F472725
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 652 | 414 | 576 | 338 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2551306166|2552111567 |
| Length | 379 |
| Sequence | CYVGVSRELPLLLVDETGWNFDTGAIGRPTFTVSRAKLATMVETTRIVLASRPEGAPTAANFRTETAELPPLEDGQVLLRTLYLSLDPYMRGRMSTAKSYAKPVEVGAVMVGGTVGEVLESRAPGFAKGDVALAYSGWQTHDVADASGLRKLDPGAAPVSTALGVLGMPGFTAYSGLLKIGQPKAGETVVVAAATGPVGSAVGQIAKIKGARAVGIAGGPKKCAYLLDEFGFDAAIDHRAADFAEQLKAAVPDGIDVYFENVAGPVAEAVYPLLNTYARVPVCGLIANYNAAGRPDGPDNLPAFYSRILIKSLTIRGFIQTEFVEEVFPDFLRDMTEWVADGRVRYLQDVTEGLEHAPEAFIGMLEGRNFGKVVVRVAD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 4 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 5 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 6 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 7 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 8 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 9 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 10 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 11 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 12 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 13 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 14 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 15 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 16 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 17 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 18 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 19 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 20 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 21 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 22 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 23 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 24 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 25 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 26 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 27 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 28 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 29 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 30 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 31 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 32 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 33 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 34 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 35 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 36 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 37 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 38 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 39 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 40 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 41 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 42 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 43 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 44 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 45 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 46 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 47 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 48 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 49 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 50 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 51 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 52 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 53 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 54 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 55 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 56 | 2883291878 | Hypericibacter terrae R5913 | Isolate | Rhizosphere |
| 57 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 58 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 59 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 60 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 61 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 62 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 63 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 64 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 65 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 66 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 67 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 68 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 69 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 70 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 71 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 72 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 73 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 74 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 75 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 76 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 77 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 79 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 80 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 81 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 84 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 86 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 89 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 99 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 108 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 109 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 115 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 116 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 117 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 121 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 122 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 123 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 124 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 125 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 126 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 127 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 129 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 130 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 131 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 132 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 133 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 134 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 136 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 137 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 138 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 139 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 140 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 141 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 142 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 144 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 145 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 146 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 156 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 160 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 170 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 183 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 225 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 226 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 227 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 238 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 258 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 262 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 263 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 333 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 334 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 335 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 336 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 337 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 338 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 339 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 340 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 341 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 342 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 343 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 344 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 345 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 374 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 375 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 376 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 377 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 387 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 388 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 389 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 390 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 391 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 403 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 407 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 408 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 409 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 412 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 413 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 414 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.19 |
| Metatranscriptomes | 0.15 |
| Isolates | 11.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.31 |
| Bulb | 0 |
| Endosphere | 11.5 |
| Nodule | 1.53 |
| Rhizoplane | 8.28 |
| Rhizosphere | 65.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 2 | JGI25163J39215_1001830 | 3300002771 | Bacteria | 2850 |
| 3 | JGI25151J46595_10000156 | 3300003187 | Bacteria | 88722 |
| 4 | JGI25151J46595_10000191 | 3300003187 | Bacteria | 75432 |
| 5 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 6 | JGI25153J46596_10000740 | 3300003215 | Bacteria | 20002 |
| 7 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 8 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 9 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 10 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 11 | Ga0055526_1000471 | 3300003771 | Bacteria | 32002 |
| 12 | Ga0055526_1001260 | 3300003771 | Bacteria | 18171 |
| 13 | Ga0055524_1000068 | 3300003775 | Bacteria | 130413 |
| 14 | Ga0055524_1010677 | 3300003775 | Bacteria | 3640 |
| 15 | Ga0055540_1002498 | 3300003792 | Bacteria | 9634 |
| 16 | Ga0055531_10003985 | 3300003794 | Bacteria | 9155 |
| 17 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 18 | Ga0065707_10083819 | 3300005295 | Bacteria | 8177 |
| 19 | Ga0065707_10140114 | 3300005295 | Bacteria | 1715 |
| 20 | Ga0070683_100076231 | 3300005329 | Bacteria | 3134 |
| 21 | Ga0070683_100139344 | 3300005329 | Bacteria | 2298 |
| 22 | Ga0070690_100090767 | 3300005330 | Bacteria | 2011 |
| 23 | Ga0070660_100084493 | 3300005339 | Bacteria | 2495 |
| 24 | Ga0070660_100237172 | 3300005339 | Bacteria | 1485 |
| 25 | Ga0070689_100007342 | 3300005340 | Bacteria | 7695 |
| 26 | Ga0070691_10037616 | 3300005341 | Bacteria | 2284 |
| 27 | Ga0070661_100052294 | 3300005344 | Bacteria | 2990 |
| 28 | Ga0070692_10089884 | 3300005345 | Bacteria | 1668 |
| 29 | Ga0070669_100017421 | 3300005353 | Bacteria | 5125 |
| 30 | Ga0070714_100172330 | 3300005435 | Bacteria | 1964 |
| 31 | Ga0070714_100315026 | 3300005435 | Bacteria | 1462 |
| 32 | Ga0070713_100066589 | 3300005436 | Bacteria | 3029 |
| 33 | Ga0070713_100095026 | 3300005436 | Bacteria | 2570 |
| 34 | Ga0070713_100356476 | 3300005436 | Bacteria | 1358 |
| 35 | Ga0070711_100071231 | 3300005439 | Bacteria | 2449 |
| 36 | Ga0070711_100277695 | 3300005439 | Bacteria | 1324 |
| 37 | Ga0070700_100003113 | 3300005441 | Bacteria | 8512 |
