202_012981 3300049652 Bacteria 1580
563 Ga0501206_008067 3300049653 Bacteria 1389
564 Ga0501207_026438 3300049654 Bacteria 956
565 Ga0501207_036228 3300049654 Unclassified 846
566 Ga0501211_050138 3300049658 Unclassified 516
567 Ga0501214_024020 3300049659 Unclassified 795
568 Ga0501214_024321 3300049659 Unclassified 792
569 Ga0501216_013760 3300049660 Bacteria 1346
570 Ga0501217_000384 3300049661 Bacteria 7089
571 Ga0501217_022266 3300049661 Bacteria 1502
572 Ga0501217_114276 3300049661 Unclassified 778
573 Ga0501217_280287 3300049661 Unclassified 545
574 Ga0501223_007434 3300049663 Unclassified 2242
575 Ga0501224_001544 3300049664 Bacteria 3066
576 Ga0501224_018894 3300049664 Unclassified 1027
577 Ga0501224_044674 3300049664 Unclassified 673
578 Ga0501227_013375 3300049665 Unclassified 1807
579 Ga0501233_078324 3300049668 Bacteria 847
580 Ga0501233_226631 3300049668 Unclassified 554
581 Ga0501235_011224 3300049669 Bacteria 1962
582 Ga0501236_124750 3300049670 Unclassified 526
583 Ga0501240_013105 3300049673 Bacteria 1145
584 Ga0501243_012113 3300049675 Unclassified 1358
585 Ga0501243_023668 3300049675 Unclassified 1023
586 Ga0501249_015255 3300049679 Unclassified 1642
587 Ga0501249_074179 3300049679 Bacteria 796
588 Ga0501250_000793 3300049680 Bacteria 2337
589 Ga0501252_006078 3300049682 Bacteria 1333
590 Ga0501253_004182 3300049683 Bacteria 1801
591 Ga0501256_005381 3300049685 Unclassified 1127
592 Ga0501257_008492 3300049686 Bacteria 2310
593 Ga0501258_013222 3300049687 Unclassified 904
594 Ga0501259_003131 3300049688 Unclassified 2650
595 Ga0501259_021220 3300049688 Bacteria 1158
596 Ga0501259_056531 3300049688 Unclassified 810
597 Ga0501259_060615 3300049688 Unclassified 790
598 Ga0501261_000624 3300049690 Bacteria 4492
599 Ga0501221_000146 3300049704 Bacteria 9358
600 Ga0501225_0001626 3300049705 Bacteria 7022
601 Ga0501225_0030051 3300049705 Unclassified 1494
602 Ga0501234_001832 3300049707 Unclassified 3356
603 Ga0501234_011450 3300049707 Bacteria 1387
604 Ga0501245_012602 3300049708 Bacteria 1243
605 Ga0501245_015841 3300049708 Bacteria 1137
606 Ga0501079_0243230 3300049741 Bacteria 1406
607 Ga0501079_0669185 3300049741 Bacteria 817
608 Ga0501081_0214110 3300049743 Bacteria 1400
609 Ga0501262_002901 3300049759 Unclassified 1947
610 Ga0501262_075948 3300049759 Unclassified 556
611 Ga0501263_081493 3300049760 Bacteria 535
612 Ga0501264_062152 3300049761 Unclassified 506
613 Ga0501266_011082 3300049763 Unclassified 1152
614 Ga0501267_050215 3300049764 Bacteria 542
615 Ga0501268_000045 3300049765 Bacteria 9459
616 Ga0501268_002134 3300049765 Bacteria 2572
617 Ga0501268_182470 3300049765 Bacteria 501
618 Ga0501273_000977 3300049770 Bacteria 2552
619 Ga0501273_101062 3300049770 Bacteria 500
620 Ga0501274_000580 3300049771 Unclassified 2633
621 Ga0501276_019255 3300049773 Unclassified 641
622 Ga0501279_020446 3300049775 Unclassified 941
623 Ga0501279_022619 3300049775 Bacteria 903
624 Ga0501280_040384 3300049776 Bacteria 755
625 Ga0501283_006595 3300049779 Bacteria 1630
626 Ga0501283_010073 3300049779 Bacteria 1387
627 Ga0501045_0611172 3300049824 Bacteria 807
628 Ga0501212_026960 3300049851 Unclassified 912
629 Ga0501212_043629 3300049851 Bacteria 746
630 Ga0501212_100013 3300049851 Unclassified 544
631 nmdc:mga0yw44_1000352_c1 3300050492 Unclassified 566