| 38 | Ga0070694_100010896 | 3300005444 | Bacteria | 5626 |
| 39 | Ga0070708_100026124 | 3300005445 | Bacteria | 4995 |
| 40 | Ga0070708_100048137 | 3300005445 | Bacteria | 3768 |
| 41 | Ga0070708_100188046 | 3300005445 | Bacteria | 1931 |
| 42 | Ga0070663_100018495 | 3300005455 | Bacteria | 4571 |
| 43 | Ga0070663_100079007 | 3300005455 | Bacteria | 2413 |
| 44 | Ga0070681_10004354 | 3300005458 | Bacteria | 13462 |
| 45 | Ga0070681_10004669 | 3300005458 | Bacteria | 13096 |
| 46 | Ga0070706_100094425 | 3300005467 | Bacteria | 2775 |
| 47 | Ga0070706_100128207 | 3300005467 | Bacteria | 2367 |
| 48 | Ga0070706_100277422 | 3300005467 | Bacteria | 1564 |
| 49 | Ga0070707_100088361 | 3300005468 | Bacteria | 2998 |
| 50 | Ga0070707_100105914 | 3300005468 | Bacteria | 2727 |
| 51 | Ga0070707_100360849 | 3300005468 | Bacteria | 1411 |
| 52 | Ga0070698_100040678 | 3300005471 | Bacteria | 4776 |
| 53 | Ga0070698_100074437 | 3300005471 | Bacteria | 3401 |
| 54 | Ga0070698_100212209 | 3300005471 | Bacteria | 1870 |
| 55 | Ga0070699_100010173 | 3300005518 | Bacteria | 8142 |
| 56 | Ga0070699_100045716 | 3300005518 | Bacteria | 3789 |
| 57 | Ga0070699_100064207 | 3300005518 | Bacteria | 3184 |
| 58 | Ga0070679_100115038 | 3300005530 | Bacteria | 2675 |
| 59 | Ga0070684_100021383 | 3300005535 | Bacteria | 5383 |
| 60 | Ga0070684_100060829 | 3300005535 | Bacteria | 3304 |
| 61 | Ga0070684_100156444 | 3300005535 | Bacteria | 2067 |
| 62 | Ga0070684_100249984 | 3300005535 | Bacteria | 1620 |
| 63 | Ga0070697_100043435 | 3300005536 | Bacteria | 3640 |
| 64 | Ga0070697_100072318 | 3300005536 | Bacteria | 2830 |
| 65 | Ga0070697_100090111 | 3300005536 | Bacteria | 2534 |
| 66 | Ga0070696_100002893 | 3300005546 | Bacteria | 11416 |
| 67 | Ga0070696_100098774 | 3300005546 | Bacteria | 2088 |
| 68 | Ga0070693_100124470 | 3300005547 | Bacteria | 1603 |
| 69 | Ga0070665_100016585 | 3300005548 | Bacteria | 7385 |
| 70 | Ga0070665_100479020 | 3300005548 | Bacteria | 1255 |
| 71 | Ga0070664_100261595 | 3300005564 | Bacteria | 1557 |
| 72 | Ga0068857_100144650 | 3300005577 | Bacteria | 2151 |
| 73 | Ga0068854_100120677 | 3300005578 | Unclassified | 1990 |
| 74 | Ga0068856_100359013 | 3300005614 | Bacteria | 1476 |
| 75 | Ga0068856_100372921 | 3300005614 | Bacteria | 1446 |
| 76 | Ga0068856_100435800 | 3300005614 | Bacteria | 1331 |
| 77 | Ga0070702_100030356 | 3300005615 | Bacteria | 2947 |
| 78 | Ga0070702_100176922 | 3300005615 | Bacteria | 1393 |
| 79 | Ga0068859_100089208 | 3300005617 | Bacteria | 3133 |
| 80 | Ga0068864_100196970 | 3300005618 | Bacteria | 1849 |
| 81 | Ga0068870_10022375 | 3300005840 | Bacteria | 3106 |
| 82 | Ga0068870_10059696 | 3300005840 | Bacteria | 2045 |
| 83 | Ga0068863_100029381 | 3300005841 | Bacteria | 5247 |
| 84 | Ga0068863_100271647 | 3300005841 | Bacteria | 1641 |
| 85 | Ga0068860_100059127 | 3300005843 | Bacteria | 3645 |
| 86 | Ga0068862_100039043 | 3300005844 | Bacteria | 4031 |
| 87 | Ga0081455_10005973 | 3300005937 | Bacteria | 13207 |
| 88 | Ga0081455_10049156 | 3300005937 | Unclassified | 3638 |
| 89 | Ga0081538_10040369 | 3300005981 | Bacteria | 2978 |
| 90 | Ga0081540_1000227 | 3300005983 | Bacteria | 59044 |
| 91 | Ga0070717_10038580 | 3300006028 | Bacteria | 3883 |
| 92 | Ga0075365_10012802 | 3300006038 | Bacteria | 4996 |
| 93 | Ga0075365_10053157 | 3300006038 | Bacteria | 2682 |
| 94 | Ga0075365_10059459 | 3300006038 | Bacteria | 2547 |
| 95 | Ga0075365_10202302 | 3300006038 | Bacteria | 1391 |
| 96 | Ga0075368_10009941 | 3300006042 | Bacteria | 3432 |
| 97 | Ga0075363_100011915 | 3300006048 | Bacteria | 4177 |
| 98 | Ga0075364_10000803 | 3300006051 | Bacteria | 16556 |
| 99 | Ga0075364_10066553 | 3300006051 | Bacteria | 2367 |
| 100 | Ga0075364_10133592 | 3300006051 | Bacteria | 1666 |
| 101 | Ga0075364_10262087 | 3300006051 | Bacteria | 1175 |
| 102 | Ga0070715_10009256 | 3300006163 | Bacteria | 3465 |
| 103 | Ga0070716_100043621 | 3300006173 | Bacteria | 2509 |
| 104 | Ga0070712_100054691 | 3300006175 | Bacteria | 2791 |
| 105 | Ga0070712_100127875 | 3300006175 | Bacteria | 1922 |
| 106 | Ga0075362_10139880 | 3300006177 | Bacteria | 1156 |
| 107 | Ga0075367_10042424 | 3300006178 | Bacteria | 2661 |
| 108 | Ga0075367_10063287 | 3300006178 | Bacteria | 2211 |
| 109 | Ga0075366_10124963 | 3300006195 | Bacteria | 1551 |
| 110 | Ga0075370_10110381 | 3300006353 | Bacteria | 1597 |
| 111 | Ga0075433_10073356 | 3300006852 | Bacteria | 3010 |
| 112 | Ga0075434_100023510 | 3300006871 | Bacteria | 6008 |
| 113 | Ga0075434_100119768 | 3300006871 | Bacteria | 2647 |
| 114 | Ga0075434_100224360 | 3300006871 | Bacteria | 1899 |
| 115 | Ga0075429_100019555 | 3300006880 | Bacteria | 5869 |
| 116 | Ga0097620_100089208 | 3300006931 | Bacteria | 3133 |
| 117 | Ga0079104_1008499 | 3300006946 | Bacteria | 3586 |
| 118 | Ga0075435_100080465 | 3300007076 | Bacteria | 2675 |
| 119 | Ga0075435_100162982 | 3300007076 | Bacteria | 1879 |
| 120 | Ga0099795_10012781 | 3300007788 | Bacteria | 2556 |
| 121 | Ga0099795_10025670 | 3300007788 | Bacteria | 1978 |
| 122 | Ga0105251_10005643 | 3300009011 | Bacteria | 8129 |
| 123 | Ga0105240_10583655 | 3300009093 | Bacteria | 1233 |
| 124 | Ga0111539_10013527 | 3300009094 | Bacteria | 10198 |
| 125 | Ga0111539_10035614 | 3300009094 | Bacteria | 6025 |
| 126 | Ga0111539_10446066 | 3300009094 | Bacteria | 1507 |
| 127 | Ga0105245_10017929 | 3300009098 | Bacteria | 6183 |
| 128 | Ga0114129_10073857 | 3300009147 | Bacteria | 4751 |
| 129 | Ga0105243_10011457 | 3300009148 | Bacteria | 6709 |
| 130 | Ga0105242_10245130 | 3300009176 | Bacteria | 1612 |
| 131 | Ga0105242_10466405 | 3300009176 | Bacteria | 1194 |
| 132 | Ga0105248_10010149 | 3300009177 | Bacteria | 10373 |
| 133 | Ga0105248_10045931 | 3300009177 | Bacteria | 4897 |
| 134 | Ga0105248_10154603 | 3300009177 | Unclassified | 2588 |
| 135 | Ga0105248_10377458 | 3300009177 | Bacteria | 1596 |
| 136 | Ga0105238_10064454 | 3300009551 | Bacteria | 3664 |
| 137 | Ga0105238_10109873 | 3300009551 | Bacteria | 2739 |
| 138 | Ga0099796_10025801 | 3300010159 | Unclassified | 1860 |
| 139 | Ga0157371_10069363 | 3300013102 | Bacteria | 2496 |
| 140 | Ga0157370_10039429 | 3300013104 | Bacteria | 4565 |
| 141 | Ga0157369_10019075 | 3300013105 | Bacteria | 7678 |
| 142 | Ga0157369_10168036 | 3300013105 | Bacteria | 2312 |
| 143 | Ga0171462_1006 | 3300013250 | Bacteria | 432986 |
| 144 | Ga0157378_10013581 | 3300013297 | Bacteria | 7123 |
| 145 | Ga0163162_10074247 | 3300013306 | Bacteria | 3459 |
| 146 | Ga0163162_10110991 | 3300013306 | Bacteria | 2839 |
| 147 | Ga0157372_10132090 | 3300013307 | Bacteria | 2873 |
| 148 | Ga0163163_10100935 | 3300014325 | Bacteria | 2908 |
| 149 | Ga0163163_10127279 | 3300014325 | Bacteria | 2585 |
| 150 | Ga0163163_10131690 | 3300014325 | Bacteria | 2541 |
| 151 | Ga0163163_10409536 | 3300014325 | Bacteria | 1414 |
| 152 | Ga0157380_10014937 | 3300014326 | Bacteria | 5694 |
| 153 | Ga0157380_10050440 | 3300014326 | Bacteria | 3287 |
| 154 | Ga0157377_10200270 | 3300014745 | Bacteria | 1267 |
| 155 | Ga0157379_10087340 | 3300014968 | Bacteria | 2796 |
| 156 | Ga0182007_10012714 | 3300015262 | Bacteria | 3231 |
| 157 | Ga0206353_11413154 | 3300020082 | Bacteria | 2187 |
| 158 | Ga0213875_10012022 | 3300021388 | Bacteria | 4287 |
| 159 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 160 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 161 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 162 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 163 | Ga0207427_100347 | 3300025231 | Bacteria | 29881 |
| 164 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 165 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 166 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 167 | Ga0209673_1038672 | 3300025273 | Bacteria | 1386 |
| 168 | Ga0209675_1000566 | 3300025291 | Bacteria | 26641 |
| 169 | Ga0209676_1020388 | 3300025292 | Bacteria | 2253 |
| 170 | Ga0209676_1034226 | 3300025292 | Bacteria | 1504 |
| 171 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 172 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 173 | Ga0209564_1000041 | 3300025295 | Bacteria | 405199 |
| 174 | Ga0209564_1000065 | 3300025295 | Bacteria | 315205 |
| 175 | Ga0209758_1001968 | 3300025297 | Bacteria | 22196 |
| 176 | Ga0209050_1016094 | 3300025298 | Bacteria | 3086 |
| 177 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 178 | Ga0209256_1000266 | 3300025299 | Bacteria | 92357 |
| 179 | Ga0209051_1002484 | 3300025303 | Bacteria | 13160 |
| 180 | Ga0209051_1019007 | 3300025303 | Bacteria | 3017 |
| 181 | Ga0209257_1000741 | 3300025304 | Bacteria | 49326 |
| 182 | Ga0207713_1015185 | 3300025735 | Bacteria | 3965 |
| 183 | Ga0207692_10005651 | 3300025898 | Bacteria | 5020 |
| 184 | Ga0207685_10007603 | 3300025905 | Bacteria | 3031 |
| 185 | Ga0207699_10028543 | 3300025906 | Bacteria | 3103 |
| 186 | Ga0207643_10013851 | 3300025908 | Bacteria | 4374 |
| 187 | Ga0207684_10016067 | 3300025910 | Bacteria | 6428 |
| 188 | Ga0207684_10121683 | 3300025910 | Bacteria | 2237 |
| 189 | Ga0207684_10170844 | 3300025910 | Bacteria | 1874 |
| 190 | Ga0207707_10001710 | 3300025912 | Bacteria | 20187 |
| 191 | Ga0207707_10003376 | 3300025912 | Bacteria | 14170 |
| 192 | Ga0207693_10025911 | 3300025915 | Bacteria | 4644 |
| 193 | Ga0207693_10064478 | 3300025915 | Bacteria | 2870 |
| 194 | Ga0207693_10076942 | 3300025915 | Bacteria | 2613 |
| 195 | Ga0207693_10208491 | 3300025915 | Bacteria | 1536 |
| 196 | Ga0207663_10082847 | 3300025916 | Bacteria | 2105 |
| 197 | Ga0207663_10147379 | 3300025916 | Bacteria | 1647 |
| 198 | Ga0207662_10035256 | 3300025918 | Bacteria | 2922 |
| 199 | Ga0207662_10040552 | 3300025918 | Bacteria | 2738 |
| 200 | Ga0207657_10023413 | 3300025919 | Bacteria | 5751 |
| 201 | Ga0207657_10160494 | 3300025919 | Bacteria | 1826 |
| 202 | Ga0207649_10033501 | 3300025920 | Bacteria | 3070 |
| 203 | Ga0207646_10054188 | 3300025922 | Bacteria | 3588 |
| 204 | Ga0207646_10120052 | 3300025922 | Bacteria | 2361 |
| 205 | Ga0207646_10131048 | 3300025922 | Bacteria | 2256 |
| 206 | Ga0207646_10132689 | 3300025922 | Bacteria | 2242 |
| 207 | Ga0207681_10242611 | 3300025923 | Bacteria | 1403 |
| 208 | Ga0207687_10263533 | 3300025927 | Bacteria | 1375 |
| 209 | Ga0207687_10299806 | 3300025927 | Bacteria | 1294 |
| 210 | Ga0207687_10313838 | 3300025927 | Bacteria | 1267 |
| 211 | Ga0207700_10007673 | 3300025928 | Bacteria | 6624 |
| 212 | Ga0207700_10165296 | 3300025928 | Bacteria | 1841 |
| 213 | Ga0207664_10365246 | 3300025929 | Bacteria | 1279 |
| 214 | Ga0207709_10026811 | 3300025935 | Bacteria | 3313 |
| 215 | Ga0207709_10032823 | 3300025935 | Bacteria | 3043 |
| 216 | Ga0207669_10353048 | 3300025937 | Bacteria | 1137 |
| 217 | Ga0207704_10022201 | 3300025938 | Bacteria | 3395 |
| 218 | Ga0207665_10116156 | 3300025939 | Bacteria | 1886 |
| 219 | Ga0207665_10135017 | 3300025939 | Bacteria | 1755 |
| 220 | Ga0207691_10124765 | 3300025940 | Bacteria | 2279 |
| 221 | Ga0207711_10002701 | 3300025941 | Bacteria | 15669 |
| 222 | Ga0207711_10022575 | 3300025941 | Bacteria | 5264 |
| 223 | Ga0207711_10167976 | 3300025941 | Unclassified | 1989 |
| 224 | Ga0207711_10188536 | 3300025941 | Bacteria | 1878 |
| 225 | Ga0207661_10101242 | 3300025944 | Bacteria | 2420 |
| 226 | Ga0207679_10258980 | 3300025945 | Bacteria | 1483 |
| 227 | Ga0207678_10007840 | 3300026067 | Bacteria | 9425 |
| 228 | Ga0207678_10041147 | 3300026067 | Bacteria | 4006 |
| 229 | Ga0207708_10002132 | 3300026075 | Bacteria | 14600 |
| 230 | Ga0207641_10219011 | 3300026088 | Bacteria | 1764 |