632 nmdc:mga05p37_299167_c1 3300050507 Bacteria 1912
633 nmdc:mga05p37_326995_c1 3300050507 Bacteria 1812
634 nmdc:mga05p37_476129_c1 3300050507 Bacteria 1439
635 nmdc:mga09592_114328_c1 3300050508 Bacteria 2316
636 nmdc:mga09592_127694_c1 3300050508 Bacteria 2186
637 nmdc:mga09592_166738_c1 3300050508 Bacteria 1904
638 nmdc:mga09592_379128_c1 3300050508 Bacteria 1223
639 nmdc:mga09592_543454_c1 3300050508 Unclassified 998
640 nmdc:mga06r32_263299_c1 3300050510 Unclassified 1712
641 nmdc:mga06r32_62286_c1 3300050510 Bacteria 3594
642 nmdc:mga08y16_106256_c1 3300050511 Bacteria 2922
643 nmdc:mga08y16_177647_c1 3300050511 Bacteria 2211
644 nmdc:mga08y16_379561_c1 3300050511 Bacteria 1449
645 nmdc:mga08y16_4952_c1 3300050511 Bacteria 13917
646 nmdc:mga0n895_1846939_c1 3300050512 Unclassified 564
647 nmdc:mga0rr50_1666075_c1 3300050513 Bacteria 538
648 Ga0500583_0317044 3300053092 Unclassified 761
649 Ga0500641_0243265 3300053096 Bacteria 756
650 Ga0500637_0116381 3300053178 Bacteria 1551
651 Ga0501084_0179382 3300054114 Bacteria 1788
652 Ga0501082_1168699 3300060353 Bacteria 672
653 Ga0466962_0057657 3300061719 Unclassified 1854
654 Ga0068868_102069738
655 CNAas_1000200
656 rootH1_10248251
657 Ga0007409J51694_1093102
658 Ga0058862_11133370
659 Ga0065715_10402407
660 Ga0065715_10442517
661 Ga0065715_10578070
662 Ga0070676_10788017
663 Ga0070676_11208807
664 Ga0070683_100000337
665 Ga0070683_100010827
666 Ga0070683_100620504
667 Ga0070690_100032116
668 Ga0070690_100076729
669 Ga0070690_100897545
670 Ga0070670_100022051
671 Ga0070677_10279587
672 Ga0068869_100017104
673 Ga0068869_100049055
674 Ga0068869_100504152
675 Ga0070666_10059274
676 Ga0070666_10577710
677 Ga0070680_100007829
678 Ga0070680_100030728
679 Ga0070680_100087486
680 Ga0070680_100099085
681 Ga0070680_100114150
682 Ga0070682_100009500
683 Ga0068868_100073929
684 Ga0068868_100424091
685 Ga0068868_100691065
686 Ga0070660_100122475
687 Ga0070689_100017378
688 Ga0070689_100132605
689 Ga0070689_100568345
690 Ga0070691_10144166
691 Ga0070691_10268402
692 Ga0070691_10757294
693 Ga0070687_100042195
694 Ga0070687_100069986
695 Ga0070687_100235531
696 Ga0070687_100251871
697 Ga0070687_100323436
698 Ga0070661_100001846
699 Ga0070692_10007266
700 Ga0070692_10058801
701 Ga0070692_10076555
702 Ga0070692_10099959
703 Ga0070668_100117765
704 Ga0070668_100739423
705 Ga0070669_100232784
706 Ga0070669_101082470
707 Ga0070675_100002325
708 Ga0070675_100855852
709 Ga0070671_100222830
710 Ga0070671_100223159
711 Ga0070674_100241920
712 Ga0070674_100636784
713 Ga0070673_100107166
714 Ga0070673_100177669
715 Ga0070673_102182584
716 Ga0070688_100374151
717 Ga0070659_100003444
718 Ga0070659_101116519
719 Ga0070667_100259159
720 Ga0070667_100349060
721 Ga0070667_101010147
722 Ga0070703_10002281
723 Ga0070709_10134749
724 Ga0070709_10623124
725 Ga0070714_101877676
726 Ga0070713_102298013
727 Ga0070701_10096821
728 Ga0070701_10347813
729 Ga0070701_11297913
730 Ga0070705_100011609
731 Ga0070705_100110081
732 Ga0070700_100052812
733 Ga0070700_100060785
734 Ga0070700_100068534
735 Ga0070700_100086664
736 Ga0070694_100045480
737 Ga0070694_100085064
738 Ga0070694_100131441
739 Ga0070694_100345691
740 Ga0070694_100548123
741 Ga0070694_101219569
742 Ga0070708_100012542
743 Ga0070708_102191997
744 Ga0070663_100092903
745 Ga0070663_100119508
746 Ga0070663_101296566
747 Ga0070678_100214202
748 Ga0070678_101973132
749 Ga0070662_100000810
750 Ga0070662_100067318
751 Ga0070662_100650755
752 Ga0070681_10000041
753 Ga0070681_10006635
754 Ga0070681_10010527
755 Ga0070681_10346049
756 Ga0070681_10399478
757 Ga0068867_100064177
758 Ga0068867_100517846
759 Ga0068867_101373385
760 Ga0070685_10399434
761 Ga0070706_100031914
762 Ga0070706_101034996
763 Ga0070698_100015037
764 Ga0070698_100024210
765 Ga0070699_100051609
766 Ga0070699_100312071
767 Ga0070699_101440192
768 Ga0070679_100000074
769 Ga0070679_100016462
770 Ga0070679_100029822
771 Ga0070679_100299768
772 Ga0070679_100419024
773 Ga0070679_101997995
774 Ga0070684_100007105
775 Ga0070684_100068647
776 Ga0070684_100106499
777 Ga0070684_100113620
778 Ga0070684_100125249
779 Ga0070697_100034174
780 Ga0070697_100076798
781 Ga0068853_100100256
782 Ga0070672_100099155
783 Ga0070672_100216047
784 Ga0070686_100105947
785 Ga0070686_100205865
786 Ga0070695_100037891
787 Ga0070695_100137523
788 Ga0070695_100277715
789 Ga0070695_100967264
790 Ga0070695_101285703
791 Ga0070696_100000539
792 Ga0070696_100027770
793 Ga0070696_101138216
794 Ga0070696_101232465
795 Ga0070696_101740556
796 Ga0070693_100001583
797 Ga0070693_100002438
798 Ga0070665_100000513
799 Ga0070704_100043491
800 Ga0070704_101026246
801 Ga0070704_101098975
802 Ga0070704_101108067
803 Ga0068855_100048518
804 Ga0068855_100085564
805 Ga0068855_100554083
806 Ga0068855_100838021
807 Ga0068855_101311247
808 Ga0068855_101539541
809 Ga0070664_100238488
810 Ga0070664_100246646
811 Ga0070664_102195286
812 Ga0068857_100008276
813 Ga0068857_100161450
814 Ga0068857_100559722
815 Ga0068857_101795130
816 Ga0068854_100110935
817 Ga0068854_100262059
818 Ga0068854_100486508
819 Ga0068854_100741848
820 Ga0068856_100003537
821 Ga0068856_100015191
822 Ga0068856_101562649
823 Ga0068856_101821346
824 Ga0070702_100009011
825 Ga0070702_100092407
826 Ga0070702_101291619
827 Ga0068852_100049470
828 Ga0068852_100099610
829 Ga0068852_100105124
830 Ga0068852_100289557
831 Ga0068859_100000002
832 Ga0068859_100004552
833 Ga0068859_100009080
834 Ga0068859_100212557
835 Ga0068859_100708843
836 Ga0068864_100110007
837 Ga0068864_101205754
838 Ga0068866_10376556
839 Ga0068861_100551119
840 Ga0068861_101129077
841 Ga0068861_101406819
842 Ga0068851_10012223
843 Ga0068870_10072913
844 Ga0068863_100053308
845 Ga0068863_100334039
846 Ga0068863_101066564
847 Ga0068858_100234845
848 Ga0068858_100406694
849 Ga0068858_100805388
850 Ga0068858_101033254
851 Ga0068860_100068012
852 Ga0068860_100182895
853 Ga0068862_100051776
854 Ga0068862_100057260
855 Ga0068862_100673004
856 Ga0070716_100917375
857 Ga0070712_100015507
858 Ga0070712_100518633
859 Ga0097621_100056203
860 Ga0097621_100287593
861 Ga0097621_101159986
862 Ga0097621_102033215
863 Ga0068871_100010847
864 Ga0068871_100030165
865 Ga0075428_100094277
866 Ga0075428_100564179
867 Ga0075428_101038494
868 Ga0075430_100007032
869 Ga0075430_100055805
870 Ga0075431_100353227
871 Ga0075433_10210554
872 Ga0075434_100195473
873 Ga0075434_100439814
874 Ga0075429_100016995
875 Ga0075429_100142989
876 Ga0075429_100349601
877 Ga0068865_100231313
878 Ga0097620_100000002
879 Ga0097620_100004552
880 Ga0097620_100009080
881 Ga0097620_100212551
882 Ga0097620_100708929