| 231 | Ga0207641_10278928 | 3300026088 | Bacteria | 1571 |
| 232 | Ga0207648_10005257 | 3300026089 | Bacteria | 13072 |
| 233 | Ga0207674_10058309 | 3300026116 | Bacteria | 3912 |
| 234 | Ga0207675_100001223 | 3300026118 | Bacteria | 25636 |
| 235 | Ga0207698_10187818 | 3300026142 | Bacteria | 1837 |
| 236 | Ga0209179_1002295 | 3300027512 | Bacteria | 2559 |
| 237 | Ga0209588_1000001 | 3300027671 | Bacteria | 705877 |
| 238 | Ga0209588_1015550 | 3300027671 | Bacteria | 2341 |
| 239 | Ga0209813_10003780 | 3300027866 | Bacteria | 3572 |
| 240 | Ga0209813_10037993 | 3300027866 | Bacteria | 1453 |
| 241 | Ga0268264_10000398 | 3300028381 | Bacteria | 62200 |
| 242 | Ga0307517_10000035 | 3300028786 | Bacteria | 172762 |
| 243 | Ga0265325_10000603 | 3300031241 | Bacteria | 26174 |
| 244 | Ga0265327_10022512 | 3300031251 | Bacteria | 3764 |
| 245 | Ga0265316_10034824 | 3300031344 | Bacteria | 4088 |
| 246 | Ga0307513_10131756 | 3300031456 | Bacteria | 2444 |
| 247 | Ga0265314_10022120 | 3300031711 | Bacteria | 4874 |
| 248 | Ga0307405_10037749 | 3300031731 | Bacteria | 2906 |
| 249 | Ga0307407_10167875 | 3300031903 | Bacteria | 1442 |
| 250 | Ga0307412_10000635 | 3300031911 | Bacteria | 20463 |
| 251 | Ga0307412_10005336 | 3300031911 | Bacteria | 7213 |
| 252 | Ga0307412_10035919 | 3300031911 | Bacteria | 3170 |
| 253 | Ga0307409_100064139 | 3300031995 | Bacteria | 2885 |
| 254 | Ga0307409_100183846 | 3300031995 | Bacteria | 1853 |
| 255 | Ga0307416_100471467 | 3300032002 | Bacteria | 1313 |
| 256 | Ga0307414_10001811 | 3300032004 | Bacteria | 11052 |
| 257 | Ga0307414_10009988 | 3300032004 | Bacteria | 5481 |
| 258 | Ga0307415_100031857 | 3300032126 | Bacteria | 3403 |
| 259 | Ga0307510_10010315 | 3300033180 | Bacteria | 11095 |
| 260 | Ga0307510_10017848 | 3300033180 | Bacteria | 8360 |
| 261 | Ga0373934_0048186 | 3300035086 | Bacteria | 1686 |
| 262 | Ga0373936_0129534 | 3300035113 | Bacteria | 1083 |
| 263 | Ga0373939_0047016 | 3300035114 | Bacteria | 1324 |
| 264 | Ga0373954_0130253 | 3300035118 | Bacteria | 1224 |
| 265 | Ga0373956_0008030 | 3300035119 | Bacteria | 4265 |
| 266 | Ga0373946_0118887 | 3300035171 | Bacteria | 1204 |
| 267 | Ga0373955_0067756 | 3300035172 | Bacteria | 1987 |
| 268 | Ga0373955_0083145 | 3300035172 | Bacteria | 1813 |
| 269 | Ga0373942_0035107 | 3300035207 | Bacteria | 1344 |
| 270 | Ga0373927_0259415 | 3300035695 | Bacteria | 1143 |
| 271 | Ga0373937_0090031 | 3300036401 | Bacteria | 2842 |
| 272 | Ga0373937_0152984 | 3300036401 | Bacteria | 2161 |
| 273 | Ga0373937_0235397 | 3300036401 | Bacteria | 1725 |
| 274 | Ga0373925_0000294 | 3300037068 | Bacteria | 52165 |
| 275 | Ga0373925_0152124 | 3300037068 | Bacteria | 1818 |
| 276 | Ga0373925_0184619 | 3300037068 | Bacteria | 1653 |
| 277 | Ga0395899_0179694 | 3300037312 | Bacteria | 1486 |
| 278 | Ga0395900_0157643 | 3300037418 | Bacteria | 2318 |
| 279 | Ga0395900_0343274 | 3300037418 | Bacteria | 1468 |
| 280 | Ga0395898_0064590 | 3300037466 | Bacteria | 3550 |
| 281 | Ga0395898_0114523 | 3300037466 | Bacteria | 2584 |
| 282 | Ga0436364_0087625 | 3300037853 | Bacteria | 2603 |
| 283 | Ga0436364_0627056 | 3300037853 | Bacteria | 2113 |
| 284 | Ga0436364_0645366 | 3300037853 | Bacteria | 5565 |
| 285 | Ga0395901_0004498 | 3300038443 | Bacteria | 14058 |
| 286 | Ga0395901_0122084 | 3300038443 | Bacteria | 2738 |
| 287 | Ga0436360_1317574 | 3300039438 | Bacteria | 1538 |
| 288 | Ga0436361_0740605 | 3300039447 | Bacteria | 3368 |
| 289 | Ga0436363_1577385 | 3300039450 | Bacteria | 1727 |
| 290 | Ga0436362_1099131 | 3300039453 | Bacteria | 2225 |
| 291 | Ga0451789_0514626 | 3300041443 | Bacteria | 2909 |
| 292 | Ga0451791_0202860 | 3300041451 | Bacteria | 8040 |
| 293 | Ga0451797_1285060 | 3300041453 | Bacteria | 1406 |
| 294 | Ga0451841_0647158 | 3300041498 | Bacteria | 3022 |
| 295 | Ga0451853_2172144 | 3300041512 | Bacteria | 3352 |
| 296 | Ga0466969_0000478 | 3300044656 | Bacteria | 21890 |
| 297 | Ga0466972_0048525 | 3300044658 | Bacteria | 2051 |
| 298 | Ga0466966_0011428 | 3300044684 | Bacteria | 5889 |
| 299 | Ga0466963_0038754 | 3300044694 | Bacteria | 3119 |
| 300 | Ga0466963_0081796 | 3300044694 | Bacteria | 2188 |
| 301 | Ga0466963_0095633 | 3300044694 | Bacteria | 2028 |
| 302 | Ga0466970_0006381 | 3300044765 | Bacteria | 5894 |
| 303 | Ga0466970_0049019 | 3300044765 | Bacteria | 2253 |
| 304 | Ga0466957_0037795 | 3300044842 | Bacteria | 2907 |
| 305 | Ga0466960_0001467 | 3300044901 | Bacteria | 8597 |
| 306 | Ga0466960_0038146 | 3300044901 | Bacteria | 2257 |
| 307 | Ga0466960_0068880 | 3300044901 | Bacteria | 1757 |
| 308 | Ga0466960_0079913 | 3300044901 | Bacteria | 1646 |
| 309 | Ga0466960_0107939 | 3300044901 | Bacteria | 1442 |
| 310 | Ga0466959_0040108 | 3300045049 | Bacteria | 3459 |
| 311 | Ga0466967_0085180 | 3300045976 | Bacteria | 2861 |
| 312 | Ga0466967_0089661 | 3300045976 | Bacteria | 2792 |
| 313 | Ga0466967_0093540 | 3300045976 | Bacteria | 2736 |
| 314 | Ga0495592_0042004 | 3300046454 | Bacteria | 3425 |
| 315 | Ga0495592_0050596 | 3300046454 | Bacteria | 3087 |
| 316 | Ga0495603_0155076 | 3300046455 | Bacteria | 1329 |
| 317 | Ga0495651_0109943 | 3300046462 | Bacteria | 2040 |
| 318 | Ga0495650_0002022 | 3300046471 | Bacteria | 17759 |
| 319 | Ga0495650_0005584 | 3300046471 | Bacteria | 8112 |
| 320 | Ga0495582_0060992 | 3300046473 | Bacteria | 2082 |
| 321 | Ga0495639_0014171 | 3300046475 | Bacteria | 3451 |
| 322 | Ga0495664_0003650 | 3300046477 | Bacteria | 8390 |
| 323 | Ga0495596_0000074 | 3300046500 | Bacteria | 70574 |
| 324 | Ga0495607_0000048 | 3300046501 | Bacteria | 121640 |
| 325 | Ga0495607_0035152 | 3300046501 | Bacteria | 3034 |
| 326 | Ga0495608_0006495 | 3300046511 | Bacteria | 8296 |
| 327 | Ga0495608_0027602 | 3300046511 | Bacteria | 3862 |
| 328 | Ga0495608_0110281 | 3300046511 | Bacteria | 1769 |
| 329 | Ga0495608_0188315 | 3300046511 | Bacteria | 1304 |
| 330 | Ga0495608_0199364 | 3300046511 | Bacteria | 1262 |
| 331 | Ga0495610_0000390 | 3300046512 | Bacteria | 45422 |
| 332 | Ga0495618_0011158 | 3300046514 | Bacteria | 5446 |
| 333 | Ga0495618_0018884 | 3300046514 | Bacteria | 4235 |
| 334 | Ga0495620_0000236 | 3300046515 | Bacteria | 41329 |
| 335 | Ga0495628_0025793 | 3300046516 | Bacteria | 4799 |
| 336 | Ga0495630_0001124 | 3300046517 | Bacteria | 18441 |
| 337 | Ga0495630_0032177 | 3300046517 | Bacteria | 3907 |
| 338 | Ga0495643_0000945 | 3300046522 | Bacteria | 30097 |
| 339 | Ga0495643_0006293 | 3300046522 | Bacteria | 7852 |
| 340 | Ga0495652_0066716 | 3300046529 | Bacteria | 3018 |
| 341 | Ga0495652_0077373 | 3300046529 | Bacteria | 2758 |
| 342 | Ga0495652_0154581 | 3300046529 | Bacteria | 1788 |
| 343 | Ga0495640_0001398 | 3300046533 | Bacteria | 18997 |
| 344 | Ga0495640_0027750 | 3300046533 | Bacteria | 4080 |
| 345 | Ga0495640_0028381 | 3300046533 | Bacteria | 4031 |
| 346 | Ga0495586_0015399 | 3300046535 | Bacteria | 4068 |
| 347 | Ga0495586_0031920 | 3300046535 | Bacteria | 2823 |
| 348 | Ga0495609_0001395 | 3300046538 | Bacteria | 16216 |
| 349 | Ga0495621_0038727 | 3300046539 | Bacteria | 1664 |
| 350 | Ga0495645_0187037 | 3300046543 | Bacteria | 1414 |
| 351 | Ga0495667_0015548 | 3300046559 | Bacteria | 5145 |
| 352 | Ga0495667_0047026 | 3300046559 | Bacteria | 2851 |
| 353 | Ga0495634_0004109 | 3300046642 | Bacteria | 11527 |
| 354 | Ga0495634_0026684 | 3300046642 | Bacteria | 4029 |
| 355 | Ga0495634_0038587 | 3300046642 | Bacteria | 3256 |
| 356 | Ga0495625_0146807 | 3300046660 | Bacteria | 1588 |
| 357 | Ga0495635_0005390 | 3300046663 | Bacteria | 8897 |
| 358 | Ga0495635_0154424 | 3300046663 | Bacteria | 1562 |
| 359 | Ga0495588_0011532 | 3300046674 | Bacteria | 4150 |
| 360 | Ga0495657_0027550 | 3300046675 | Bacteria | 4008 |
| 361 | Ga0495599_0005443 | 3300046678 | Bacteria | 7611 |
| 362 | Ga0495599_0176299 | 3300046678 | Bacteria | 1318 |
| 363 | Ga0495623_0086589 | 3300046679 | Bacteria | 1931 |
| 364 | Ga0495646_0181351 | 3300046680 | Bacteria | 1155 |
| 365 | Ga0495647_0085245 | 3300046681 | Bacteria | 1287 |
| 366 | Ga0495658_0014372 | 3300046683 | Bacteria | 4045 |
| 367 | Ga0495658_0045239 | 3300046683 | Bacteria | 2470 |
| 368 | Ga0495613_0146298 | 3300046689 | Bacteria | 1686 |
| 369 | Ga0495624_0130326 | 3300046690 | Bacteria | 1542 |
| 370 | Ga0495671_0068964 | 3300046692 | Bacteria | 1738 |
| 371 | Ga0495589_0000297 | 3300046794 | Bacteria | 39517 |
| 372 | Ga0495600_0008961 | 3300046809 | Bacteria | 6165 |
| 373 | Ga0495581_0064565 | 3300047315 | Bacteria | 2115 |
| 374 | Ga0495581_0155139 | 3300047315 | Bacteria | 1338 |
| 375 | Ga0495604_0001361 | 3300047317 | Bacteria | 20003 |
| 376 | Ga0495604_0034652 | 3300047317 | Bacteria | 3993 |
| 377 | Ga0495636_0012336 | 3300047318 | Bacteria | 3383 |
| 378 | Ga0495674_0162867 | 3300047319 | Bacteria | 1865 |
| 379 | Ga0495674_0212675 | 3300047319 | Bacteria | 1601 |
| 380 | Ga0495676_0163613 | 3300047321 | Bacteria | 1572 |
| 381 | Ga0495680_0014826 | 3300047322 | Bacteria | 6739 |
| 382 | Ga0495680_0032946 | 3300047322 | Bacteria | 4200 |
| 383 | Ga0495680_0240942 | 3300047322 | Bacteria | 1284 |
| 384 | Ga0495683_0000527 | 3300047323 | Bacteria | 28999 |
| 385 | Ga0495679_002910 | 3300047446 | Bacteria | 8477 |
| 386 | Ga0495681_0068664 | 3300047470 | Bacteria | 1612 |
| 387 | Ga0495684_0009361 | 3300047471 | Bacteria | 7563 |
| 388 | Ga0495686_0032402 | 3300047472 | Bacteria | 3383 |
| 389 | Ga0495602_0091199 | 3300048088 | Bacteria | 2528 |
| 390 | Ga0496100_0042503 | 3300048903 | Bacteria | 2903 |
| 391 | Ga0496100_0347824 | 3300048903 | Bacteria | 1119 |
| 392 | Ga0496101_0067070 | 3300048904 | Bacteria | 2619 |
| 393 | Ga0496101_0155050 | 3300048904 | Bacteria | 1754 |
| 394 | Ga0496101_0227163 | 3300048904 | Bacteria | 1450 |
| 395 | Ga0496102_0133104 | 3300048905 | Bacteria | 2329 |
| 396 | Ga0496102_0140430 | 3300048905 | Bacteria | 2265 |
| 397 | Ga0496102_0425337 | 3300048905 | Bacteria | 1247 |
| 398 | Ga0496104_0000303 | 3300048907 | Bacteria | 43795 |
| 399 | Ga0496104_0026767 | 3300048907 | Bacteria | 5329 |
| 400 | Ga0496104_0074509 | 3300048907 | Bacteria | 3231 |
| 401 | Ga0496104_0086072 | 3300048907 | Bacteria | 3000 |
| 402 | Ga0496104_0490673 | 3300048907 | Bacteria | 1139 |
| 403 | Ga0496105_0000975 | 3300048908 | Bacteria | 19694 |
| 404 | Ga0496105_0008362 | 3300048908 | Bacteria | 8041 |
| 405 | Ga0496105_0045435 | 3300048908 | Bacteria | 3623 |
| 406 | Ga0496105_0109415 | 3300048908 | Bacteria | 2281 |
| 407 | Ga0496106_0068778 | 3300048909 | Bacteria | 2702 |
| 408 | Ga0496107_0142180 | 3300048910 | Bacteria | 1774 |
| 409 | Ga0496108_0035934 | 3300048911 | Bacteria | 4121 |
| 410 | Ga0496108_0092653 | 3300048911 | Bacteria | 2570 |
| 411 | Ga0496108_0263171 | 3300048911 | Bacteria | 1501 |
| 412 | Ga0496109_0037527 | 3300048912 | Bacteria | 4378 |
| 413 | Ga0496109_0396048 | 3300048912 | Bacteria | 1305 |
| 414 | Ga0496110_0006378 | 3300048913 | Bacteria | 9328 |
| 415 | Ga0496110_0137598 | 3300048913 | Bacteria | 2208 |
| 416 | Ga0496111_0018369 | 3300048914 | Bacteria | 4844 |
| 417 | Ga0496111_0037939 | 3300048914 | Bacteria | 3450 |
| 418 | Ga0496111_0044693 | 3300048914 | Bacteria | 3184 |
| 419 | Ga0496111_0050990 | 3300048914 | Bacteria | 2987 |
| 420 | Ga0496112_0005559 | 3300048915 | Bacteria | 10923 |
| 421 | Ga0496112_0022841 | 3300048915 | Bacteria | 5968 |
| 422 | Ga0496112_0047790 | 3300048915 | Bacteria | 4198 |
| 423 | Ga0496112_0054758 | 3300048915 | Bacteria | 3920 |
| 424 | Ga0496112_0073057 | 3300048915 | Bacteria | 3391 |
| 425 | Ga0496112_0180754 | 3300048915 | Bacteria | 2073 |
| 426 | Ga0496112_0335928 | 3300048915 | Bacteria | 1454 |
| 427 | Ga0496113_0016896 | 3300048916 | Bacteria | 5051 |
| 428 | Ga0496113_0044397 | 3300048916 | Bacteria | 3292 |
| 429 | Ga0496113_0120508 | 3300048916 | Bacteria | 2050 |
| 430 | Ga0496113_0324883 | 3300048916 | Bacteria | 1233 |
| 431 | Ga0496114_0049308 | 3300048917 | Bacteria | 3503 |
| 432 | Ga0496114_0073072 | 3300048917 | Bacteria | 2886 |
| 433 | Ga0496114_0244667 | 3300048917 | Bacteria | 1578 |
| 434 | Ga0496114_0366390 | 3300048917 | Bacteria | 1275 |
| 435 | Ga0496115_0165963 | 3300048918 | Bacteria | 1826 |
| 436 | Ga0496117_0057283 | 3300048920 | Bacteria | 2708 |
| 437 | Ga0496117_0277947 | 3300048920 | Bacteria | 898 |
| 438 | Ga0496118_0005078 | 3300048921 | Bacteria | 15154 |
| 439 | Ga0496119_0000708 | 3300048922 | Bacteria | 44757 |
| 440 | Ga0496119_0005330 | 3300048922 | Bacteria | 12372 |
| 441 | Ga0496119_0017505 | 3300048922 | Bacteria | 5386 |
| 442 | Ga0496119_0028119 | 3300048922 | Bacteria | 3846 |
| 443 | Ga0496119_0063365 | 3300048922 | Bacteria | 2199 |
| 444 | Ga0496120_0001278 | 3300048923 | Bacteria | 31428 |
| 445 | Ga0496120_0002868 | 3300048923 | Bacteria | 16557 |
| 446 | Ga0496121_0000334 | 3300048924 | Bacteria | 98442 |
| 447 | Ga0496121_0022990 | 3300048924 | Bacteria | 6023 |
| 448 | Ga0496121_0024299 | 3300048924 | Bacteria | 5802 |
| 449 | Ga0496122_0000137 | 3300048925 | Bacteria | 170016 |
| 450 | Ga0496122_0016172 | 3300048925 | Bacteria | 7085 |
| 451 | Ga0496123_0000022 | 3300048926 | Bacteria | 361832 |
| 452 | Ga0496123_0025051 | 3300048926 | Bacteria | 4509 |
| 453 | Ga0496123_0040022 | 3300048926 | Bacteria | 3272 |
| 454 | Ga0496124_0000007 | 3300048927 | Bacteria | 883534 |
| 455 | Ga0496124_0000309 | 3300048927 | Bacteria | 90452 |
| 456 | Ga0496124_0064381 | 3300048927 | Bacteria | 3061 |
| 457 | Ga0496125_0000146 | 3300048928 | Bacteria | 154919 |
| 458 | Ga0496125_0000459 | 3300048928 | Bacteria | 73809 |
| 459 | Ga0496125_0134275 | 3300048928 | Bacteria | 1734 |
| 460 | Ga0496125_0167269 | 3300048928 | Bacteria | 1484 |
| 461 | Ga0496126_0012581 | 3300048929 | Bacteria | 8661 |
| 462 | Ga0496126_0091268 | 3300048929 | Bacteria | 2679 |
| 463 | Ga0496126_0102621 | 3300048929 | Bacteria | 2500 |
| 464 | Ga0501031_0019772 | 3300049568 | Bacteria | 4388 |
| 465 | Ga0501031_0027638 | 3300049568 | Bacteria | 3698 |
| 466 | Ga0501032_0001822 | 3300049569 | Bacteria | 16845 |
| 467 | Ga0501032_0014355 | 3300049569 | Bacteria | 5610 |
| 468 | Ga0501033_0000108 | 3300049570 | Bacteria | 79903 |
| 469 | Ga0501033_0001583 | 3300049570 | Bacteria | 20018 |
| 470 | Ga0501033_0149982 | 3300049570 | Bacteria | 1682 |
| 471 | Ga0501034_0002449 | 3300049571 | Bacteria | 22384 |
| 472 | Ga0501034_0303794 | 3300049571 | Bacteria | 1532 |
| 473 | Ga0501036_0000149 | 3300049572 | Bacteria | 45598 |
| 474 | Ga0501036_0169890 | 3300049572 | Bacteria | 1837 |
| 475 | Ga0501037_0000153 | 3300049573 | Bacteria | 64239 |
| 476 | Ga0501037_0034024 | 3300049573 | Bacteria | 3762 |
| 477 | Ga0501038_0000138 | 3300049574 | Bacteria | 62493 |
| 478 | Ga0501038_0006460 | 3300049574 | Bacteria | 10854 |
| 479 | Ga0501038_0191967 | 3300049574 | Bacteria | 1643 |
| 480 | Ga0501039_0000842 | 3300049575 | Bacteria | 22166 |
| 481 | Ga0501039_0001752 | 3300049575 | Bacteria | 16010 |
| 482 | Ga0501039_0006162 | 3300049575 | Bacteria | 9108 |
| 483 | Ga0501040_0000458 | 3300049576 | Bacteria | 24237 |
| 484 | Ga0501041_0007029 | 3300049577 | Bacteria | 6606 |
| 485 | Ga0501042_0000034 | 3300049578 | Bacteria | 43770 |
| 486 | Ga0501042_0035858 | 3300049578 | Bacteria | 3519 |
| 487 | Ga0501042_0109064 | 3300049578 | Bacteria | 1993 |
| 488 | Ga0501043_0000085 | 3300049579 | Bacteria | 83544 |
| 489 | Ga0501043_0014894 | 3300049579 | Bacteria | 6087 |
| 490 | Ga0501043_0082269 | 3300049579 | Bacteria | 2530 |
| 491 | Ga0501043_0225163 | 3300049579 | Bacteria | 1450 |
| 492 | Ga0501046_0000267 | 3300049580 | Bacteria | 53185 |
| 493 | Ga0501046_0003985 | 3300049580 | Bacteria | 13484 |
| 494 | Ga0501046_0010908 | 3300049580 | Bacteria | 7787 |
| 495 | Ga0501047_0001785 | 3300049581 | Bacteria | 20809 |
| 496 | Ga0501047_0022832 | 3300049581 | Bacteria | 6006 |
| 497 | Ga0501047_0095373 | 3300049581 | Bacteria | 2854 |
| 498 | Ga0501047_0119727 | 3300049581 | Bacteria | 2515 |
| 499 | Ga0501048_0000396 | 3300049582 | Bacteria | 30302 |
| 500 | Ga0501048_0012524 | 3300049582 | Bacteria | 6311 |
| 501 | Ga0501067_0000104 | 3300049583 | Bacteria | 48290 |
| 502 | Ga0501067_0199421 | 3300049583 | Bacteria | 1115 |
| 503 | Ga0501068_0004084 | 3300049584 | Bacteria | 7922 |
| 504 | Ga0501069_0005888 | 3300049585 | Bacteria | 6388 |
| 505 | Ga0501070_0002230 | 3300049586 | Bacteria | 17026 |
| 506 | Ga0501070_0027438 | 3300049586 | Bacteria | 4777 |
| 507 | Ga0501070_0038371 | 3300049586 | Bacteria | 3996 |
| 508 | Ga0501070_0071191 | 3300049586 | Bacteria | 2879 |
| 509 | Ga0501070_0089536 | 3300049586 | Bacteria | 2547 |
| 510 | Ga0501071_0000148 | 3300049587 | Bacteria | 29373 |
| 511 | Ga0501071_0118156 | 3300049587 | Bacteria | 1964 |
| 512 | Ga0501072_0002177 | 3300049588 | Bacteria | 14632 |
| 513 | Ga0501072_0002565 | 3300049588 | Bacteria | 13617 |
| 514 | Ga0501073_0000221 | 3300049589 | Bacteria | 37338 |
| 515 | Ga0501073_0068404 | 3300049589 | Bacteria | 2475 |
| 516 | Ga0501074_0001821 | 3300049590 | Bacteria | 14590 |
| 517 | Ga0501074_0039892 | 3300049590 | Bacteria | 3400 |
| 518 | Ga0501075_0003982 | 3300049591 | Bacteria | 9965 |
| 519 | Ga0501076_0007933 | 3300049592 | Bacteria | 7744 |
| 520 | Ga0501077_0000051 | 3300049593 | Bacteria | 61179 |
| 521 | Ga0501223_000049 | 3300049663 | Bacteria | 40988 |
| 522 | Ga0501224_000007 | 3300049664 | Bacteria | 127654 |
| 523 | Ga0501225_0000055 | 3300049705 | Bacteria | 38821 |
| 524 | Ga0501234_000426 | 3300049707 | Bacteria | 6297 |
| 525 | Ga0501079_0011518 | 3300049741 | Bacteria | 6750 |
| 526 | Ga0501080_0011359 | 3300049742 | Bacteria | 8154 |
| 527 | Ga0501080_0014641 | 3300049742 | Bacteria | 7224 |
| 528 | Ga0501080_0015912 | 3300049742 | Bacteria | 6938 |
| 529 | Ga0501081_0007633 | 3300049743 | Bacteria | 7015 |
| 530 | Ga0501083_0008249 | 3300049744 | Bacteria | 7364 |
| 531 | Ga0501083_0033735 | 3300049744 | Bacteria | 3503 |
| 532 | Ga0501035_0004322 | 3300049822 | Bacteria | 13496 |
| 533 | Ga0501035_0024781 | 3300049822 | Bacteria | 5500 |
| 534 | Ga0501044_0000369 | 3300049823 | Bacteria | 56363 |
| 535 | Ga0501044_0005606 | 3300049823 | Bacteria | 13943 |
| 536 | Ga0501045_0060453 | 3300049824 | Bacteria | 2778 |
| 537 | Ga0501226_000025 | 3300049853 | Bacteria | 91197 |
| 538 | nmdc:mga03683_29380_c1 | 3300050489 | Bacteria | 2192 |
| 539 | nmdc:mga00v17_2236_c1 | 3300050491 | Bacteria | 9924 |
| 540 | nmdc:mga0yw44_40083_c1 | 3300050492 | Bacteria | 2781 |
| 541 | nmdc:mga0yw44_46201_c1 | 3300050492 | Bacteria | 2614 |
| 542 | nmdc:mga0k408_119692_c1 | 3300050493 | Bacteria | 1559 |
| 543 | nmdc:mga06z11_136424_c1 | 3300050494 | Bacteria | 1383 |
| 544 | nmdc:mga04h51_22348_c1 | 3300050495 | Bacteria | 1913 |
| 545 | nmdc:mga04h51_32183_c1 | 3300050495 | Bacteria | 1662 |
| 546 | nmdc:mga07m45_2407_c1 | 3300050496 | Bacteria | 8775 |
| 547 | nmdc:mga07m45_34554_c1 | 3300050496 | Bacteria | 2810 |
| 548 | nmdc:mga07m45_9552_c1 | 3300050496 | Bacteria | 5036 |
| 549 | nmdc:mga05p37_113678_c1 | 3300050507 | Bacteria | 3329 |
| 550 | nmdc:mga05p37_337000_c1 | 3300050507 | Bacteria | 1779 |
| 551 | nmdc:mga05p37_496154_c1 | 3300050507 | Bacteria | 1403 |
| 552 | nmdc:mga05p37_55038_c1 | 3300050507 | Bacteria | 4895 |
| 553 | nmdc:mga06r32_72756_c1 | 3300050510 | Bacteria | 3328 |
| 554 | nmdc:mga08y16_32074_c1 | 3300050511 | Bacteria | 5524 |
| 555 | nmdc:mga08y16_7589_c1 | 3300050511 | Bacteria | 11355 |
| 556 | nmdc:mga0n895_58539_c1 | 3300050512 | Bacteria | 3799 |
| 557 | nmdc:mga0rr50_42431_c1 | 3300050513 | Bacteria | 3322 |
| 558 | nmdc:mga0rr50_60283_c1 | 3300050513 | Bacteria | 2854 |
| 559 | nmdc:mga08x19_158463_c1 | 3300050514 | Bacteria | 1536 |
| 560 | nmdc:mga0a205_173829_c1 | 3300050515 | Bacteria | 2050 |
| 561 | Ga0495601_0007195 | 3300053077 | Bacteria | 6529 |
| 562 | Ga0495595_0000497 | 3300053084 | Bacteria | 15033 |
| 563 | Ga0495619_0018781 | 3300053085 | Bacteria | 4388 |
| 564 | Ga0495619_0046007 | 3300053085 | Bacteria | 2868 |
| 565 | Ga0500643_010958 | 3300053087 | Bacteria | 3342 |
| 566 | Ga0500641_0001088 | 3300053096 | Bacteria | 9669 |
| 567 | Ga0500654_097784 | 3300053099 | Bacteria | 1269 |
| 568 | Ga0500568_0014921 | 3300053139 | Bacteria | 3491 |
| 569 | Ga0500573_0062449 | 3300053140 | Bacteria | 2133 |
| 570 | Ga0500616_0000399 | 3300053153 | Bacteria | 59548 |
| 571 | Ga0500622_0049136 | 3300053156 | Bacteria | 2175 |
| 572 | Ga0501084_0000798 | 3300054114 | Bacteria | 24109 |
| 573 | Ga0501084_0040995 | 3300054114 | Bacteria | 3873 |
| 574 | Ga0501082_0012174 | 3300060353 | Bacteria | 7390 |
| 575 | Ga0501082_0016777 | 3300060353 | Bacteria | 6306 |
| 576 | Ga0530510_0001331 | 3300061734 | Bacteria | 16535 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_0425337 | Ga0496102_0425337_344_1171 | 245 |
| 2 | 3300048927 | Ga0496124_0064381 | Ga0496124_0064381_271_1092 | 245 |
| 3 | 3300048907 | Ga0496104_0490673 | Ga0496104_0490673_16_855 | 252 |
| 4 | 3300048908 | Ga0496105_0045435 | Ga0496105_0045435_16_855 | 252 |
| 5 | 3300046689 | Ga0495613_0146298 | Ga0495613_0146298_21_872 | 256 |
| 6 | 3300048920 | Ga0496117_0277947 | Ga0496117_0277947_24_887 | 258 |
| 7 | 3300047322 | Ga0495680_0240942 | Ga0495680_0240942_13_867 | 259 |
| 8 | 3300035118 | Ga0373954_0130253 | Ga0373954_0130253_347_1213 | 263 |
| 9 | 3300009176 | Ga0105242_10466405 | Ga0105242_104664052 | 287 |
| 10 | 3300013250 | Ga0171462_1006 | Ga0171462_1006243 | 287 |
| 11 | 3300028786 | Ga0307517_10000035 | Ga0307517_1000003517 | 289 |
| 12 | 3300031344 | Ga0265316_10034824 | Ga0265316_100348243 | 289 |
| 13 | 3300035114 | Ga0373939_0047016 | Ga0373939_0047016_11_970 | 289 |
| 14 | 3300031711 | Ga0265314_10022120 | Ga0265314_100221202 | 290 |
| 15 | 3300044694 | Ga0466963_0081796 | Ga0466963_0081796_43_1053 | 290 |
| 16 | 3300009094 | Ga0111539_10446066 | Ga0111539_104460662 | 292 |
| 17 | 3300009177 | Ga0105248_10154603 | Ga0105248_101546032 | 292 |
| 18 | 3300025941 | Ga0207711_10167976 | Ga0207711_101679762 | 292 |
| 19 | 3300046471 | Ga0495650_0005584 | Ga0495650_0005584_2020_3033 | 292 |
| 20 | 3300025923 | Ga0207681_10242611 | Ga0207681_102426111 | 294 |
| 21 | 3300025916 | Ga0207663_10147379 | Ga0207663_101473792 | 296 |
| 22 | 3300009177 | Ga0105248_10045931 | Ga0105248_100459312 | 297 |
| 23 | 3300025941 | Ga0207711_10002701 | Ga0207711_100027018 | 297 |
| 24 | 3300035172 | Ga0373955_0083145 | Ga0373955_0083145_223_1263 | 297 |
| 25 | 3300036401 | Ga0373937_0152984 | Ga0373937_0152984_910_1950 | 297 |
| 26 | 3300046454 | Ga0495592_0042004 | Ga0495592_0042004_669_1709 | 297 |
| 27 | 3300046455 | Ga0495603_0155076 | Ga0495603_0155076_127_1167 | 297 |
| 28 | 3300046475 | Ga0495639_0014171 | Ga0495639_0014171_1381_2469 | 297 |
| 29 | 3300046477 | Ga0495664_0003650 | Ga0495664_0003650_544_1632 | 297 |
| 30 | 3300046511 | Ga0495608_0027602 | Ga0495608_0027602_49_1077 | 297 |
| 31 | 3300046514 | Ga0495618_0018884 | Ga0495618_0018884_1725_2813 | 297 |
| 32 | 3300046642 | Ga0495634_0026684 | Ga0495634_0026684_1725_2813 | 297 |
| 33 | 3300046663 | Ga0495635_0154424 | Ga0495635_0154424_161_1201 | 297 |
| 34 | 3300046683 | Ga0495658_0014372 | Ga0495658_0014372_827_1915 | 297 |