883 Ga0105240_10012385
884 Ga0105240_10042919
885 Ga0105240_10083956
886 Ga0105240_10119368
887 Ga0105240_10127845
888 Ga0105240_11269466
889 Ga0105240_12634001
890 Ga0111539_10005689
891 Ga0111539_10016357
892 Ga0111539_10161987
893 Ga0105245_10022771
894 Ga0105245_10027042
895 Ga0105245_10124676
896 Ga0105245_10165088
897 Ga0105245_10967966
898 Ga0114129_10044644
899 Ga0114129_10076024
900 Ga0114129_10649577
901 Ga0114129_11746021
902 Ga0105243_10064203
903 Ga0105243_10170862
904 Ga0105241_10070490
905 Ga0105241_10098226
906 Ga0105241_10240187
907 Ga0105241_11841746
908 Ga0105242_10027983
909 Ga0105242_10057948
910 Ga0105248_10003597
911 Ga0105248_10560703
912 Ga0105248_10822237
913 Ga0105237_10001367
914 Ga0105237_10096648
915 Ga0105237_10530559
916 Ga0105237_10570737
917 Ga0105237_10703261
918 Ga0105238_10154079
919 Ga0105238_10962959
920 Ga0105239_10886343
921 Ga0105239_12083437
922 Ga0105246_10005127
923 Ga0105246_10042246
924 Ga0105246_10775690
925 Ga0157373_10028865
926 Ga0157373_10509153
927 Ga0157373_10657024
928 Ga0157373_10999656
929 Ga0157371_10011028
930 Ga0157370_10257666
931 Ga0157370_11952731
932 Ga0157369_10077964
933 Ga0157369_10265439
934 Ga0157374_10005959
935 Ga0157374_10023151
936 Ga0157374_10168308
937 Ga0157374_10302223
938 Ga0157378_10429638
939 Ga0157378_10828152
940 Ga0157378_12067728
941 Ga0163162_10337119
942 Ga0157372_10010450
943 Ga0157372_10010550
944 Ga0157372_10079844
945 Ga0157375_10015456
946 Ga0157375_10219691
947 Ga0157375_10757366
948 Ga0163163_10175027
949 Ga0163163_10186437
950 Ga0163163_10912800
951 Ga0157380_10002857
952 Ga0157380_10016633
953 Ga0157380_10235699
954 Ga0157377_10024236
955 Ga0157377_10547752
956 Ga0157377_11662003
957 Ga0157379_10201507
958 Ga0157379_10359881
959 Ga0157379_10793764
960 Ga0157379_11117225
961 Ga0157376_10024971
962 Ga0157376_10045369
963 Ga0157376_10110286
964 Ga0163161_10062973
965 Ga0207656_10031519
966 Ga0207653_10003550
967 Ga0207653_10118740
968 Ga0207642_10205588
969 Ga0207642_10417156
970 Ga0207680_10650266
971 Ga0207699_10216121
972 Ga0207645_10575344
973 Ga0207645_10934555
974 Ga0207643_10121983
975 Ga0207684_10102372
976 Ga0207654_10114572
977 Ga0207654_10236609
978 Ga0207707_10000077
979 Ga0207707_10008984
980 Ga0207707_10015197
981 Ga0207707_10028214
982 Ga0207707_10039996
983 Ga0207707_10369976
984 Ga0207707_10396246
985 Ga0207695_10007946
986 Ga0207695_10074728
987 Ga0207695_10079063
988 Ga0207695_10086124
989 Ga0207695_10476412
990 Ga0207695_10583474
991 Ga0207671_10011164
992 Ga0207671_10055217
993 Ga0207671_10424143
994 Ga0207693_10559885
995 Ga0207693_10642828
996 Ga0207660_10005318
997 Ga0207660_10009830
998 Ga0207660_10019945
999 Ga0207660_10024755
1000 Ga0207660_10156729
1001 Ga0207660_10376896
1002 Ga0207660_10634899
1003 Ga0207662_10027141
1004 Ga0207662_10040290
1005 Ga0207662_10059473
1006 Ga0207662_10313632
1007 Ga0207649_10171133
1008 Ga0207652_10000096
1009 Ga0207652_10000449
1010 Ga0207652_10013788
1011 Ga0207652_10113226
1012 Ga0207652_10723440
1013 Ga0207646_10048346
1014 Ga0207646_10126496
1015 Ga0207681_10841414
1016 Ga0207687_10347128
1017 Ga0207687_10697002
1018 Ga0207700_10154010
1019 Ga0207700_11696897
1020 Ga0207664_10148266
1021 Ga0207644_10409406
1022 Ga0207644_11012442
1023 Ga0207690_11462331
1024 Ga0207706_10046609
1025 Ga0207706_10556056
1026 Ga0207706_10806144
1027 Ga0207686_10126181
1028 Ga0207709_10239994
1029 Ga0207670_10009739
1030 Ga0207670_10547240
1031 Ga0207704_10044138
1032 Ga0207665_10770325
1033 Ga0207691_10010752
1034 Ga0207689_10011788
1035 Ga0207689_11169726
1036 Ga0207661_10002298
1037 Ga0207661_10002376
1038 Ga0207661_10011612
1039 Ga0207661_10575209
1040 Ga0207667_10318237
1041 Ga0207667_12090638
1042 Ga0207651_10096785
1043 Ga0207668_10178032
1044 Ga0207640_10002016
1045 Ga0207640_10051038
1046 Ga0207640_11048170
1047 Ga0207640_11294481
1048 Ga0207658_11423187
1049 Ga0207677_10191510
1050 Ga0207677_10307361
1051 Ga0207677_10948177
1052 Ga0207703_10112578
1053 Ga0207703_10448812
1054 Ga0207703_10830558
1055 Ga0207639_10972854
1056 Ga0207678_10063224
1057 Ga0207678_11346394
1058 Ga0207708_10051724
1059 Ga0207708_10094025
1060 Ga0207708_10195817
1061 Ga0207702_10211268
1062 Ga0207702_12111654
1063 Ga0207641_10242402
1064 Ga0207641_10355513
1065 Ga0207648_10045018
1066 Ga0207648_10184520
1067 Ga0207648_10228306
1068 Ga0207676_11045640
1069 Ga0207674_10103883
1070 Ga0207674_10457778
1071 Ga0207674_11194865
1072 Ga0207674_11299956
1073 Ga0207675_100028664
1074 Ga0207675_100082946
1075 Ga0207675_102672012
1076 Ga0207683_10414567
1077 Ga0207683_11175576
1078 Ga0207698_10080279
1079 Ga0207698_10117295
1080 Ga0207698_10956040
1081 Ga0209969_1003478
1082 Ga0209984_1006282
1083 Ga0210000_1051026
1084 Ga0209968_1017787
1085 Ga0209999_1008755
1086 Ga0209588_1003267
1087 Ga0209966_1015547
1088 Ga0209974_10036364
1089 Ga0207428_10064469
1090 Ga0207428_10254717
1091 Ga0268265_11034383
1092 Ga0268265_11366513
1093 Ga0268264_11701881
1094 Ga0265337_1038808
1095 Ga0265318_10101478
1096 Ga0265336_10005887
1097 Ga0265338_10016447
1098 Ga0265330_10049623
1099 Ga0265325_10233199
1100 Ga0265340_10161164
1101 Ga0265339_10028468
1102 Ga0265331_10104014
1103 Ga0265327_10098118
1104 Ga0265316_10048141
1105 Ga0307408_100066989
1106 Ga0307408_100809132
1107 Ga0265313_10012796
1108 Ga0265314_10005023
1109 Ga0265342_10012497
1110 Ga0307405_10108976
1111 Ga0307405_10277693
1112 Ga0307413_10031804
1113 Ga0307413_10232067
1114 Ga0307410_10173975
1115 Ga0307406_10415709
1116 Ga0307406_10746755
1117 Ga0307407_10195109
1118 Ga0307412_10016580
1119 Ga0307412_10154816
1120 Ga0307412_11073969
1121 Ga0307409_100048366
1122 Ga0307409_100120052
1123 Ga0307409_102180715
1124 Ga0307409_102192480
1125 Ga0307416_100053075
1126 Ga0307416_100172343
1127 Ga0307414_10209793
1128 Ga0307414_10462886
1129 Ga0307411_10383636
1130 Ga0307411_10486914
1131 Ga0307415_100074395
1132 Ga0373951_0174614
1133 Ga0373931_0173947
1134 Ga0373931_0411598
1135 Ga0373947_0039438
1136 Ga0373937_0754691
1137 Ga0373925_1573714
1138 Ga0395899_0051252
1139 Ga0395900_0320095
1140 Ga0395898_0744374
1141 Ga0395901_0341246
1142 Ga0242420_008619
1143 Ga0436365_0443550
1144 Ga0436363_0198479
1145 Ga0451804_0396918
1146 Ga0451807_1352813
1147 Ga0439455_0196116
1148 Ga0450898_038088
1149 Ga0439434_0146283
1150 Ga0451577_0243167
1151 Ga0466963_0051639
1152 Ga0466963_0104949
1153 Ga0453684_1663748
1154 Ga0466957_0194069
1155 Ga0451576_0127709
1156 Ga0466958_0582605
1157 Ga0466967_0056152
1158 Ga0495603_0235842
1159 Ga0495629_0505705
1160 Ga0495629_0654632
1161 Ga0495580_0754594
1162 Ga0495582_0164411
1163 Ga0495582_0893379
1164 Ga0495662_0377599