| 35 | 3300047322 | Ga0495680_0032946 | Ga0495680_0032946_1326_2414 | 297 |
| 36 | 3300048921 | Ga0496118_0005078 | Ga0496118_0005078_9739_10722 | 297 |
| 37 | 3300048922 | Ga0496119_0017505 | Ga0496119_0017505_457_1440 | 297 |
| 38 | 3300048924 | Ga0496121_0000334 | Ga0496121_0000334_89075_90058 | 297 |
| 39 | 3300053084 | Ga0495595_0000497 | Ga0495595_0000497_316_1356 | 297 |
| 40 | 3300053085 | Ga0495619_0018781 | Ga0495619_0018781_1113_2201 | 297 |
| 41 | 3300005439 | Ga0070711_100277695 | Ga0070711_1002776952 | 298 |
| 42 | 3300005458 | Ga0070681_10004669 | Ga0070681_100046694 | 300 |
| 43 | 3300025912 | Ga0207707_10003376 | Ga0207707_100033764 | 300 |
| 44 | 3300044694 | Ga0466963_0038754 | Ga0466963_0038754_28_1005 | 300 |
| 45 | 3300046539 | Ga0495621_0038727 | Ga0495621_0038727_675_1652 | 301 |
| 46 | 3300049574 | Ga0501038_0191967 | Ga0501038_0191967_611_1603 | 301 |
| 47 | 3300053099 | Ga0500654_097784 | Ga0500654_097784_252_1229 | 301 |
| 48 | iso_pu_bacteria | 2510917021 | 2511129637 | 302 |
| 49 | iso_pu_bacteria | 8054302542 | 8054305655 | 302 |
| 50 | iso_pu_bacteria | 2513237101 | 2513694144 | 303 |
| 51 | 3300005339 | Ga0070660_100237172 | Ga0070660_1002371721 | 304 |
| 52 | 3300005535 | Ga0070684_100156444 | Ga0070684_1001564442 | 304 |
| 53 | 3300005546 | Ga0070696_100098774 | Ga0070696_1000987742 | 304 |
| 54 | 3300006353 | Ga0075370_10110381 | Ga0075370_101103812 | 304 |
| 55 | 3300006871 | Ga0075434_100224360 | Ga0075434_1002243603 | 304 |
| 56 | 3300009093 | Ga0105240_10583655 | Ga0105240_105836551 | 304 |
| 57 | 3300009094 | Ga0111539_10035614 | Ga0111539_100356145 | 304 |
| 58 | 3300014325 | Ga0163163_10100935 | Ga0163163_101009353 | 304 |
| 59 | 3300025919 | Ga0207657_10160494 | Ga0207657_101604941 | 304 |
| 60 | 3300035171 | Ga0373946_0118887 | Ga0373946_0118887_86_1090 | 304 |
| 61 | 3300036401 | Ga0373937_0090031 | Ga0373937_0090031_630_1625 | 304 |
| 62 | 3300036401 | Ga0373937_0235397 | Ga0373937_0235397_678_1673 | 304 |
| 63 | 3300037068 | Ga0373925_0152124 | Ga0373925_0152124_512_1507 | 304 |
| 64 | 3300037068 | Ga0373925_0184619 | Ga0373925_0184619_104_1108 | 304 |
| 65 | 3300037853 | Ga0436364_0087625 | Ga0436364_0087625_739_1740 | 304 |
| 66 | 3300039453 | Ga0436362_1099131 | Ga0436362_1099131_237_1232 | 304 |
| 67 | 3300044656 | Ga0466969_0000478 | Ga0466969_0000478_3412_4446 | 304 |
| 68 | 3300044684 | Ga0466966_0011428 | Ga0466966_0011428_2963_3997 | 304 |
| 69 | 3300045049 | Ga0466959_0040108 | Ga0466959_0040108_1683_2717 | 304 |
| 70 | 3300046473 | Ga0495582_0060992 | Ga0495582_0060992_306_1304 | 304 |
| 71 | 3300046511 | Ga0495608_0006495 | Ga0495608_0006495_3773_4771 | 304 |
| 72 | 3300046511 | Ga0495608_0188315 | Ga0495608_0188315_59_1054 | 304 |
| 73 | 3300046514 | Ga0495618_0011158 | Ga0495618_0011158_866_1864 | 304 |
| 74 | 3300046516 | Ga0495628_0025793 | Ga0495628_0025793_387_1385 | 304 |
| 75 | 3300046517 | Ga0495630_0001124 | Ga0495630_0001124_13792_14790 | 304 |
| 76 | 3300046517 | Ga0495630_0032177 | Ga0495630_0032177_1077_2072 | 304 |
| 77 | 3300046529 | Ga0495652_0077373 | Ga0495652_0077373_454_1452 | 304 |
| 78 | 3300046529 | Ga0495652_0154581 | Ga0495652_0154581_233_1228 | 304 |
| 79 | 3300046533 | Ga0495640_0001398 | Ga0495640_0001398_10597_11595 | 304 |
| 80 | 3300046533 | Ga0495640_0027750 | Ga0495640_0027750_737_1732 | 304 |
| 81 | 3300046535 | Ga0495586_0015399 | Ga0495586_0015399_2121_3116 | 304 |
| 82 | 3300046535 | Ga0495586_0031920 | Ga0495586_0031920_539_1537 | 304 |
| 83 | 3300046559 | Ga0495667_0047026 | Ga0495667_0047026_1298_2296 | 304 |
| 84 | 3300046642 | Ga0495634_0004109 | Ga0495634_0004109_3433_4431 | 304 |
| 85 | 3300046678 | Ga0495599_0005443 | Ga0495599_0005443_2992_3990 | 304 |
| 86 | 3300046678 | Ga0495599_0176299 | Ga0495599_0176299_60_1055 | 304 |
| 87 | 3300046681 | Ga0495647_0085245 | Ga0495647_0085245_255_1253 | 304 |
| 88 | 3300046683 | Ga0495658_0045239 | Ga0495658_0045239_1250_2248 | 304 |
| 89 | 3300046809 | Ga0495600_0008961 | Ga0495600_0008961_3525_4523 | 304 |
| 90 | 3300047315 | Ga0495581_0155139 | Ga0495581_0155139_136_1140 | 304 |
| 91 | 3300047317 | Ga0495604_0001361 | Ga0495604_0001361_7268_8266 | 304 |
| 92 | 3300047318 | Ga0495636_0012336 | Ga0495636_0012336_1316_2314 | 304 |
| 93 | 3300047319 | Ga0495674_0212675 | Ga0495674_0212675_272_1270 | 304 |
| 94 | 3300047321 | Ga0495676_0163613 | Ga0495676_0163613_58_1062 | 304 |
| 95 | 3300047322 | Ga0495680_0014826 | Ga0495680_0014826_5537_6535 | 304 |
| 96 | 3300048903 | Ga0496100_0042503 | Ga0496100_0042503_1492_2496 | 304 |
| 97 | 3300048905 | Ga0496102_0140430 | Ga0496102_0140430_974_1978 | 304 |
| 98 | 3300048907 | Ga0496104_0000303 | Ga0496104_0000303_2790_3794 | 304 |
| 99 | 3300048907 | Ga0496104_0026767 | Ga0496104_0026767_3536_4540 | 304 |
| 100 | 3300048908 | Ga0496105_0000975 | Ga0496105_0000975_2790_3794 | 304 |
| 101 | 3300048908 | Ga0496105_0008362 | Ga0496105_0008362_5503_6507 | 304 |
| 102 | 3300048911 | Ga0496108_0092653 | Ga0496108_0092653_1062_2066 | 304 |
| 103 | 3300048914 | Ga0496111_0018369 | Ga0496111_0018369_1808_2812 | 304 |
| 104 | 3300048915 | Ga0496112_0005559 | Ga0496112_0005559_9083_10087 | 304 |
| 105 | 3300048915 | Ga0496112_0054758 | Ga0496112_0054758_1050_2054 | 304 |
| 106 | 3300048916 | Ga0496113_0044397 | Ga0496113_0044397_1696_2700 | 304 |
| 107 | 3300048916 | Ga0496113_0120508 | Ga0496113_0120508_182_1186 | 304 |
| 108 | 3300048917 | Ga0496114_0366390 | Ga0496114_0366390_178_1182 | 304 |
| 109 | 3300048918 | Ga0496115_0165963 | Ga0496115_0165963_511_1509 | 304 |
| 110 | 3300048928 | Ga0496125_0167269 | Ga0496125_0167269_457_1461 | 304 |
| 111 | 3300048929 | Ga0496126_0091268 | Ga0496126_0091268_892_1887 | 304 |
| 112 | 3300050496 | nmdc:mga07m45_34554_c1 | nmdc:mga07m45_34554_c1_1404_2438 | 304 |
| 113 | 3300050511 | nmdc:mga08y16_7589_c1 | nmdc:mga08y16_7589_c1_4440_5435 | 304 |
| 114 | 3300050513 | nmdc:mga0rr50_42431_c1 | nmdc:mga0rr50_42431_c1_220_1218 | 304 |
| 115 | 3300053077 | Ga0495601_0007195 | Ga0495601_0007195_3461_4459 | 304 |
| 116 | 3300035695 | Ga0373927_0259415 | Ga0373927_0259415_72_1073 | 305 |
| 117 | 3300039450 | Ga0436363_1577385 | Ga0436363_1577385_19_1020 | 305 |
| 118 | 3300005295 | Ga0065707_10083819 | Ga0065707_100838194 | 306 |
| 119 | 3300005843 | Ga0068860_100059127 | Ga0068860_1000591272 | 306 |
| 120 | 3300031456 | Ga0307513_10131756 | Ga0307513_101317562 | 306 |
| 121 | 3300031911 | Ga0307412_10005336 | Ga0307412_100053364 | 306 |
| 122 | 3300032004 | Ga0307414_10001811 | Ga0307414_100018113 | 306 |
| 123 | 3300032004 | Ga0307414_10009988 | Ga0307414_100099885 | 306 |
| 124 | 3300046471 | Ga0495650_0002022 | Ga0495650_0002022_14816_15871 | 306 |
| 125 | 3300046500 | Ga0495596_0000074 | Ga0495596_0000074_49337_50392 | 306 |
| 126 | 3300046501 | Ga0495607_0035152 | Ga0495607_0035152_761_1816 | 306 |
| 127 | 3300046512 | Ga0495610_0000390 | Ga0495610_0000390_2919_3974 | 306 |
| 128 | 3300046522 | Ga0495643_0000945 | Ga0495643_0000945_11298_12353 | 306 |
| 129 | 3300046522 | Ga0495643_0006293 | Ga0495643_0006293_2909_3964 | 306 |
| 130 | 3300046538 | Ga0495609_0001395 | Ga0495609_0001395_5894_6949 | 306 |
| 131 | 3300046692 | Ga0495671_0068964 | Ga0495671_0068964_632_1687 | 306 |
| 132 | 3300049663 | Ga0501223_000049 | Ga0501223_000049_33949_34980 | 306 |
| 133 | 3300049664 | Ga0501224_000007 | Ga0501224_000007_6189_7220 | 306 |
| 134 | 3300049705 | Ga0501225_0000055 | Ga0501225_0000055_31689_32720 | 306 |
| 135 | 3300049707 | Ga0501234_000426 | Ga0501234_000426_4517_5548 | 306 |
| 136 | 3300049853 | Ga0501226_000025 | Ga0501226_000025_83972_85003 | 306 |
| 137 | 3300006051 | Ga0075364_10262087 | Ga0075364_102620871 | 307 |
| 138 | iso_pu_bacteria | 2937877337 | 2937884875 | 307 |
| 139 | iso_pu_bacteria | 2958084443 | 2958092184 | 307 |
| 140 | 3300033180 | Ga0307510_10010315 | Ga0307510_100103153 | 308 |
| 141 | iso_pu_bacteria | 2508501050 | 2508728767 | 308 |
| 142 | iso_pu_bacteria | 2643221734 | 2644736663 | 308 |
| 143 | iso_pu_bacteria | 2818991467 | 2819719302 | 308 |
| 144 | iso_pu_bacteria | 2883291878 | 2883292355 | 308 |
| 145 | iso_pu_bacteria | 2891968417 | 2891973625 | 308 |
| 146 | iso_pu_bacteria | 2915650412 | 2915651852 | 308 |
| 147 | 3300006195 | Ga0075366_10124963 | Ga0075366_101249632 | 309 |
| 148 | 3300006946 | Ga0079104_1008499 | Ga0079104_10084993 | 309 |
| 149 | 3300009176 | Ga0105242_10245130 | Ga0105242_102451302 | 309 |
| 150 | 3300013306 | Ga0163162_10110991 | Ga0163162_101109913 | 309 |
| 151 | 3300013307 | Ga0157372_10132090 | Ga0157372_101320902 | 309 |
| 152 | 3300025927 | Ga0207687_10263533 | Ga0207687_102635332 | 309 |
| 153 | 3300048903 | Ga0496100_0347824 | Ga0496100_0347824_29_1030 | 309 |
| 154 | 3300048904 | Ga0496101_0155050 | Ga0496101_0155050_426_1454 | 309 |
| 155 | 3300048904 | Ga0496101_0227163 | Ga0496101_0227163_164_1165 | 309 |
| 156 | 3300048907 | Ga0496104_0074509 | Ga0496104_0074509_613_1617 | 309 |
| 157 | 3300048914 | Ga0496111_0037939 | Ga0496111_0037939_2154_3182 | 309 |
| 158 | 3300048915 | Ga0496112_0047790 | Ga0496112_0047790_1319_2320 | 309 |
| 159 | 3300048915 | Ga0496112_0335928 | Ga0496112_0335928_287_1288 | 309 |
| 160 | 3300048916 | Ga0496113_0324883 | Ga0496113_0324883_77_1078 | 309 |
| 161 | 3300050493 | nmdc:mga0k408_119692_c1 | nmdc:mga0k408_119692_c1_152_1186 | 309 |
| 162 | 3300053087 | Ga0500643_010958 | Ga0500643_010958_2235_3269 | 309 |
| 163 | 3300053156 | Ga0500622_0049136 | Ga0500622_0049136_885_1919 | 309 |
| 164 | iso_pu_bacteria | 2545555834 | 2545679316 | 309 |
| 165 | iso_pu_bacteria | 2599185156 | 2599332316 | 309 |
| 166 | iso_pu_bacteria | 2643221561 | 2643823616 | 309 |
| 167 | iso_pu_bacteria | 2643221696 | 2644535297 | 309 |
| 168 | iso_pu_bacteria | 2738543031 | 2739347729 | 309 |
| 169 | iso_pu_bacteria | 2739367898 | 2740166199 | 309 |
| 170 | iso_pu_bacteria | 2773857762 | 2774395266 | 309 |
| 171 | iso_pu_bacteria | 2808606439 | 2809193900 | 309 |
| 172 | iso_pu_bacteria | 2811994878 | 2812348640 | 309 |
| 173 | iso_pu_bacteria | 2842922631 | 2842924673 | 309 |
| 174 | iso_pu_bacteria | 2857542790 | 2857544213 | 309 |
| 175 | iso_pu_bacteria | 2857576091 | 2857579771 | 309 |
| 176 | iso_pu_bacteria | 2945961074 | 2945963094 | 309 |
| 177 | iso_pu_bacteria | 2974315732 | 2974318231 | 309 |
| 178 | iso_pu_bacteria | 2984523437 | 2984526443 | 309 |
| 179 | iso_pu_bacteria | 3003665799 | 3003667584 | 309 |
| 180 | iso_pu_bacteria | 641522639 | 641644595 | 309 |
| 181 | iso_pu_bacteria | 643348564 | 643602827 | 309 |
| 182 | 3300005618 | Ga0068864_100196970 | Ga0068864_1001969702 | 310 |
| 183 | 3300014325 | Ga0163163_10131690 | Ga0163163_101316902 | 310 |
| 184 | 3300033180 | Ga0307510_10017848 | Ga0307510_100178486 | 310 |
| 185 | 3300037418 | Ga0395900_0343274 | Ga0395900_0343274_363_1367 | 310 |
| 186 | 3300037466 | Ga0395898_0064590 | Ga0395898_0064590_852_1856 | 310 |
| 187 | 3300038443 | Ga0395901_0004498 | Ga0395901_0004498_5580_6584 | 310 |
| 188 | 3300044901 | Ga0466960_0079913 | Ga0466960_0079913_93_1103 | 310 |
| 189 | 3300046511 | Ga0495608_0199364 | Ga0495608_0199364_60_1070 | 310 |
| 190 | 3300046642 | Ga0495634_0038587 | Ga0495634_0038587_610_1620 | 310 |
| 191 | 3300048912 | Ga0496109_0396048 | Ga0496109_0396048_39_1046 | 310 |
| 192 | 3300048915 | Ga0496112_0022841 | Ga0496112_0022841_3831_4838 | 310 |
| 193 | iso_pu_bacteria | 2599185292 | 2599903753 | 310 |
| 194 | iso_pu_bacteria | 2643221569 | 2643860261 | 310 |
| 195 | iso_pu_bacteria | 2643221594 | 2643979517 | 310 |
| 196 | iso_pu_bacteria | 2643221621 | 2644120022 | 310 |