1165 Ga0495585_0523179
1166 Ga0495658_0051722
1167 Ga0495613_0081959
1168 Ga0495581_0686175
1169 Ga0495636_0132155
1170 Ga0495672_0002225
1171 Ga0495676_0054465
1172 Ga0495684_0512605
1173 Ga0496100_0124165
1174 Ga0496101_0234917
1175 Ga0496102_0249080
1176 Ga0496102_0342668
1177 Ga0496102_1322035
1178 Ga0496102_1678543
1179 Ga0496103_0253235
1180 Ga0496103_0559150
1181 Ga0496103_0634145
1182 Ga0496104_0032626
1183 Ga0496104_0410320
1184 Ga0496105_0046404
1185 Ga0496107_0024626
1186 Ga0496108_0434395
1187 Ga0496109_0000842
1188 Ga0496109_1943972
1189 Ga0496110_0000414
1190 Ga0496110_0104176
1191 Ga0496110_0345324
1192 Ga0496111_0000134
1193 Ga0496111_0108070
1194 Ga0496112_0123960
1195 Ga0496112_0185635
1196 Ga0496112_0525262
1197 Ga0496113_0011716
1198 Ga0496113_0045059
1199 Ga0496113_0205400
1200 Ga0496114_0108487
1201 Ga0496114_0130540
1202 Ga0496125_0166145
1203 Ga0495682_0310642
1204 Ga0501291_026943
1205 Ga0501292_016549
1206 Ga0501292_017189
1207 Ga0501296_000553
1208 Ga0501298_065242
1209 Ga0501299_016648
1210 Ga0501299_016841
1211 Ga0501300_019125
1212 Ga0501316_047544
1213 Ga0501076_0622973
1214 Ga0501198_016159
1215 Ga0501202_012981
1216 Ga0501206_008067
1217 Ga0501207_026438
1218 Ga0501207_036228
1219 Ga0501211_050138
1220 Ga0501214_024020
1221 Ga0501214_024321
1222 Ga0501216_013760
1223 Ga0501217_000384
1224 Ga0501217_022266
1225 Ga0501217_114276
1226 Ga0501217_280287
1227 Ga0501223_007434
1228 Ga0501224_001544
1229 Ga0501224_018894
1230 Ga0501224_044674
1231 Ga0501227_013375
1232 Ga0501233_078324
1233 Ga0501233_226631
1234 Ga0501235_011224
1235 Ga0501236_124750
1236 Ga0501240_013105
1237 Ga0501243_012113
1238 Ga0501243_023668
1239 Ga0501249_015255
1240 Ga0501249_074179
1241 Ga0501250_000793
1242 Ga0501252_006078
1243 Ga0501253_004182
1244 Ga0501256_005381
1245 Ga0501257_008492
1246 Ga0501258_013222
1247 Ga0501259_003131
1248 Ga0501259_021220
1249 Ga0501259_056531
1250 Ga0501259_060615
1251 Ga0501261_000624
1252 Ga0501221_000146
1253 Ga0501225_0001626
1254 Ga0501225_0030051
1255 Ga0501234_001832
1256 Ga0501234_011450
1257 Ga0501245_012602
1258 Ga0501245_015841
1259 Ga0501079_0243230
1260 Ga0501079_0669185
1261 Ga0501081_0214110
1262 Ga0501262_002901
1263 Ga0501262_075948
1264 Ga0501263_081493
1265 Ga0501264_062152
1266 Ga0501266_011082
1267 Ga0501267_050215
1268 Ga0501268_000045
1269 Ga0501268_002134
1270 Ga0501268_182470
1271 Ga0501273_000977
1272 Ga0501273_101062
1273 Ga0501274_000580
1274 Ga0501276_019255
1275 Ga0501279_020446
1276 Ga0501279_022619
1277 Ga0501280_040384
1278 Ga0501283_006595
1279 Ga0501283_010073
1280 Ga0501045_0611172
1281 Ga0501212_026960
1282 Ga0501212_043629
1283 Ga0501212_100013
1284 nmdc:mga0yw44_1000352_c1
1285 nmdc:mga05p37_299167_c1
1286 nmdc:mga05p37_326995_c1
1287 nmdc:mga05p37_476129_c1
1288 nmdc:mga09592_114328_c1
1289 nmdc:mga09592_127694_c1
1290 nmdc:mga09592_166738_c1
1291 nmdc:mga09592_379128_c1
1292 nmdc:mga09592_543454_c1
1293 nmdc:mga06r32_263299_c1
1294 nmdc:mga06r32_62286_c1
1295 nmdc:mga08y16_106256_c1
1296 nmdc:mga08y16_177647_c1
1297 nmdc:mga08y16_379561_c1
1298 nmdc:mga08y16_4952_c1
1299 nmdc:mga0n895_1846939_c1
1300 nmdc:mga0rr50_1666075_c1
1301 Ga0500583_0317044
1302 Ga0500641_0243265
1303 Ga0500637_0116381
1304 Ga0501084_0179382
1305 Ga0501082_1168699
1306 Ga0466962_0057657