| 197 | iso_pu_bacteria | 2738541281 | 2738746249 | 310 |
| 198 | iso_pu_bacteria | 2738543032 | 2739355479 | 310 |
| 199 | iso_pu_bacteria | 2751185725 | 2753039507 | 310 |
| 200 | iso_pu_bacteria | 2751185792 | 2753327870 | 310 |
| 201 | iso_pu_bacteria | 2808606395 | 2809035788 | 310 |
| 202 | iso_pu_bacteria | 2829745981 | 2829747798 | 310 |
| 203 | iso_pu_bacteria | 2842698319 | 2842701651 | 310 |
| 204 | iso_pu_bacteria | 2857537821 | 2857538944 | 310 |
| 205 | iso_pu_bacteria | 2857710386 | 2857712688 | 310 |
| 206 | iso_pu_bacteria | 2902330777 | 2902335581 | 310 |
| 207 | iso_pu_bacteria | 2941479691 | 2941485524 | 310 |
| 208 | 3300005344 | Ga0070661_100052294 | Ga0070661_1000522942 | 311 |
| 209 | 3300005435 | Ga0070714_100172330 | Ga0070714_1001723301 | 311 |
| 210 | 3300005436 | Ga0070713_100066589 | Ga0070713_1000665892 | 311 |
| 211 | 3300005455 | Ga0070663_100018495 | Ga0070663_1000184953 | 311 |
| 212 | 3300005535 | Ga0070684_100021383 | Ga0070684_1000213834 | 311 |
| 213 | 3300005564 | Ga0070664_100261595 | Ga0070664_1002615952 | 311 |
| 214 | 3300005577 | Ga0068857_100144650 | Ga0068857_1001446502 | 311 |
| 215 | 3300005937 | Ga0081455_10005973 | Ga0081455_1000597313 | 311 |
| 216 | 3300007788 | Ga0099795_10025670 | Ga0099795_100256701 | 311 |
| 217 | 3300013105 | Ga0157369_10168036 | Ga0157369_101680362 | 311 |
| 218 | 3300025920 | Ga0207649_10033501 | Ga0207649_100335012 | 311 |
| 219 | 3300025944 | Ga0207661_10101242 | Ga0207661_101012422 | 311 |
| 220 | 3300026067 | Ga0207678_10007840 | Ga0207678_1000784010 | 311 |
| 221 | 3300026116 | Ga0207674_10058309 | Ga0207674_100583094 | 311 |
| 222 | 3300027512 | Ga0209179_1002295 | Ga0209179_10022951 | 311 |
| 223 | 3300048929 | Ga0496126_0012581 | Ga0496126_0012581_4988_6037 | 311 |
| 224 | 3300053153 | Ga0500616_0000399 | Ga0500616_0000399_29217_30233 | 311 |
| 225 | iso_pu_bacteria | 2582581307 | 2585274750 | 311 |
| 226 | iso_pu_bacteria | 2585427531 | 2585562116 | 311 |
| 227 | iso_pu_bacteria | 2595698237 | 2596372728 | 311 |
| 228 | iso_pu_bacteria | 2643221651 | 2644288846 | 311 |
| 229 | iso_pu_bacteria | 2744054900 | 2746090086 | 311 |
| 230 | iso_pu_bacteria | 2744054901 | 2746095526 | 311 |
| 231 | iso_pu_bacteria | 2902405164 | 2902410857 | 311 |
| 232 | iso_pu_bacteria | 2928125067 | 2928127478 | 311 |
| 233 | 3300003187 | JGI25151J46595_10000191 | JGI25151J46595_1000019144 | 312 |
| 234 | 3300003771 | Ga0055526_1000471 | Ga0055526_100047114 | 312 |
| 235 | 3300003771 | Ga0055526_1001260 | Ga0055526_100126011 | 312 |
| 236 | 3300003775 | Ga0055524_1000068 | Ga0055524_100006856 | 312 |
| 237 | 3300003775 | Ga0055524_1010677 | Ga0055524_10106773 | 312 |
| 238 | 3300005329 | Ga0070683_100076231 | Ga0070683_1000762312 | 312 |
| 239 | 3300005330 | Ga0070690_100090767 | Ga0070690_1000907672 | 312 |
| 240 | 3300005339 | Ga0070660_100084493 | Ga0070660_1000844932 | 312 |
| 241 | 3300005340 | Ga0070689_100007342 | Ga0070689_1000073423 | 312 |
| 242 | 3300005341 | Ga0070691_10037616 | Ga0070691_100376162 | 312 |
| 243 | 3300005345 | Ga0070692_10089884 | Ga0070692_100898843 | 312 |
| 244 | 3300005435 | Ga0070714_100315026 | Ga0070714_1003150262 | 312 |
| 245 | 3300005441 | Ga0070700_100003113 | Ga0070700_1000031132 | 312 |
| 246 | 3300005455 | Ga0070663_100079007 | Ga0070663_1000790072 | 312 |
| 247 | 3300005535 | Ga0070684_100060829 | Ga0070684_1000608293 | 312 |
| 248 | 3300005535 | Ga0070684_100249984 | Ga0070684_1002499842 | 312 |
| 249 | 3300005547 | Ga0070693_100124470 | Ga0070693_1001244702 | 312 |
| 250 | 3300005614 | Ga0068856_100359013 | Ga0068856_1003590132 | 312 |
| 251 | 3300005615 | Ga0070702_100030356 | Ga0070702_1000303563 | 312 |
| 252 | 3300005840 | Ga0068870_10022375 | Ga0068870_100223753 | 312 |
| 253 | 3300005981 | Ga0081538_10040369 | Ga0081538_100403692 | 312 |
| 254 | 3300006038 | Ga0075365_10202302 | Ga0075365_102023022 | 312 |
| 255 | 3300006042 | Ga0075368_10009941 | Ga0075368_100099411 | 312 |
| 256 | 3300006175 | Ga0070712_100127875 | Ga0070712_1001278753 | 312 |
| 257 | 3300006178 | Ga0075367_10042424 | Ga0075367_100424242 | 312 |
| 258 | 3300007788 | Ga0099795_10012781 | Ga0099795_100127813 | 312 |
| 259 | 3300009094 | Ga0111539_10013527 | Ga0111539_100135272 | 312 |
| 260 | 3300009098 | Ga0105245_10017929 | Ga0105245_100179292 | 312 |
| 261 | 3300009177 | Ga0105248_10377458 | Ga0105248_103774582 | 312 |
| 262 | 3300009551 | Ga0105238_10109873 | Ga0105238_101098733 | 312 |
| 263 | 3300010159 | Ga0099796_10025801 | Ga0099796_100258013 | 312 |
| 264 | 3300013104 | Ga0157370_10039429 | Ga0157370_100394292 | 312 |
| 265 | 3300013105 | Ga0157369_10019075 | Ga0157369_100190752 | 312 |
| 266 | 3300014326 | Ga0157380_10050440 | Ga0157380_100504403 | 312 |
| 267 | 3300014745 | Ga0157377_10200270 | Ga0157377_102002701 | 312 |
| 268 | 3300020082 | Ga0206353_11413154 | Ga0206353_114131542 | 312 |
| 269 | 3300021388 | Ga0213875_10012022 | Ga0213875_100120222 | 312 |
| 270 | 3300025273 | Ga0209673_1038672 | Ga0209673_10386722 | 312 |
| 271 | 3300025291 | Ga0209675_1000566 | Ga0209675_100056622 | 312 |
| 272 | 3300025292 | Ga0209676_1034226 | Ga0209676_10342262 | 312 |
| 273 | 3300025294 | Ga0209025_1000008 | Ga0209025_1000008549 | 312 |
| 274 | 3300025295 | Ga0209564_1000041 | Ga0209564_1000041196 | 312 |
| 275 | 3300025295 | Ga0209564_1000065 | Ga0209564_1000065305 | 312 |
| 276 | 3300025299 | Ga0209256_1000014 | Ga0209256_100001456 | 312 |
| 277 | 3300025299 | Ga0209256_1000266 | Ga0209256_100026631 | 312 |
| 278 | 3300025908 | Ga0207643_10013851 | Ga0207643_100138514 | 312 |
| 279 | 3300025915 | Ga0207693_10025911 | Ga0207693_100259113 | 312 |
| 280 | 3300025918 | Ga0207662_10035256 | Ga0207662_100352562 | 312 |
| 281 | 3300025919 | Ga0207657_10023413 | Ga0207657_100234133 | 312 |
| 282 | 3300025927 | Ga0207687_10299806 | Ga0207687_102998062 | 312 |
| 283 | 3300025927 | Ga0207687_10313838 | Ga0207687_103138382 | 312 |
| 284 | 3300025928 | Ga0207700_10165296 | Ga0207700_101652961 | 312 |
| 285 | 3300025935 | Ga0207709_10032823 | Ga0207709_100328233 | 312 |
| 286 | 3300025938 | Ga0207704_10022201 | Ga0207704_100222012 | 312 |
| 287 | 3300025939 | Ga0207665_10116156 | Ga0207665_101161562 | 312 |
| 288 | 3300025940 | Ga0207691_10124765 | Ga0207691_101247652 | 312 |
| 289 | 3300025941 | Ga0207711_10188536 | Ga0207711_101885363 | 312 |
| 290 | 3300025945 | Ga0207679_10258980 | Ga0207679_102589802 | 312 |
| 291 | 3300026067 | Ga0207678_10041147 | Ga0207678_100411472 | 312 |
| 292 | 3300026075 | Ga0207708_10002132 | Ga0207708_100021323 | 312 |
| 293 | 3300026089 | Ga0207648_10005257 | Ga0207648_100052571 | 312 |
| 294 | 3300026118 | Ga0207675_100001223 | Ga0207675_1000012236 | 312 |
| 295 | 3300026142 | Ga0207698_10187818 | Ga0207698_101878182 | 312 |
| 296 | 3300037466 | Ga0395898_0114523 | Ga0395898_0114523_70_1086 | 312 |
| 297 | 3300037853 | Ga0436364_0645366 | Ga0436364_0645366_3531_4541 | 312 |
| 298 | 3300045976 | Ga0466967_0085180 | Ga0466967_0085180_1439_2482 | 312 |
| 299 | 3300048911 | Ga0496108_0263171 | Ga0496108_0263171_312_1328 | 312 |
| 300 | 3300048912 | Ga0496109_0037527 | Ga0496109_0037527_2757_3770 | 312 |
| 301 | 3300048917 | Ga0496114_0073072 | Ga0496114_0073072_1106_2119 | 312 |
| 302 | 3300048920 | Ga0496117_0057283 | Ga0496117_0057283_1203_2222 | 312 |
| 303 | 3300048925 | Ga0496122_0000137 | Ga0496122_0000137_142847_143872 | 312 |
| 304 | 3300048925 | Ga0496122_0016172 | Ga0496122_0016172_245_1264 | 312 |
| 305 | 3300048926 | Ga0496123_0000022 | Ga0496123_0000022_24668_25693 | 312 |
| 306 | 3300048926 | Ga0496123_0025051 | Ga0496123_0025051_1462_2481 | 312 |
| 307 | 3300050511 | nmdc:mga08y16_32074_c1 | nmdc:mga08y16_32074_c1_2127_3140 | 312 |
| 308 | 3300053140 | Ga0500573_0062449 | Ga0500573_0062449_56_1069 | 312 |
| 309 | iso_pu_bacteria | 2984592036 | 2984593008 | 312 |
| 310 | 3300003215 | JGI25153J46596_10000740 | JGI25153J46596_1000074013 | 313 |
| 311 | 3300003792 | Ga0055540_1002498 | Ga0055540_100249811 | 313 |
| 312 | 3300003794 | Ga0055531_10003985 | Ga0055531_1000398510 | 313 |
| 313 | 3300005548 | Ga0070665_100479020 | Ga0070665_1004790201 | 313 |
| 314 | 3300006028 | Ga0070717_10038580 | Ga0070717_100385803 | 313 |
| 315 | 3300006038 | Ga0075365_10012802 | Ga0075365_100128025 | 313 |
| 316 | 3300006038 | Ga0075365_10053157 | Ga0075365_100531573 | 313 |
| 317 | 3300006038 | Ga0075365_10059459 | Ga0075365_100594593 | 313 |
| 318 | 3300006048 | Ga0075363_100011915 | Ga0075363_1000119155 | 313 |
| 319 | 3300006051 | Ga0075364_10066553 | Ga0075364_100665533 | 313 |
| 320 | 3300006051 | Ga0075364_10133592 | Ga0075364_101335922 | 313 |
| 321 | 3300006173 | Ga0070716_100043621 | Ga0070716_1000436212 | 313 |
| 322 | 3300006177 | Ga0075362_10139880 | Ga0075362_101398801 | 313 |
| 323 | 3300006178 | Ga0075367_10063287 | Ga0075367_100632872 | 313 |
| 324 | 3300009011 | Ga0105251_10005643 | Ga0105251_100056435 | 313 |
| 325 | 3300013306 | Ga0163162_10074247 | Ga0163162_100742474 | 313 |
| 326 | 3300025297 | Ga0209758_1001968 | Ga0209758_100196813 | 313 |
| 327 | 3300025298 | Ga0209050_1016094 | Ga0209050_10160942 | 313 |
| 328 | 3300025303 | Ga0209051_1002484 | Ga0209051_10024843 | 313 |
| 329 | 3300025304 | Ga0209257_1000741 | Ga0209257_100074110 | 313 |
| 330 | 3300025735 | Ga0207713_1015185 | Ga0207713_10151853 | 313 |
| 331 | 3300025906 | Ga0207699_10028543 | Ga0207699_100285435 | 313 |
| 332 | 3300025916 | Ga0207663_10082847 | Ga0207663_100828472 | 313 |
| 333 | 3300027866 | Ga0209813_10037993 | Ga0209813_100379932 | 313 |
| 334 | 3300028381 | Ga0268264_10000398 | Ga0268264_1000039854 | 313 |
| 335 | 3300031251 | Ga0265327_10022512 | Ga0265327_100225122 | 313 |
| 336 | 3300031995 | Ga0307409_100183846 | Ga0307409_1001838462 | 313 |
| 337 | 3300037068 | Ga0373925_0000294 | Ga0373925_0000294_9383_10447 | 313 |
| 338 | 3300037418 | Ga0395900_0157643 | Ga0395900_0157643_715_1731 | 313 |
| 339 | 3300037853 | Ga0436364_0627056 | Ga0436364_0627056_968_1984 | 313 |
| 340 | 3300038443 | Ga0395901_0122084 | Ga0395901_0122084_530_1546 | 313 |
| 341 | 3300039438 | Ga0436360_1317574 | Ga0436360_1317574_210_1226 | 313 |
| 342 | 3300045976 | Ga0466967_0093540 | Ga0466967_0093540_269_1285 | 313 |
| 343 | 3300046501 | Ga0495607_0000048 | Ga0495607_0000048_34483_35502 | 313 |
| 344 | 3300046515 | Ga0495620_0000236 | Ga0495620_0000236_2769_3794 | 313 |
| 345 | 3300046559 | Ga0495667_0015548 | Ga0495667_0015548_2290_3318 | 313 |
| 346 | 3300046794 | Ga0495589_0000297 | Ga0495589_0000297_11209_12234 | 313 |
| 347 | 3300047323 | Ga0495683_0000527 | Ga0495683_0000527_4288_5304 | 313 |
| 348 | 3300047446 | Ga0495679_002910 | Ga0495679_002910_6482_7507 | 313 |
| 349 | 3300048913 | Ga0496110_0137598 | Ga0496110_0137598_843_1859 | 313 |
| 350 | 3300048922 | Ga0496119_0005330 | Ga0496119_0005330_8048_9073 | 313 |
| 351 | 3300048922 | Ga0496119_0028119 | Ga0496119_0028119_219_1247 | 313 |
| 352 | 3300048923 | Ga0496120_0001278 | Ga0496120_0001278_5583_6608 | 313 |
| 353 | 3300048923 | Ga0496120_0002868 | Ga0496120_0002868_15032_16060 | 313 |
| 354 | 3300048924 | Ga0496121_0022990 | Ga0496121_0022990_2926_3954 | 313 |
| 355 | 3300048924 | Ga0496121_0024299 | Ga0496121_0024299_801_1820 | 313 |
| 356 | 3300048927 | Ga0496124_0000007 | Ga0496124_0000007_508988_510007 | 313 |
| 357 | 3300048927 | Ga0496124_0000309 | Ga0496124_0000309_49700_50725 | 313 |
| 358 | 3300048928 | Ga0496125_0000459 | Ga0496125_0000459_39801_40826 | 313 |
| 359 | 3300050489 | nmdc:mga03683_29380_c1 | nmdc:mga03683_29380_c1_319_1338 | 313 |
| 360 | 3300050492 | nmdc:mga0yw44_40083_c1 | nmdc:mga0yw44_40083_c1_1555_2577 | 313 |
| 361 | 3300050492 | nmdc:mga0yw44_46201_c1 | nmdc:mga0yw44_46201_c1_1237_2256 | 313 |
| 362 | 3300050494 | nmdc:mga06z11_136424_c1 | nmdc:mga06z11_136424_c1_213_1232 | 313 |
| 363 | 3300050495 | nmdc:mga04h51_32183_c1 | nmdc:mga04h51_32183_c1_446_1465 | 313 |
| 364 | 3300050496 | nmdc:mga07m45_2407_c1 | nmdc:mga07m45_2407_c1_4260_5279 | 313 |
| 365 | 3300050496 | nmdc:mga07m45_9552_c1 | nmdc:mga07m45_9552_c1_2800_3816 | 313 |
| 366 | iso_pu_bacteria | 2643221681 | 2644455685 | 313 |
| 367 | iso_pu_bacteria | 2643221961 | 2645721091 | 313 |
| 368 | iso_pu_bacteria | 2643221962 | 2645724880 | 313 |
| 369 | iso_pu_bacteria | 2738543005 | 2739203931 | 313 |
| 370 | iso_pu_bacteria | 2738543011 | 2739238588 | 313 |
| 371 | iso_pu_bacteria | 2857542790 | 2857544112 | 313 |
| 372 | iso_pu_bacteria | 2889300758 | 2889303022 | 313 |
| 373 | iso_pu_bacteria | 2928142448 | 2928145662 | 313 |
| 374 | iso_pu_bacteria | 2939743619 | 2939746100 | 313 |
| 375 | 3300005329 | Ga0070683_100139344 | Ga0070683_1001393442 | 314 |
| 376 | 3300006051 | Ga0075364_10000803 | Ga0075364_1000080317 | 314 |
| 377 | 3300013102 | Ga0157371_10069363 | Ga0157371_100693632 | 314 |
| 378 | 3300025292 | Ga0209676_1020388 | Ga0209676_10203881 | 314 |
| 379 | 3300025303 | Ga0209051_1019007 | Ga0209051_10190073 | 314 |
| 380 | 3300027866 | Ga0209813_10003780 | Ga0209813_100037804 | 314 |
| 381 | 3300031903 | Ga0307407_10167875 | Ga0307407_101678752 | 314 |
| 382 | 3300031911 | Ga0307412_10000635 | Ga0307412_1000063510 | 314 |
| 383 | 3300044658 | Ga0466972_0048525 | Ga0466972_0048525_970_1989 | 314 |
| 384 | 3300044765 | Ga0466970_0006381 | Ga0466970_0006381_1794_2861 | 314 |
| 385 | 3300044765 | Ga0466970_0049019 | Ga0466970_0049019_468_1502 | 314 |
| 386 | 3300044842 | Ga0466957_0037795 | Ga0466957_0037795_302_1369 | 314 |
| 387 | 3300044901 | Ga0466960_0001467 | Ga0466960_0001467_5773_6792 | 314 |
| 388 | 3300044901 | Ga0466960_0038146 | Ga0466960_0038146_1218_2246 | 314 |
| 389 | 3300044901 | Ga0466960_0068880 | Ga0466960_0068880_279_1346 | 314 |
| 390 | 3300044901 | Ga0466960_0107939 | Ga0466960_0107939_246_1274 | 314 |
| 391 | 3300048917 | Ga0496114_0244667 | Ga0496114_0244667_158_1186 | 314 |
| 392 | 3300048922 | Ga0496119_0063365 | Ga0496119_0063365_259_1287 | 314 |
| 393 | 3300048928 | Ga0496125_0000146 | Ga0496125_0000146_25662_26690 | 314 |
| 394 | 3300048928 | Ga0496125_0134275 | Ga0496125_0134275_102_1130 | 314 |
| 395 | 3300048929 | Ga0496126_0102621 | Ga0496126_0102621_648_1676 | 314 |
| 396 | 3300049581 | Ga0501047_0022832 | Ga0501047_0022832_3790_4860 | 314 |
| 397 | 3300049583 | Ga0501067_0199421 | Ga0501067_0199421_74_1102 | 314 |
| 398 | 3300049822 | Ga0501035_0024781 | Ga0501035_0024781_148_1218 | 314 |
| 399 | 3300049823 | Ga0501044_0005606 | Ga0501044_0005606_8993_10063 | 314 |
| 400 | 3300050491 | nmdc:mga00v17_2236_c1 | nmdc:mga00v17_2236_c1_7984_9003 | 314 |
| 401 | 3300050495 | nmdc:mga04h51_22348_c1 | nmdc:mga04h51_22348_c1_166_1188 | 314 |
| 402 | 3300053096 | Ga0500641_0001088 | Ga0500641_0001088_6508_7536 | 314 |
| 403 | iso_pu_bacteria | 2551306166 | 2552111567 | 314 |
| 404 | iso_pu_bacteria | 2855767633 | 2855772002 | 314 |
| 405 | iso_pu_bacteria | 2881412998 | 2881416058 | 314 |
| 406 | 3300005436 | Ga0070713_100095026 | Ga0070713_1000950262 | 315 |
| 407 | 3300005467 | Ga0070706_100094425 | Ga0070706_1000944253 | 315 |
| 408 | 3300005471 | Ga0070698_100074437 | Ga0070698_1000744374 | 315 |
| 409 | 3300005518 | Ga0070699_100064207 | Ga0070699_1000642074 | 315 |
| 410 | 3300005614 | Ga0068856_100372921 | Ga0068856_1003729212 | 315 |
| 411 | 3300005614 | Ga0068856_100435800 | Ga0068856_1004358002 | 315 |
| 412 | 3300005841 | Ga0068863_100271647 | Ga0068863_1002716471 | 315 |
| 413 | 3300009551 | Ga0105238_10064454 | Ga0105238_100644542 | 315 |
| 414 | 3300025910 | Ga0207684_10170844 | Ga0207684_101708442 | 315 |
| 415 | 3300025928 | Ga0207700_10007673 | Ga0207700_100076736 | 315 |
| 416 | 3300026088 | Ga0207641_10278928 | Ga0207641_102789281 | 315 |
| 417 | 3300027671 | Ga0209588_1015550 | Ga0209588_10155503 | 315 |
| 418 | 3300031241 | Ga0265325_10000603 | Ga0265325_1000060316 | 315 |
| 419 | 3300035086 | Ga0373934_0048186 | Ga0373934_0048186_256_1299 | 315 |
| 420 | 3300035113 | Ga0373936_0129534 | Ga0373936_0129534_13_1056 | 315 |
| 421 | 3300035119 | Ga0373956_0008030 | Ga0373956_0008030_3051_4094 | 315 |
| 422 | 3300035172 | Ga0373955_0067756 | Ga0373955_0067756_172_1215 | 315 |
| 423 | 3300037312 | Ga0395899_0179694 | Ga0395899_0179694_140_1174 | 315 |
| 424 | 3300039447 | Ga0436361_0740605 | Ga0436361_0740605_472_1497 | 315 |
| 425 | 3300041443 | Ga0451789_0514626 | Ga0451789_0514626_951_1976 | 315 |
| 426 | 3300041451 | Ga0451791_0202860 | Ga0451791_0202860_3044_4069 | 315 |
| 427 | 3300041453 | Ga0451797_1285060 | Ga0451797_1285060_185_1210 | 315 |
| 428 | 3300041498 | Ga0451841_0647158 | Ga0451841_0647158_232_1257 | 315 |
| 429 | 3300044694 | Ga0466963_0095633 | Ga0466963_0095633_563_1594 | 315 |
| 430 | 3300045976 | Ga0466967_0089661 | Ga0466967_0089661_1445_2476 | 315 |
| 431 | 3300046454 | Ga0495592_0050596 | Ga0495592_0050596_620_1663 | 315 |
| 432 | 3300046511 | Ga0495608_0110281 | Ga0495608_0110281_341_1384 | 315 |
| 433 | 3300046529 | Ga0495652_0066716 | Ga0495652_0066716_423_1466 | 315 |
| 434 | 3300046533 | Ga0495640_0028381 | Ga0495640_0028381_326_1369 | 315 |
| 435 | 3300046543 | Ga0495645_0187037 | Ga0495645_0187037_59_1102 | 315 |
| 436 | 3300046660 | Ga0495625_0146807 | Ga0495625_0146807_299_1330 | 315 |
| 437 | 3300046663 | Ga0495635_0005390 | Ga0495635_0005390_1295_2338 | 315 |
| 438 | 3300046674 | Ga0495588_0011532 | Ga0495588_0011532_2026_3060 | 315 |
| 439 | 3300046675 | Ga0495657_0027550 | Ga0495657_0027550_2547_3590 | 315 |
| 440 | 3300046679 | Ga0495623_0086589 | Ga0495623_0086589_45_1088 | 315 |
| 441 | 3300046680 | Ga0495646_0181351 | Ga0495646_0181351_46_1089 | 315 |
| 442 | 3300046690 | Ga0495624_0130326 | Ga0495624_0130326_286_1329 | 315 |
| 443 | 3300047315 | Ga0495581_0064565 | Ga0495581_0064565_504_1538 | 315 |
| 444 | 3300047317 | Ga0495604_0034652 | Ga0495604_0034652_2899_3942 | 315 |
| 445 | 3300047319 | Ga0495674_0162867 | Ga0495674_0162867_131_1174 | 315 |
| 446 | 3300047470 | Ga0495681_0068664 | Ga0495681_0068664_181_1209 | 315 |
| 447 | 3300047471 | Ga0495684_0009361 | Ga0495684_0009361_5635_6678 | 315 |
| 448 | 3300047472 | Ga0495686_0032402 | Ga0495686_0032402_402_1436 | 315 |
| 449 | 3300048088 | Ga0495602_0091199 | Ga0495602_0091199_695_1738 | 315 |
| 450 | 3300048917 | Ga0496114_0049308 | Ga0496114_0049308_844_1869 | 315 |
| 451 | 3300048922 | Ga0496119_0000708 | Ga0496119_0000708_40659_41696 | 315 |
| 452 | 3300049568 | Ga0501031_0019772 | Ga0501031_0019772_280_1314 | 315 |
| 453 | 3300049568 | Ga0501031_0027638 | Ga0501031_0027638_1264_2298 | 315 |
| 454 | 3300049569 | Ga0501032_0001822 | Ga0501032_0001822_5909_6943 | 315 |
| 455 | 3300049569 | Ga0501032_0014355 | Ga0501032_0014355_2968_4002 | 315 |
| 456 | 3300049570 | Ga0501033_0000108 | Ga0501033_0000108_77716_78750 | 315 |
| 457 | 3300049570 | Ga0501033_0001583 | Ga0501033_0001583_479_1513 | 315 |
| 458 | 3300049571 | Ga0501034_0002449 | Ga0501034_0002449_6105_7139 | 315 |
| 459 | 3300049571 | Ga0501034_0303794 | Ga0501034_0303794_248_1282 | 315 |
| 460 | 3300049572 | Ga0501036_0000149 | Ga0501036_0000149_6542_7576 | 315 |
| 461 | 3300049573 | Ga0501037_0000153 | Ga0501037_0000153_58946_59980 | 315 |
| 462 | 3300049573 | Ga0501037_0034024 | Ga0501037_0034024_1628_2662 | 315 |
| 463 | 3300049574 | Ga0501038_0000138 | Ga0501038_0000138_4494_5528 | 315 |
| 464 | 3300049575 | Ga0501039_0000842 | Ga0501039_0000842_15960_16994 | 315 |
| 465 | 3300049575 | Ga0501039_0006162 | Ga0501039_0006162_6333_7367 | 315 |
| 466 | 3300049578 | Ga0501042_0035858 | Ga0501042_0035858_1794_2828 | 315 |
| 467 | 3300049578 | Ga0501042_0109064 | Ga0501042_0109064_436_1470 | 315 |
| 468 | 3300049579 | Ga0501043_0000085 | Ga0501043_0000085_519_1553 | 315 |
| 469 | 3300049579 | Ga0501043_0014894 | Ga0501043_0014894_3871_4905 | 315 |
| 470 | 3300049579 | Ga0501043_0082269 | Ga0501043_0082269_987_2021 | 315 |
| 471 | 3300049579 | Ga0501043_0225163 | Ga0501043_0225163_106_1140 | 315 |
| 472 | 3300049580 | Ga0501046_0000267 | Ga0501046_0000267_1538_2572 | 315 |
| 473 | 3300049580 | Ga0501046_0003985 | Ga0501046_0003985_11731_12765 | 315 |
| 474 | 3300049581 | Ga0501047_0001785 | Ga0501047_0001785_10435_11469 | 315 |
| 475 | 3300049581 | Ga0501047_0095373 | Ga0501047_0095373_1279_2352 | 315 |
| 476 | 3300049581 | Ga0501047_0119727 | Ga0501047_0119727_528_1562 | 315 |
| 477 | 3300049582 | Ga0501048_0000396 | Ga0501048_0000396_4494_5528 | 315 |
| 478 | 3300049583 | Ga0501067_0000104 | Ga0501067_0000104_46647_47681 | 315 |
| 479 | 3300049584 | Ga0501068_0004084 | Ga0501068_0004084_2546_3580 | 315 |
| 480 | 3300049585 | Ga0501069_0005888 | Ga0501069_0005888_4283_5317 | 315 |
| 481 | 3300049586 | Ga0501070_0002230 | Ga0501070_0002230_11732_12766 | 315 |
| 482 | 3300049586 | Ga0501070_0027438 | Ga0501070_0027438_505_1539 | 315 |
| 483 | 3300049586 | Ga0501070_0038371 | Ga0501070_0038371_2805_3878 | 315 |
| 484 | 3300049586 | Ga0501070_0071191 | Ga0501070_0071191_818_1852 | 315 |
| 485 | 3300049587 | Ga0501071_0118156 | Ga0501071_0118156_89_1123 | 315 |
| 486 | 3300049588 | Ga0501072_0002565 | Ga0501072_0002565_8501_9535 | 315 |
| 487 | 3300049589 | Ga0501073_0000221 | Ga0501073_0000221_7882_8916 | 315 |
| 488 | 3300049589 | Ga0501073_0068404 | Ga0501073_0068404_280_1314 | 315 |
| 489 | 3300049590 | Ga0501074_0001821 | Ga0501074_0001821_435_1469 | 315 |
| 490 | 3300049742 | Ga0501080_0011359 | Ga0501080_0011359_3882_4916 | 315 |
| 491 | 3300049742 | Ga0501080_0015912 | Ga0501080_0015912_635_1669 | 315 |
| 492 | 3300049744 | Ga0501083_0008249 | Ga0501083_0008249_5229_6263 | 315 |
| 493 | 3300049822 | Ga0501035_0004322 | Ga0501035_0004322_4645_5679 | 315 |
| 494 | 3300049823 | Ga0501044_0000369 | Ga0501044_0000369_5963_6997 | 315 |
| 495 | 3300053139 | Ga0500568_0014921 | Ga0500568_0014921_1247_2308 | 315 |
| 496 | 3300054114 | Ga0501084_0040995 | Ga0501084_0040995_94_1128 | 315 |
| 497 | 3300060353 | Ga0501082_0016777 | Ga0501082_0016777_2762_3796 | 315 |
| 498 | iso_pu_bacteria | 2511231006 | 2511263842 | 315 |
| 499 | iso_pu_bacteria | 2597489887 | 2597857091 | 315 |
| 500 | iso_pu_bacteria | 2599185185 | 2599484113 | 315 |
| 501 | iso_pu_bacteria | 2599185257 | 2599801764 | 315 |
| 502 | iso_pu_bacteria | 2619619299 | 2621298184 | 315 |
| 503 | iso_pu_bacteria | 2671180172 | 2671768713 | 315 |
| 504 | iso_pu_bacteria | 2738541265 | 2738671433 | 315 |
| 505 | iso_pu_bacteria | 2738541282 | 2738749827 | 315 |
| 506 | iso_pu_bacteria | 2738541303 | 2738858867 | 315 |
| 507 | iso_pu_bacteria | 2816332298 | 2817492673 | 315 |
| 508 | iso_pu_bacteria | 2818991436 | 2819540584 | 315 |
| 509 | 3300005436 | Ga0070713_100356476 | Ga0070713_1003564762 | 316 |
| 510 | 3300005445 | Ga0070708_100048137 | Ga0070708_1000481372 | 316 |
| 511 | 3300005467 | Ga0070706_100128207 | Ga0070706_1001282072 | 316 |
| 512 | 3300005468 | Ga0070707_100105914 | Ga0070707_1001059143 | 316 |
| 513 | 3300005518 | Ga0070699_100010173 | Ga0070699_1000101733 | 316 |
| 514 | 3300005536 | Ga0070697_100043435 | Ga0070697_1000434353 | 316 |
| 515 | 3300005536 | Ga0070697_100072318 | Ga0070697_1000723182 | 316 |
| 516 | 3300005546 | Ga0070696_100002893 | Ga0070696_1000028938 | 316 |
| 517 | 3300005548 | Ga0070665_100016585 | Ga0070665_1000165856 | 316 |
| 518 | 3300005841 | Ga0068863_100029381 | Ga0068863_1000293811 | 316 |