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02311

AraC_binding

AraC-like ligand binding domain

36

111

0.9

PF07883

Cupin_2

Cupin domain

36

108

0.9

PF00190

Cupin_1

Cupin

26

109

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9315 25 109
2oa2-assembly1.cif.gz_A-2 crystal structure of bh2720 (10175341) from bacillus halodurans at 1.41 a resolution 0.9279 25 110
7zyb-assembly1.cif.gz_A bekdgf with ca 0.9209 5 114
4jaa-assembly1.cif.gz_A factor inhibiting hif-1 alpha in complex with consensus ankyrin repeat domain-(d)leu peptide 0.915 34 108
2pfw-assembly1.cif.gz_B crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution 0.9127 5 113
ID Description Score Start End Superfamily
af_P96245_1_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9236 37 109 2.60.120.10
4cugB01 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9196 35 109 2.60.120.650
af_Q9VJ97_9_301_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9081 35 109 2.60.120.650
af_Q96S16_35_262_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9034 35 106 2.60.120.650
af_Q54FM1_4_251_2.60.120.650 Mainly Beta;Sandwich;Jelly Rolls;Cupin 0.9019 33 110 2.60.120.650
ID Description Score Start End GO Terms
AF-A0A2A4VYL0-F1-model_v4 Cupin 1.002 14 123
AF-A0A838T0J1-F1-model_v4 Cupin domain-containing protein 0.9982 3 123
AF-A0A2V7EW52-F1-model_v4 Cupin domain-containing protein 0.996 5 124
AF-A0A537VZ03-F1-model_v4 Cupin domain-containing protein 0.9953 3 123
AF-A0A2V7R241-F1-model_v4 Cupin domain-containing protein 0.9951 2 123

Map