| 519 | 3300005937 | Ga0081455_10049156 | Ga0081455_100491564 | 316 |
| 520 | 3300006852 | Ga0075433_10073356 | Ga0075433_100733562 | 316 |
| 521 | 3300006871 | Ga0075434_100023510 | Ga0075434_1000235102 | 316 |
| 522 | 3300006880 | Ga0075429_100019555 | Ga0075429_1000195555 | 316 |
| 523 | 3300007076 | Ga0075435_100080465 | Ga0075435_1000804651 | 316 |
| 524 | 3300009147 | Ga0114129_10073857 | Ga0114129_100738573 | 316 |
| 525 | 3300009177 | Ga0105248_10010149 | Ga0105248_100101497 | 316 |
| 526 | 3300014325 | Ga0163163_10127279 | Ga0163163_101272792 | 316 |
| 527 | 3300014325 | Ga0163163_10409536 | Ga0163163_104095362 | 316 |
| 528 | 3300014968 | Ga0157379_10087340 | Ga0157379_100873403 | 316 |
| 529 | 3300025922 | Ga0207646_10054188 | Ga0207646_100541882 | 316 |
| 530 | 3300025922 | Ga0207646_10120052 | Ga0207646_101200523 | 316 |
| 531 | 3300025941 | Ga0207711_10022575 | Ga0207711_100225752 | 316 |
| 532 | 3300026088 | Ga0207641_10219011 | Ga0207641_102190112 | 316 |
| 533 | 3300027671 | Ga0209588_1000001 | Ga0209588_1000001302 | 316 |
| 534 | 3300031731 | Ga0307405_10037749 | Ga0307405_100377493 | 316 |
| 535 | 3300031911 | Ga0307412_10035919 | Ga0307412_100359192 | 316 |
| 536 | 3300031995 | Ga0307409_100064139 | Ga0307409_1000641392 | 316 |
| 537 | 3300032002 | Ga0307416_100471467 | Ga0307416_1004714672 | 316 |
| 538 | 3300032126 | Ga0307415_100031857 | Ga0307415_1000318572 | 316 |
| 539 | 3300035207 | Ga0373942_0035107 | Ga0373942_0035107_262_1290 | 316 |
| 540 | 3300046462 | Ga0495651_0109943 | Ga0495651_0109943_989_2023 | 316 |
| 541 | 3300048905 | Ga0496102_0133104 | Ga0496102_0133104_823_1851 | 316 |
| 542 | 3300048907 | Ga0496104_0086072 | Ga0496104_0086072_952_1980 | 316 |
| 543 | 3300048908 | Ga0496105_0109415 | Ga0496105_0109415_432_1460 | 316 |
| 544 | 3300048910 | Ga0496107_0142180 | Ga0496107_0142180_213_1241 | 316 |
| 545 | 3300048911 | Ga0496108_0035934 | Ga0496108_0035934_1004_2032 | 316 |
| 546 | 3300048914 | Ga0496111_0050990 | Ga0496111_0050990_221_1252 | 316 |
| 547 | 3300048915 | Ga0496112_0180754 | Ga0496112_0180754_41_1069 | 316 |
| 548 | 3300048916 | Ga0496113_0016896 | Ga0496113_0016896_1232_2260 | 316 |
| 549 | 3300048926 | Ga0496123_0040022 | Ga0496123_0040022_2035_3072 | 316 |
| 550 | 3300049570 | Ga0501033_0149982 | Ga0501033_0149982_543_1568 | 316 |
| 551 | 3300049572 | Ga0501036_0169890 | Ga0501036_0169890_185_1210 | 316 |
| 552 | 3300049574 | Ga0501038_0006460 | Ga0501038_0006460_4376_5401 | 316 |
| 553 | 3300049575 | Ga0501039_0001752 | Ga0501039_0001752_9677_10702 | 316 |
| 554 | 3300049576 | Ga0501040_0000458 | Ga0501040_0000458_17902_18927 | 316 |
| 555 | 3300049577 | Ga0501041_0007029 | Ga0501041_0007029_148_1173 | 316 |
| 556 | 3300049578 | Ga0501042_0000034 | Ga0501042_0000034_39429_40454 | 316 |
| 557 | 3300049580 | Ga0501046_0010908 | Ga0501046_0010908_5197_6222 | 316 |
| 558 | 3300049582 | Ga0501048_0012524 | Ga0501048_0012524_5116_6141 | 316 |
| 559 | 3300049586 | Ga0501070_0089536 | Ga0501070_0089536_798_1823 | 316 |
| 560 | 3300049587 | Ga0501071_0000148 | Ga0501071_0000148_10319_11344 | 316 |
| 561 | 3300049588 | Ga0501072_0002177 | Ga0501072_0002177_12194_13219 | 316 |
| 562 | 3300049590 | Ga0501074_0039892 | Ga0501074_0039892_1254_2279 | 316 |
| 563 | 3300049591 | Ga0501075_0003982 | Ga0501075_0003982_4772_5797 | 316 |
| 564 | 3300049592 | Ga0501076_0007933 | Ga0501076_0007933_1406_2431 | 316 |
| 565 | 3300049593 | Ga0501077_0000051 | Ga0501077_0000051_1345_2370 | 316 |
| 566 | 3300049741 | Ga0501079_0011518 | Ga0501079_0011518_4377_5402 | 316 |
| 567 | 3300049742 | Ga0501080_0014641 | Ga0501080_0014641_3427_4452 | 316 |
| 568 | 3300049743 | Ga0501081_0007633 | Ga0501081_0007633_4377_5402 | 316 |
| 569 | 3300049744 | Ga0501083_0033735 | Ga0501083_0033735_675_1700 | 316 |
| 570 | 3300049824 | Ga0501045_0060453 | Ga0501045_0060453_675_1700 | 316 |
| 571 | 3300050507 | nmdc:mga05p37_113678_c1 | nmdc:mga05p37_113678_c1_2052_3077 | 316 |
| 572 | 3300050507 | nmdc:mga05p37_337000_c1 | nmdc:mga05p37_337000_c1_424_1449 | 316 |
| 573 | 3300050507 | nmdc:mga05p37_496154_c1 | nmdc:mga05p37_496154_c1_105_1130 | 316 |
| 574 | 3300050507 | nmdc:mga05p37_55038_c1 | nmdc:mga05p37_55038_c1_1948_2973 | 316 |
| 575 | 3300050510 | nmdc:mga06r32_72756_c1 | nmdc:mga06r32_72756_c1_1551_2576 | 316 |
| 576 | 3300050512 | nmdc:mga0n895_58539_c1 | nmdc:mga0n895_58539_c1_882_1910 | 316 |
| 577 | 3300050513 | nmdc:mga0rr50_60283_c1 | nmdc:mga0rr50_60283_c1_1762_2790 | 316 |
| 578 | 3300050514 | nmdc:mga08x19_158463_c1 | nmdc:mga08x19_158463_c1_76_1101 | 316 |
| 579 | 3300050515 | nmdc:mga0a205_173829_c1 | nmdc:mga0a205_173829_c1_812_1837 | 316 |
| 580 | 3300053085 | Ga0495619_0046007 | Ga0495619_0046007_1798_2832 | 316 |
| 581 | 3300054114 | Ga0501084_0000798 | Ga0501084_0000798_5411_6436 | 316 |
| 582 | 3300060353 | Ga0501082_0012174 | Ga0501082_0012174_6247_7272 | 316 |
| 583 | 3300061734 | Ga0530510_0001331 | Ga0530510_0001331_3317_4342 | 316 |
| 584 | 3300005439 | Ga0070711_100071231 | Ga0070711_1000712312 | 317 |
| 585 | 3300005445 | Ga0070708_100026124 | Ga0070708_1000261241 | 317 |
| 586 | 3300005445 | Ga0070708_100188046 | Ga0070708_1001880462 | 317 |
| 587 | 3300005458 | Ga0070681_10004354 | Ga0070681_100043544 | 317 |
| 588 | 3300005467 | Ga0070706_100277422 | Ga0070706_1002774222 | 317 |
| 589 | 3300005468 | Ga0070707_100088361 | Ga0070707_1000883613 | 317 |
| 590 | 3300005468 | Ga0070707_100360849 | Ga0070707_1003608492 | 317 |
| 591 | 3300005471 | Ga0070698_100040678 | Ga0070698_1000406783 | 317 |
| 592 | 3300005471 | Ga0070698_100212209 | Ga0070698_1002122092 | 317 |
| 593 | 3300005518 | Ga0070699_100045716 | Ga0070699_1000457163 | 317 |
| 594 | 3300005530 | Ga0070679_100115038 | Ga0070679_1001150382 | 317 |
| 595 | 3300005536 | Ga0070697_100090111 | Ga0070697_1000901112 | 317 |
| 596 | 3300005578 | Ga0068854_100120677 | Ga0068854_1001206772 | 317 |
| 597 | 3300005983 | Ga0081540_1000227 | Ga0081540_10002274 | 317 |
| 598 | 3300006163 | Ga0070715_10009256 | Ga0070715_100092564 | 317 |
| 599 | 3300006175 | Ga0070712_100054691 | Ga0070712_1000546914 | 317 |
| 600 | 3300006871 | Ga0075434_100119768 | Ga0075434_1001197685 | 317 |
| 601 | 3300007076 | Ga0075435_100162982 | Ga0075435_1001629822 | 317 |
| 602 | 3300009148 | Ga0105243_10011457 | Ga0105243_100114575 | 317 |
| 603 | 3300013297 | Ga0157378_10013581 | Ga0157378_100135813 | 317 |
| 604 | 3300025898 | Ga0207692_10005651 | Ga0207692_100056517 | 317 |
| 605 | 3300025905 | Ga0207685_10007603 | Ga0207685_100076033 | 317 |
| 606 | 3300025910 | Ga0207684_10016067 | Ga0207684_100160672 | 317 |
| 607 | 3300025910 | Ga0207684_10121683 | Ga0207684_101216832 | 317 |
| 608 | 3300025912 | Ga0207707_10001710 | Ga0207707_1000171015 | 317 |
| 609 | 3300025915 | Ga0207693_10064478 | Ga0207693_100644784 | 317 |
| 610 | 3300025915 | Ga0207693_10076942 | Ga0207693_100769421 | 317 |
| 611 | 3300025915 | Ga0207693_10208491 | Ga0207693_102084912 | 317 |
| 612 | 3300025918 | Ga0207662_10040552 | Ga0207662_100405521 | 317 |
| 613 | 3300025922 | Ga0207646_10131048 | Ga0207646_101310481 | 317 |
| 614 | 3300025922 | Ga0207646_10132689 | Ga0207646_101326893 | 317 |
| 615 | 3300025929 | Ga0207664_10365246 | Ga0207664_103652461 | 317 |
| 616 | 3300025935 | Ga0207709_10026811 | Ga0207709_100268115 | 317 |
| 617 | 3300025937 | Ga0207669_10353048 | Ga0207669_103530481 | 317 |
| 618 | 3300025939 | Ga0207665_10135017 | Ga0207665_101350172 | 317 |
| 619 | 3300048904 | Ga0496101_0067070 | Ga0496101_0067070_1081_2112 | 317 |
| 620 | 3300048909 | Ga0496106_0068778 | Ga0496106_0068778_871_1902 | 317 |
| 621 | 3300048913 | Ga0496110_0006378 | Ga0496110_0006378_4367_5401 | 317 |
| 622 | 3300048914 | Ga0496111_0044693 | Ga0496111_0044693_292_1326 | 317 |
| 623 | 3300048915 | Ga0496112_0073057 | Ga0496112_0073057_2116_3150 | 317 |
| 624 | 3300003187 | JGI25151J46595_10000156 | JGI25151J46595_1000015614 | 318 |
| 625 | 3300005295 | Ga0065707_10140114 | Ga0065707_101401141 | 318 |
| 626 | 3300005353 | Ga0070669_100017421 | Ga0070669_1000174212 | 318 |
| 627 | 3300005444 | Ga0070694_100010896 | Ga0070694_1000108963 | 318 |
| 628 | 3300005615 | Ga0070702_100176922 | Ga0070702_1001769221 | 318 |
| 629 | 3300005617 | Ga0068859_100089208 | Ga0068859_1000892082 | 318 |
| 630 | 3300005844 | Ga0068862_100039043 | Ga0068862_1000390433 | 318 |
| 631 | 3300006931 | Ga0097620_100089208 | Ga0097620_1000892082 | 318 |
| 632 | 3300014326 | Ga0157380_10014937 | Ga0157380_100149371 | 318 |
| 633 | 3300025294 | Ga0209025_1000019 | Ga0209025_1000019547 | 318 |
| 634 | 3300041512 | Ga0451853_2172144 | Ga0451853_2172144_2015_3088 | 318 |
| 635 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001570 | 319 |
| 636 | 3300002771 | JGI25163J39215_1001830 | JGI25163J39215_10018302 | 319 |
| 637 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001558 | 319 |
| 638 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001476 | 319 |
| 639 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001476 | 319 |
| 640 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003558 | 319 |
| 641 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003558 | 319 |
| 642 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001558 | 319 |
| 643 | 3300005840 | Ga0068870_10059696 | Ga0068870_100596963 | 319 |
| 644 | 3300015262 | Ga0182007_10012714 | Ga0182007_100127142 | 319 |
| 645 | 3300025224 | Ga0209784_100004 | Ga0209784_100004553 | 319 |
| 646 | 3300025225 | Ga0209566_100004 | Ga0209566_100004710 | 319 |
| 647 | 3300025226 | Ga0209674_100006 | Ga0209674_100006710 | 319 |
| 648 | 3300025230 | Ga0209563_100009 | Ga0209563_100009553 | 319 |
| 649 | 3300025231 | Ga0207427_100347 | Ga0207427_10034728 | 319 |
| 650 | 3300025233 | Ga0209437_100004 | Ga0209437_100004553 | 319 |
| 651 | 3300025253 | Ga0209677_100005 | Ga0209677_100005553 | 319 |
| 652 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005710 | 319 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zxu-assembly1.cif.gz_A | crystal structure of cura in complex with nadph from vibrio vulnificus | 0.9689 | 9 | 319 |
| 5zxn-assembly1.cif.gz_B | crystal structure of cura from vibrio vulnificus | 0.9545 | 8 | 318 |
| 5zxu-assembly1.cif.gz_A | crystal structure of cura in complex with nadph from vibrio vulnificus | 0.9421 | 9 | 319 |
| 4b7x-assembly3.cif.gz_K | crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. | 0.9391 | 7 | 316 |
| 4b7c-assembly1.cif.gz_B | crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. | 0.9388 | 7 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76113_7_128_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9779 | 8 | 128 | 3.90.180.10 |
| af_Q2G2D7_2_124_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9655 | 8 | 118 | 3.90.180.10 |
| af_P76113_7_128_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9621 | 8 | 128 | 3.90.180.10 |
| af_Q91YR9_2_104_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9524 | 7 | 115 | 3.90.180.10 |
| af_Q14914_3_121_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9428 | 8 | 118 | 3.90.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E9RBJ5-F1-model_v4 | NADP-dependent oxidoreductase | 0.9848 | 5 | 319 |
GO:0016628
|
| AF-A0A6C8H448-F1-model_v4 | Oxidoreductase YncB | 0.9832 | 42 | 319 |
GO:0016628
|
| AF-A0A090PR43-F1-model_v4 | deleted | 0.983 | 132 | 319 |
|
| AF-A0A511GWU0-F1-model_v4 | deleted | 0.9828 | 44 | 317 |
|
| AF-A0A376UB23-F1-model_v4 | NADP-dependent oxidoreductase yncB (EC 1.3.1.-) | 0.9828 | 132 | 273 |
GO:0016628
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar