F472725

General Info

Members Datasets Scaffolds Average Seq Length
652 414 576 338

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306166|2552111567
Length 379
Sequence CYVGVSRELPLLLVDETGWNFDTGAIGRPTFTVSRAKLATMVETTRIVLASRPEGAPTAANFRTETAELPPLEDGQVLLRTLYLSLDPYMRGRMSTAKSYAKPVEVGAVMVGGTVGEVLESRAPGFAKGDVALAYSGWQTHDVADASGLRKLDPGAAPVSTALGVLGMPGFTAYSGLLKIGQPKAGETVVVAAATGPVGSAVGQIAKIKGARAVGIAGGPKKCAYLLDEFGFDAAIDHRAADFAEQLKAAVPDGIDVYFENVAGPVAEAVYPLLNTYARVPVCGLIANYNAAGRPDGPDNLPAFYSRILIKSLTIRGFIQTEFVEEVFPDFLRDMTEWVADGRVRYLQDVTEGLEHAPEAFIGMLEGRNFGKVVVRVAD

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
6 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
7 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
8 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
9 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
10 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
11 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
12 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
13 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
14 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
15 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
16 2643221561 Nocardioides sp. Root151 Isolate Unclassified
17 2643221569 Achromobacter sp. Root565 Isolate Unclassified
18 2643221594 Achromobacter sp. Root170 Isolate Unclassified
19 2643221621 Achromobacter sp. Root83 Isolate Unclassified
20 2643221651 Afipia sp. Root123D2 Isolate Unclassified
21 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
22 2643221696 Nocardioides sp. Root140 Isolate Unclassified
23 2643221734 Bosea sp. Root670 Isolate Unclassified
24 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
25 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
26 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
27 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
28 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
29 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
30 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
31 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
32 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
33 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
34 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
35 2739367898 Nocardioides sp. CF479 Isolate Unclassified
36 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
37 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
38 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
39 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
40 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
41 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
42 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
43 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
44 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
45 2818991436 Collimonas arenae 515 Isolate Unclassified
46 2818991467 Bosea vestrisii 3192 Isolate Unclassified
47 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
48 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
49 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
50 2855767633 Achromobacter sp. HZ34 Isolate Nodule
51 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
52 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
53 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
54 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
55 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
56 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
57 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
58 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
59 2902330777 Methylobacterium sp. 2A Isolate Unclassified
60 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
61 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
62 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
63 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
64 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
65 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
66 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
67 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
68 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
69 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
70 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
71 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
72 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
73 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
74 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
75 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
76 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
77 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
78 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
79 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
80 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
84 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
85 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
86 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
89 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
90 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
91 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
94 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
95 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
96 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
97 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
98 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
99 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
100 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
103 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
104 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
105 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
106 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
107 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
108 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
109 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
110 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
111 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
114 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
115 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
116 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
117 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
121 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
126 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
127 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
128 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
129 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
133 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
138 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
139 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
140 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
141 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
142 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
144 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
145 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
146 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
147 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
148 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
149 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
150 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
151 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
152 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
153 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
154 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
155 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
170 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
175 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
176 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
178 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
184 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
225 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
226 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
227 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
239 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
240 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
258 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
259 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
260 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
261 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
262 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
263 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
277 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
278 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
279 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
280 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
283 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
290 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
318 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
333 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
334 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
335 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
336 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
337 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
338 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
339 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
340 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
341 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
342 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
343 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
344 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
345 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
354 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
363 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
364 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
365 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
366 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
367 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
370 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
371 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
372 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
373 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
374 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
375 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
376 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
377 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
380 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
381 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
394 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
395 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
396 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
397 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
398 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
399 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
400 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
401 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
402 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
403 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
404 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
405 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
406 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
407 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
408 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
411 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
412 641522639 Methylobacterium sp. 4-46 Isolate Nodule
413 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
414 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.19
Metatranscriptomes 0.15
Isolates 11.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.31
Bulb 0
Endosphere 11.5
Nodule 1.53
Rhizoplane 8.28
Rhizosphere 65.18
Stem 0
Stem Tuber 0
Unclassified 13.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000001 3300002737 Bacteria 740113
2 JGI25163J39215_1001830 3300002771 Bacteria 2850
3 JGI25151J46595_10000156 3300003187 Bacteria 88722
4 JGI25151J46595_10000191 3300003187 Bacteria 75432
5 JGI25165J46597_1000001 3300003214 Bacteria 1111887
6 JGI25153J46596_10000740 3300003215 Bacteria 20002
7 Ga0055538_1000001 3300003751 Bacteria 1111887
8 Ga0055539_1000001 3300003752 Bacteria 1111887
9 Ga0055533_1000003 3300003756 Bacteria 1111887
10 Ga0055525_1000003 3300003759 Bacteria 962094
11 Ga0055526_1000471 3300003771 Bacteria 32002
12 Ga0055526_1001260 3300003771 Bacteria 18171
13 Ga0055524_1000068 3300003775 Bacteria 130413
14 Ga0055524_1010677 3300003775 Bacteria 3640
15 Ga0055540_1002498 3300003792 Bacteria 9634
16 Ga0055531_10003985 3300003794 Bacteria 9155
17 Ga0055541_1000001 3300003841 Bacteria 1111887
18 Ga0065707_10083819 3300005295 Bacteria 8177
19 Ga0065707_10140114 3300005295 Bacteria 1715
20 Ga0070683_100076231 3300005329 Bacteria 3134
21 Ga0070683_100139344 3300005329 Bacteria 2298
22 Ga0070690_100090767 3300005330 Bacteria 2011
23 Ga0070660_100084493 3300005339 Bacteria 2495
24 Ga0070660_100237172 3300005339 Bacteria 1485
25 Ga0070689_100007342 3300005340 Bacteria 7695
26 Ga0070691_10037616 3300005341 Bacteria 2284
27 Ga0070661_100052294 3300005344 Bacteria 2990
28 Ga0070692_10089884 3300005345 Bacteria 1668
29 Ga0070669_100017421 3300005353 Bacteria 5125
30 Ga0070714_100172330 3300005435 Bacteria 1964
31 Ga0070714_100315026 3300005435 Bacteria 1462
32 Ga0070713_100066589 3300005436 Bacteria 3029
33 Ga0070713_100095026 3300005436 Bacteria 2570
34 Ga0070713_100356476 3300005436 Bacteria 1358
35 Ga0070711_100071231 3300005439 Bacteria 2449
36 Ga0070711_100277695 3300005439 Bacteria 1324
37 Ga0070700_100003113 3300005441 Bacteria 8512
38 Ga0070694_100010896 3300005444 Bacteria 5626
39 Ga0070708_100026124 3300005445 Bacteria 4995
40 Ga0070708_100048137 3300005445 Bacteria 3768
41 Ga0070708_100188046 3300005445 Bacteria 1931
42 Ga0070663_100018495 3300005455 Bacteria 4571
43 Ga0070663_100079007 3300005455 Bacteria 2413
44 Ga0070681_10004354 3300005458 Bacteria 13462
45 Ga0070681_10004669 3300005458 Bacteria 13096
46 Ga0070706_100094425 3300005467 Bacteria 2775
47 Ga0070706_100128207 3300005467 Bacteria 2367
48 Ga0070706_100277422 3300005467 Bacteria 1564
49 Ga0070707_100088361 3300005468 Bacteria 2998
50 Ga0070707_100105914 3300005468 Bacteria 2727
51 Ga0070707_100360849 3300005468 Bacteria 1411
52 Ga0070698_100040678 3300005471 Bacteria 4776
53 Ga0070698_100074437 3300005471 Bacteria 3401
54 Ga0070698_100212209 3300005471 Bacteria 1870
55 Ga0070699_100010173 3300005518 Bacteria 8142
56 Ga0070699_100045716 3300005518 Bacteria 3789
57 Ga0070699_100064207 3300005518 Bacteria 3184
58 Ga0070679_100115038 3300005530 Bacteria 2675
59 Ga0070684_100021383 3300005535 Bacteria 5383
60 Ga0070684_100060829 3300005535 Bacteria 3304
61 Ga0070684_100156444 3300005535 Bacteria 2067
62 Ga0070684_100249984 3300005535 Bacteria 1620
63 Ga0070697_100043435 3300005536 Bacteria 3640
64 Ga0070697_100072318 3300005536 Bacteria 2830
65 Ga0070697_100090111 3300005536 Bacteria 2534
66 Ga0070696_100002893 3300005546 Bacteria 11416
67 Ga0070696_100098774 3300005546 Bacteria 2088
68 Ga0070693_100124470 3300005547 Bacteria 1603
69 Ga0070665_100016585 3300005548 Bacteria 7385
70 Ga0070665_100479020 3300005548 Bacteria 1255
71 Ga0070664_100261595 3300005564 Bacteria 1557
72 Ga0068857_100144650 3300005577 Bacteria 2151
73 Ga0068854_100120677 3300005578 Unclassified 1990
74 Ga0068856_100359013 3300005614 Bacteria 1476
75 Ga0068856_100372921 3300005614 Bacteria 1446
76 Ga0068856_100435800 3300005614 Bacteria 1331
77 Ga0070702_100030356 3300005615 Bacteria 2947
78 Ga0070702_100176922 3300005615 Bacteria 1393
79 Ga0068859_100089208 3300005617 Bacteria 3133
80 Ga0068864_100196970 3300005618 Bacteria 1849
81 Ga0068870_10022375 3300005840 Bacteria 3106
82 Ga0068870_10059696 3300005840 Bacteria 2045
83 Ga0068863_100029381 3300005841 Bacteria 5247
84 Ga0068863_100271647 3300005841 Bacteria 1641
85 Ga0068860_100059127 3300005843 Bacteria 3645
86 Ga0068862_100039043 3300005844 Bacteria 4031
87 Ga0081455_10005973 3300005937 Bacteria 13207
88 Ga0081455_10049156 3300005937 Unclassified 3638
89 Ga0081538_10040369 3300005981 Bacteria 2978
90 Ga0081540_1000227 3300005983 Bacteria 59044
91 Ga0070717_10038580 3300006028 Bacteria 3883
92 Ga0075365_10012802 3300006038 Bacteria 4996
93 Ga0075365_10053157 3300006038 Bacteria 2682
94 Ga0075365_10059459 3300006038 Bacteria 2547
95 Ga0075365_10202302 3300006038 Bacteria 1391
96 Ga0075368_10009941 3300006042 Bacteria 3432
97 Ga0075363_100011915 3300006048 Bacteria 4177
98 Ga0075364_10000803 3300006051 Bacteria 16556
99 Ga0075364_10066553 3300006051 Bacteria 2367
100 Ga0075364_10133592 3300006051 Bacteria 1666
101 Ga0075364_10262087 3300006051 Bacteria 1175
102 Ga0070715_10009256 3300006163 Bacteria 3465
103 Ga0070716_100043621 3300006173 Bacteria 2509
104 Ga0070712_100054691 3300006175 Bacteria 2791
105 Ga0070712_100127875 3300006175 Bacteria 1922
106 Ga0075362_10139880 3300006177 Bacteria 1156
107 Ga0075367_10042424 3300006178 Bacteria 2661
108 Ga0075367_10063287 3300006178 Bacteria 2211
109 Ga0075366_10124963 3300006195 Bacteria 1551
110 Ga0075370_10110381 3300006353 Bacteria 1597
111 Ga0075433_10073356 3300006852 Bacteria 3010
112 Ga0075434_100023510 3300006871 Bacteria 6008
113 Ga0075434_100119768 3300006871 Bacteria 2647
114 Ga0075434_100224360 3300006871 Bacteria 1899
115 Ga0075429_100019555 3300006880 Bacteria 5869
116 Ga0097620_100089208 3300006931 Bacteria 3133
117 Ga0079104_1008499 3300006946 Bacteria 3586
118 Ga0075435_100080465 3300007076 Bacteria 2675
119 Ga0075435_100162982 3300007076 Bacteria 1879
120 Ga0099795_10012781 3300007788 Bacteria 2556
121 Ga0099795_10025670 3300007788 Bacteria 1978
122 Ga0105251_10005643 3300009011 Bacteria 8129
123 Ga0105240_10583655 3300009093 Bacteria 1233
124 Ga0111539_10013527 3300009094 Bacteria 10198
125 Ga0111539_10035614 3300009094 Bacteria 6025
126 Ga0111539_10446066 3300009094 Bacteria 1507
127 Ga0105245_10017929 3300009098 Bacteria 6183
128 Ga0114129_10073857 3300009147 Bacteria 4751
129 Ga0105243_10011457 3300009148 Bacteria 6709
130 Ga0105242_10245130 3300009176 Bacteria 1612
131 Ga0105242_10466405 3300009176 Bacteria 1194
132 Ga0105248_10010149 3300009177 Bacteria 10373
133 Ga0105248_10045931 3300009177 Bacteria 4897
134 Ga0105248_10154603 3300009177 Unclassified 2588
135 Ga0105248_10377458 3300009177 Bacteria 1596
136 Ga0105238_10064454 3300009551 Bacteria 3664
137 Ga0105238_10109873 3300009551 Bacteria 2739
138 Ga0099796_10025801 3300010159 Unclassified 1860
139 Ga0157371_10069363 3300013102 Bacteria 2496
140 Ga0157370_10039429 3300013104 Bacteria 4565
141 Ga0157369_10019075 3300013105 Bacteria 7678
142 Ga0157369_10168036 3300013105 Bacteria 2312
143 Ga0171462_1006 3300013250 Bacteria 432986
144 Ga0157378_10013581 3300013297 Bacteria 7123
145 Ga0163162_10074247 3300013306 Bacteria 3459
146 Ga0163162_10110991 3300013306 Bacteria 2839
147 Ga0157372_10132090 3300013307 Bacteria 2873
148 Ga0163163_10100935 3300014325 Bacteria 2908
149 Ga0163163_10127279 3300014325 Bacteria 2585
150 Ga0163163_10131690 3300014325 Bacteria 2541
151 Ga0163163_10409536 3300014325 Bacteria 1414
152 Ga0157380_10014937 3300014326 Bacteria 5694
153 Ga0157380_10050440 3300014326 Bacteria 3287
154 Ga0157377_10200270 3300014745 Bacteria 1267
155 Ga0157379_10087340 3300014968 Bacteria 2796
156 Ga0182007_10012714 3300015262 Bacteria 3231
157 Ga0206353_11413154 3300020082 Bacteria 2187
158 Ga0213875_10012022 3300021388 Bacteria 4287
159 Ga0209784_100004 3300025224 Bacteria 1378156
160 Ga0209566_100004 3300025225 Bacteria 1531866
161 Ga0209674_100006 3300025226 Bacteria 1531866
162 Ga0209563_100009 3300025230 Bacteria 1378156
163 Ga0207427_100347 3300025231 Bacteria 29881
164 Ga0209437_100004 3300025233 Bacteria 1378156
165 Ga0209677_100005 3300025253 Bacteria 1378156
166 Ga0209233_1000005 3300025261 Bacteria 1531866
167 Ga0209673_1038672 3300025273 Bacteria 1386
168 Ga0209675_1000566 3300025291 Bacteria 26641
169 Ga0209676_1020388 3300025292 Bacteria 2253
170 Ga0209676_1034226 3300025292 Bacteria 1504
171 Ga0209025_1000008 3300025294 Bacteria 1130876
172 Ga0209025_1000019 3300025294 Bacteria 631548
173 Ga0209564_1000041 3300025295 Bacteria 405199
174 Ga0209564_1000065 3300025295 Bacteria 315205
175 Ga0209758_1001968 3300025297 Bacteria 22196
176 Ga0209050_1016094 3300025298 Bacteria 3086
177 Ga0209256_1000014 3300025299 Bacteria 687409
178 Ga0209256_1000266 3300025299 Bacteria 92357
179 Ga0209051_1002484 3300025303 Bacteria 13160
180 Ga0209051_1019007 3300025303 Bacteria 3017
181 Ga0209257_1000741 3300025304 Bacteria 49326
182 Ga0207713_1015185 3300025735 Bacteria 3965
183 Ga0207692_10005651 3300025898 Bacteria 5020
184 Ga0207685_10007603 3300025905 Bacteria 3031
185 Ga0207699_10028543 3300025906 Bacteria 3103
186 Ga0207643_10013851 3300025908 Bacteria 4374
187 Ga0207684_10016067 3300025910 Bacteria 6428
188 Ga0207684_10121683 3300025910 Bacteria 2237
189 Ga0207684_10170844 3300025910 Bacteria 1874
190 Ga0207707_10001710 3300025912 Bacteria 20187
191 Ga0207707_10003376 3300025912 Bacteria 14170
192 Ga0207693_10025911 3300025915 Bacteria 4644
193 Ga0207693_10064478 3300025915 Bacteria 2870
194 Ga0207693_10076942 3300025915 Bacteria 2613
195 Ga0207693_10208491 3300025915 Bacteria 1536
196 Ga0207663_10082847 3300025916 Bacteria 2105
197 Ga0207663_10147379 3300025916 Bacteria 1647
198 Ga0207662_10035256 3300025918 Bacteria 2922
199 Ga0207662_10040552 3300025918 Bacteria 2738
200 Ga0207657_10023413 3300025919 Bacteria 5751
201 Ga0207657_10160494 3300025919 Bacteria 1826
202 Ga0207649_10033501 3300025920 Bacteria 3070
203 Ga0207646_10054188 3300025922 Bacteria 3588
204 Ga0207646_10120052 3300025922 Bacteria 2361
205 Ga0207646_10131048 3300025922 Bacteria 2256
206 Ga0207646_10132689 3300025922 Bacteria 2242
207 Ga0207681_10242611 3300025923 Bacteria 1403
208 Ga0207687_10263533 3300025927 Bacteria 1375
209 Ga0207687_10299806 3300025927 Bacteria 1294
210 Ga0207687_10313838 3300025927 Bacteria 1267
211 Ga0207700_10007673 3300025928 Bacteria 6624
212 Ga0207700_10165296 3300025928 Bacteria 1841
213 Ga0207664_10365246 3300025929 Bacteria 1279
214 Ga0207709_10026811 3300025935 Bacteria 3313
215 Ga0207709_10032823 3300025935 Bacteria 3043
216 Ga0207669_10353048 3300025937 Bacteria 1137
217 Ga0207704_10022201 3300025938 Bacteria 3395
218 Ga0207665_10116156 3300025939 Bacteria 1886
219 Ga0207665_10135017 3300025939 Bacteria 1755
220 Ga0207691_10124765 3300025940 Bacteria 2279
221 Ga0207711_10002701 3300025941 Bacteria 15669
222 Ga0207711_10022575 3300025941 Bacteria 5264
223 Ga0207711_10167976 3300025941 Unclassified 1989
224 Ga0207711_10188536 3300025941 Bacteria 1878
225 Ga0207661_10101242 3300025944 Bacteria 2420
226 Ga0207679_10258980 3300025945 Bacteria 1483
227 Ga0207678_10007840 3300026067 Bacteria 9425
228 Ga0207678_10041147 3300026067 Bacteria 4006
229 Ga0207708_10002132 3300026075 Bacteria 14600
230 Ga0207641_10219011 3300026088 Bacteria 1764
231 Ga0207641_10278928 3300026088 Bacteria 1571
232 Ga0207648_10005257 3300026089 Bacteria 13072
233 Ga0207674_10058309 3300026116 Bacteria 3912
234 Ga0207675_100001223 3300026118 Bacteria 25636
235 Ga0207698_10187818 3300026142 Bacteria 1837
236 Ga0209179_1002295 3300027512 Bacteria 2559
237 Ga0209588_1000001 3300027671 Bacteria 705877
238 Ga0209588_1015550 3300027671 Bacteria 2341
239 Ga0209813_10003780 3300027866 Bacteria 3572
240 Ga0209813_10037993 3300027866 Bacteria 1453
241 Ga0268264_10000398 3300028381 Bacteria 62200
242 Ga0307517_10000035 3300028786 Bacteria 172762
243 Ga0265325_10000603 3300031241 Bacteria 26174
244 Ga0265327_10022512 3300031251 Bacteria 3764
245 Ga0265316_10034824 3300031344 Bacteria 4088
246 Ga0307513_10131756 3300031456 Bacteria 2444
247 Ga0265314_10022120 3300031711 Bacteria 4874
248 Ga0307405_10037749 3300031731 Bacteria 2906
249 Ga0307407_10167875 3300031903 Bacteria 1442
250 Ga0307412_10000635 3300031911 Bacteria 20463
251 Ga0307412_10005336 3300031911 Bacteria 7213
252 Ga0307412_10035919 3300031911 Bacteria 3170
253 Ga0307409_100064139 3300031995 Bacteria 2885
254 Ga0307409_100183846 3300031995 Bacteria 1853
255 Ga0307416_100471467 3300032002 Bacteria 1313
256 Ga0307414_10001811 3300032004 Bacteria 11052
257 Ga0307414_10009988 3300032004 Bacteria 5481
258 Ga0307415_100031857 3300032126 Bacteria 3403
259 Ga0307510_10010315 3300033180 Bacteria 11095
260 Ga0307510_10017848 3300033180 Bacteria 8360
261 Ga0373934_0048186 3300035086 Bacteria 1686
262 Ga0373936_0129534 3300035113 Bacteria 1083
263 Ga0373939_0047016 3300035114 Bacteria 1324
264 Ga0373954_0130253 3300035118 Bacteria 1224
265 Ga0373956_0008030 3300035119 Bacteria 4265
266 Ga0373946_0118887 3300035171 Bacteria 1204
267 Ga0373955_0067756 3300035172 Bacteria 1987
268 Ga0373955_0083145 3300035172 Bacteria 1813
269 Ga0373942_0035107 3300035207 Bacteria 1344
270 Ga0373927_0259415 3300035695 Bacteria 1143
271 Ga0373937_0090031 3300036401 Bacteria 2842
272 Ga0373937_0152984 3300036401 Bacteria 2161
273 Ga0373937_0235397 3300036401 Bacteria 1725
274 Ga0373925_0000294 3300037068 Bacteria 52165
275 Ga0373925_0152124 3300037068 Bacteria 1818
276 Ga0373925_0184619 3300037068 Bacteria 1653
277 Ga0395899_0179694 3300037312 Bacteria 1486
278 Ga0395900_0157643 3300037418 Bacteria 2318
279 Ga0395900_0343274 3300037418 Bacteria 1468
280 Ga0395898_0064590 3300037466 Bacteria 3550
281 Ga0395898_0114523 3300037466 Bacteria 2584
282 Ga0436364_0087625 3300037853 Bacteria 2603
283 Ga0436364_0627056 3300037853 Bacteria 2113
284 Ga0436364_0645366 3300037853 Bacteria 5565
285 Ga0395901_0004498 3300038443 Bacteria 14058
286 Ga0395901_0122084 3300038443 Bacteria 2738
287 Ga0436360_1317574 3300039438 Bacteria 1538
288 Ga0436361_0740605 3300039447 Bacteria 3368
289 Ga0436363_1577385 3300039450 Bacteria 1727
290 Ga0436362_1099131 3300039453 Bacteria 2225
291 Ga0451789_0514626 3300041443 Bacteria 2909
292 Ga0451791_0202860 3300041451 Bacteria 8040
293 Ga0451797_1285060 3300041453 Bacteria 1406
294 Ga0451841_0647158 3300041498 Bacteria 3022
295 Ga0451853_2172144 3300041512 Bacteria 3352
296 Ga0466969_0000478 3300044656 Bacteria 21890
297 Ga0466972_0048525 3300044658 Bacteria 2051
298 Ga0466966_0011428 3300044684 Bacteria 5889
299 Ga0466963_0038754 3300044694 Bacteria 3119
300 Ga0466963_0081796 3300044694 Bacteria 2188
301 Ga0466963_0095633 3300044694 Bacteria 2028
302 Ga0466970_0006381 3300044765 Bacteria 5894
303 Ga0466970_0049019 3300044765 Bacteria 2253
304 Ga0466957_0037795 3300044842 Bacteria 2907
305 Ga0466960_0001467 3300044901 Bacteria 8597
306 Ga0466960_0038146 3300044901 Bacteria 2257
307 Ga0466960_0068880 3300044901 Bacteria 1757
308 Ga0466960_0079913 3300044901 Bacteria 1646
309 Ga0466960_0107939 3300044901 Bacteria 1442
310 Ga0466959_0040108 3300045049 Bacteria 3459
311 Ga0466967_0085180 3300045976 Bacteria 2861
312 Ga0466967_0089661 3300045976 Bacteria 2792
313 Ga0466967_0093540 3300045976 Bacteria 2736
314 Ga0495592_0042004 3300046454 Bacteria 3425
315 Ga0495592_0050596 3300046454 Bacteria 3087
316 Ga0495603_0155076 3300046455 Bacteria 1329
317 Ga0495651_0109943 3300046462 Bacteria 2040
318 Ga0495650_0002022 3300046471 Bacteria 17759
319 Ga0495650_0005584 3300046471 Bacteria 8112
320 Ga0495582_0060992 3300046473 Bacteria 2082
321 Ga0495639_0014171 3300046475 Bacteria 3451
322 Ga0495664_0003650 3300046477 Bacteria 8390
323 Ga0495596_0000074 3300046500 Bacteria 70574
324 Ga0495607_0000048 3300046501 Bacteria 121640
325 Ga0495607_0035152 3300046501 Bacteria 3034
326 Ga0495608_0006495 3300046511 Bacteria 8296
327 Ga0495608_0027602 3300046511 Bacteria 3862
328 Ga0495608_0110281 3300046511 Bacteria 1769
329 Ga0495608_0188315 3300046511 Bacteria 1304
330 Ga0495608_0199364 3300046511 Bacteria 1262
331 Ga0495610_0000390 3300046512 Bacteria 45422
332 Ga0495618_0011158 3300046514 Bacteria 5446
333 Ga0495618_0018884 3300046514 Bacteria 4235
334 Ga0495620_0000236 3300046515 Bacteria 41329
335 Ga0495628_0025793 3300046516 Bacteria 4799
336 Ga0495630_0001124 3300046517 Bacteria 18441
337 Ga0495630_0032177 3300046517 Bacteria 3907
338 Ga0495643_0000945 3300046522 Bacteria 30097
339 Ga0495643_0006293 3300046522 Bacteria 7852
340 Ga0495652_0066716 3300046529 Bacteria 3018
341 Ga0495652_0077373 3300046529 Bacteria 2758
342 Ga0495652_0154581 3300046529 Bacteria 1788
343 Ga0495640_0001398 3300046533 Bacteria 18997
344 Ga0495640_0027750 3300046533 Bacteria 4080
345 Ga0495640_0028381 3300046533 Bacteria 4031
346 Ga0495586_0015399 3300046535 Bacteria 4068
347 Ga0495586_0031920 3300046535 Bacteria 2823
348 Ga0495609_0001395 3300046538 Bacteria 16216
349 Ga0495621_0038727 3300046539 Bacteria 1664
350 Ga0495645_0187037 3300046543 Bacteria 1414
351 Ga0495667_0015548 3300046559 Bacteria 5145
352 Ga0495667_0047026 3300046559 Bacteria 2851
353 Ga0495634_0004109 3300046642 Bacteria 11527
354 Ga0495634_0026684 3300046642 Bacteria 4029
355 Ga0495634_0038587 3300046642 Bacteria 3256
356 Ga0495625_0146807 3300046660 Bacteria 1588
357 Ga0495635_0005390 3300046663 Bacteria 8897
358 Ga0495635_0154424 3300046663 Bacteria 1562
359 Ga0495588_0011532 3300046674 Bacteria 4150
360 Ga0495657_0027550 3300046675 Bacteria 4008
361 Ga0495599_0005443 3300046678 Bacteria 7611
362 Ga0495599_0176299 3300046678 Bacteria 1318
363 Ga0495623_0086589 3300046679 Bacteria 1931
364 Ga0495646_0181351 3300046680 Bacteria 1155
365 Ga0495647_0085245 3300046681 Bacteria 1287
366 Ga0495658_0014372 3300046683 Bacteria 4045
367 Ga0495658_0045239 3300046683 Bacteria 2470
368 Ga0495613_0146298 3300046689 Bacteria 1686
369 Ga0495624_0130326 3300046690 Bacteria 1542
370 Ga0495671_0068964 3300046692 Bacteria 1738
371 Ga0495589_0000297 3300046794 Bacteria 39517
372 Ga0495600_0008961 3300046809 Bacteria 6165
373 Ga0495581_0064565 3300047315 Bacteria 2115
374 Ga0495581_0155139 3300047315 Bacteria 1338
375 Ga0495604_0001361 3300047317 Bacteria 20003
376 Ga0495604_0034652 3300047317 Bacteria 3993
377 Ga0495636_0012336 3300047318 Bacteria 3383
378 Ga0495674_0162867 3300047319 Bacteria 1865
379 Ga0495674_0212675 3300047319 Bacteria 1601
380 Ga0495676_0163613 3300047321 Bacteria 1572
381 Ga0495680_0014826 3300047322 Bacteria 6739
382 Ga0495680_0032946 3300047322 Bacteria 4200
383 Ga0495680_0240942 3300047322 Bacteria 1284
384 Ga0495683_0000527 3300047323 Bacteria 28999
385 Ga0495679_002910 3300047446 Bacteria 8477
386 Ga0495681_0068664 3300047470 Bacteria 1612
387 Ga0495684_0009361 3300047471 Bacteria 7563
388 Ga0495686_0032402 3300047472 Bacteria 3383
389 Ga0495602_0091199 3300048088 Bacteria 2528
390 Ga0496100_0042503 3300048903 Bacteria 2903
391 Ga0496100_0347824 3300048903 Bacteria 1119
392 Ga0496101_0067070 3300048904 Bacteria 2619
393 Ga0496101_0155050 3300048904 Bacteria 1754
394 Ga0496101_0227163 3300048904 Bacteria 1450
395 Ga0496102_0133104 3300048905 Bacteria 2329
396 Ga0496102_0140430 3300048905 Bacteria 2265
397 Ga0496102_0425337 3300048905 Bacteria 1247
398 Ga0496104_0000303 3300048907 Bacteria 43795
399 Ga0496104_0026767 3300048907 Bacteria 5329
400 Ga0496104_0074509 3300048907 Bacteria 3231
401 Ga0496104_0086072 3300048907 Bacteria 3000
402 Ga0496104_0490673 3300048907 Bacteria 1139
403 Ga0496105_0000975 3300048908 Bacteria 19694
404 Ga0496105_0008362 3300048908 Bacteria 8041
405 Ga0496105_0045435 3300048908 Bacteria 3623
406 Ga0496105_0109415 3300048908 Bacteria 2281
407 Ga0496106_0068778 3300048909 Bacteria 2702
408 Ga0496107_0142180 3300048910 Bacteria 1774
409 Ga0496108_0035934 3300048911 Bacteria 4121
410 Ga0496108_0092653 3300048911 Bacteria 2570
411 Ga0496108_0263171 3300048911 Bacteria 1501
412 Ga0496109_0037527 3300048912 Bacteria 4378
413 Ga0496109_0396048 3300048912 Bacteria 1305
414 Ga0496110_0006378 3300048913 Bacteria 9328
415 Ga0496110_0137598 3300048913 Bacteria 2208
416 Ga0496111_0018369 3300048914 Bacteria 4844
417 Ga0496111_0037939 3300048914 Bacteria 3450
418 Ga0496111_0044693 3300048914 Bacteria 3184
419 Ga0496111_0050990 3300048914 Bacteria 2987
420 Ga0496112_0005559 3300048915 Bacteria 10923
421 Ga0496112_0022841 3300048915 Bacteria 5968
422 Ga0496112_0047790 3300048915 Bacteria 4198
423 Ga0496112_0054758 3300048915 Bacteria 3920
424 Ga0496112_0073057 3300048915 Bacteria 3391
425 Ga0496112_0180754 3300048915 Bacteria 2073
426 Ga0496112_0335928 3300048915 Bacteria 1454
427 Ga0496113_0016896 3300048916 Bacteria 5051
428 Ga0496113_0044397 3300048916 Bacteria 3292
429 Ga0496113_0120508 3300048916 Bacteria 2050
430 Ga0496113_0324883 3300048916 Bacteria 1233
431 Ga0496114_0049308 3300048917 Bacteria 3503
432 Ga0496114_0073072 3300048917 Bacteria 2886
433 Ga0496114_0244667 3300048917 Bacteria 1578
434 Ga0496114_0366390 3300048917 Bacteria 1275
435 Ga0496115_0165963 3300048918 Bacteria 1826
436 Ga0496117_0057283 3300048920 Bacteria 2708
437 Ga0496117_0277947 3300048920 Bacteria 898
438 Ga0496118_0005078 3300048921 Bacteria 15154
439 Ga0496119_0000708 3300048922 Bacteria 44757
440 Ga0496119_0005330 3300048922 Bacteria 12372
441 Ga0496119_0017505 3300048922 Bacteria 5386
442 Ga0496119_0028119 3300048922 Bacteria 3846
443 Ga0496119_0063365 3300048922 Bacteria 2199
444 Ga0496120_0001278 3300048923 Bacteria 31428
445 Ga0496120_0002868 3300048923 Bacteria 16557
446 Ga0496121_0000334 3300048924 Bacteria 98442
447 Ga0496121_0022990 3300048924 Bacteria 6023
448 Ga0496121_0024299 3300048924 Bacteria 5802
449 Ga0496122_0000137 3300048925 Bacteria 170016
450 Ga0496122_0016172 3300048925 Bacteria 7085
451 Ga0496123_0000022 3300048926 Bacteria 361832
452 Ga0496123_0025051 3300048926 Bacteria 4509
453 Ga0496123_0040022 3300048926 Bacteria 3272
454 Ga0496124_0000007 3300048927 Bacteria 883534
455 Ga0496124_0000309 3300048927 Bacteria 90452
456 Ga0496124_0064381 3300048927 Bacteria 3061
457 Ga0496125_0000146 3300048928 Bacteria 154919
458 Ga0496125_0000459 3300048928 Bacteria 73809
459 Ga0496125_0134275 3300048928 Bacteria 1734
460 Ga0496125_0167269 3300048928 Bacteria 1484
461 Ga0496126_0012581 3300048929 Bacteria 8661
462 Ga0496126_0091268 3300048929 Bacteria 2679
463 Ga0496126_0102621 3300048929 Bacteria 2500
464 Ga0501031_0019772 3300049568 Bacteria 4388
465 Ga0501031_0027638 3300049568 Bacteria 3698
466 Ga0501032_0001822 3300049569 Bacteria 16845
467 Ga0501032_0014355 3300049569 Bacteria 5610
468 Ga0501033_0000108 3300049570 Bacteria 79903
469 Ga0501033_0001583 3300049570 Bacteria 20018
470 Ga0501033_0149982 3300049570 Bacteria 1682
471 Ga0501034_0002449 3300049571 Bacteria 22384
472 Ga0501034_0303794 3300049571 Bacteria 1532
473 Ga0501036_0000149 3300049572 Bacteria 45598
474 Ga0501036_0169890 3300049572 Bacteria 1837
475 Ga0501037_0000153 3300049573 Bacteria 64239
476 Ga0501037_0034024 3300049573 Bacteria 3762
477 Ga0501038_0000138 3300049574 Bacteria 62493
478 Ga0501038_0006460 3300049574 Bacteria 10854
479 Ga0501038_0191967 3300049574 Bacteria 1643
480 Ga0501039_0000842 3300049575 Bacteria 22166
481 Ga0501039_0001752 3300049575 Bacteria 16010
482 Ga0501039_0006162 3300049575 Bacteria 9108
483 Ga0501040_0000458 3300049576 Bacteria 24237
484 Ga0501041_0007029 3300049577 Bacteria 6606
485 Ga0501042_0000034 3300049578 Bacteria 43770
486 Ga0501042_0035858 3300049578 Bacteria 3519
487 Ga0501042_0109064 3300049578 Bacteria 1993
488 Ga0501043_0000085 3300049579 Bacteria 83544
489 Ga0501043_0014894 3300049579 Bacteria 6087
490 Ga0501043_0082269 3300049579 Bacteria 2530
491 Ga0501043_0225163 3300049579 Bacteria 1450
492 Ga0501046_0000267 3300049580 Bacteria 53185
493 Ga0501046_0003985 3300049580 Bacteria 13484
494 Ga0501046_0010908 3300049580 Bacteria 7787
495 Ga0501047_0001785 3300049581 Bacteria 20809
496 Ga0501047_0022832 3300049581 Bacteria 6006
497 Ga0501047_0095373 3300049581 Bacteria 2854
498 Ga0501047_0119727 3300049581 Bacteria 2515
499 Ga0501048_0000396 3300049582 Bacteria 30302
500 Ga0501048_0012524 3300049582 Bacteria 6311
501 Ga0501067_0000104 3300049583 Bacteria 48290
502 Ga0501067_0199421 3300049583 Bacteria 1115
503 Ga0501068_0004084 3300049584 Bacteria 7922
504 Ga0501069_0005888 3300049585 Bacteria 6388
505 Ga0501070_0002230 3300049586 Bacteria 17026
506 Ga0501070_0027438 3300049586 Bacteria 4777
507 Ga0501070_0038371 3300049586 Bacteria 3996
508 Ga0501070_0071191 3300049586 Bacteria 2879
509 Ga0501070_0089536 3300049586 Bacteria 2547
510 Ga0501071_0000148 3300049587 Bacteria 29373
511 Ga0501071_0118156 3300049587 Bacteria 1964
512 Ga0501072_0002177 3300049588 Bacteria 14632
513 Ga0501072_0002565 3300049588 Bacteria 13617
514 Ga0501073_0000221 3300049589 Bacteria 37338
515 Ga0501073_0068404 3300049589 Bacteria 2475
516 Ga0501074_0001821 3300049590 Bacteria 14590
517 Ga0501074_0039892 3300049590 Bacteria 3400
518 Ga0501075_0003982 3300049591 Bacteria 9965
519 Ga0501076_0007933 3300049592 Bacteria 7744
520 Ga0501077_0000051 3300049593 Bacteria 61179
521 Ga0501223_000049 3300049663 Bacteria 40988
522 Ga0501224_000007 3300049664 Bacteria 127654
523 Ga0501225_0000055 3300049705 Bacteria 38821
524 Ga0501234_000426 3300049707 Bacteria 6297
525 Ga0501079_0011518 3300049741 Bacteria 6750
526 Ga0501080_0011359 3300049742 Bacteria 8154
527 Ga0501080_0014641 3300049742 Bacteria 7224
528 Ga0501080_0015912 3300049742 Bacteria 6938
529 Ga0501081_0007633 3300049743 Bacteria 7015
530 Ga0501083_0008249 3300049744 Bacteria 7364
531 Ga0501083_0033735 3300049744 Bacteria 3503
532 Ga0501035_0004322 3300049822 Bacteria 13496
533 Ga0501035_0024781 3300049822 Bacteria 5500
534 Ga0501044_0000369 3300049823 Bacteria 56363
535 Ga0501044_0005606 3300049823 Bacteria 13943
536 Ga0501045_0060453 3300049824 Bacteria 2778
537 Ga0501226_000025 3300049853 Bacteria 91197
538 nmdc:mga03683_29380_c1 3300050489 Bacteria 2192
539 nmdc:mga00v17_2236_c1 3300050491 Bacteria 9924
540 nmdc:mga0yw44_40083_c1 3300050492 Bacteria 2781
541 nmdc:mga0yw44_46201_c1 3300050492 Bacteria 2614
542 nmdc:mga0k408_119692_c1 3300050493 Bacteria 1559
543 nmdc:mga06z11_136424_c1 3300050494 Bacteria 1383
544 nmdc:mga04h51_22348_c1 3300050495 Bacteria 1913
545 nmdc:mga04h51_32183_c1 3300050495 Bacteria 1662
546 nmdc:mga07m45_2407_c1 3300050496 Bacteria 8775
547 nmdc:mga07m45_34554_c1 3300050496 Bacteria 2810
548 nmdc:mga07m45_9552_c1 3300050496 Bacteria 5036
549 nmdc:mga05p37_113678_c1 3300050507 Bacteria 3329
550 nmdc:mga05p37_337000_c1 3300050507 Bacteria 1779
551 nmdc:mga05p37_496154_c1 3300050507 Bacteria 1403
552 nmdc:mga05p37_55038_c1 3300050507 Bacteria 4895
553 nmdc:mga06r32_72756_c1 3300050510 Bacteria 3328
554 nmdc:mga08y16_32074_c1 3300050511 Bacteria 5524
555 nmdc:mga08y16_7589_c1 3300050511 Bacteria 11355
556 nmdc:mga0n895_58539_c1 3300050512 Bacteria 3799
557 nmdc:mga0rr50_42431_c1 3300050513 Bacteria 3322
558 nmdc:mga0rr50_60283_c1 3300050513 Bacteria 2854
559 nmdc:mga08x19_158463_c1 3300050514 Bacteria 1536
560 nmdc:mga0a205_173829_c1 3300050515 Bacteria 2050
561 Ga0495601_0007195 3300053077 Bacteria 6529
562 Ga0495595_0000497 3300053084 Bacteria 15033
563 Ga0495619_0018781 3300053085 Bacteria 4388
564 Ga0495619_0046007 3300053085 Bacteria 2868
565 Ga0500643_010958 3300053087 Bacteria 3342
566 Ga0500641_0001088 3300053096 Bacteria 9669
567 Ga0500654_097784 3300053099 Bacteria 1269
568 Ga0500568_0014921 3300053139 Bacteria 3491
569 Ga0500573_0062449 3300053140 Bacteria 2133
570 Ga0500616_0000399 3300053153 Bacteria 59548
571 Ga0500622_0049136 3300053156 Bacteria 2175
572 Ga0501084_0000798 3300054114 Bacteria 24109
573 Ga0501084_0040995 3300054114 Bacteria 3873
574 Ga0501082_0012174 3300060353 Bacteria 7390
575 Ga0501082_0016777 3300060353 Bacteria 6306
576 Ga0530510_0001331 3300061734 Bacteria 16535

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0425337 Ga0496102_0425337_344_1171 245
2 3300048927 Ga0496124_0064381 Ga0496124_0064381_271_1092 245
3 3300048907 Ga0496104_0490673 Ga0496104_0490673_16_855 252
4 3300048908 Ga0496105_0045435 Ga0496105_0045435_16_855 252
5 3300046689 Ga0495613_0146298 Ga0495613_0146298_21_872 256
6 3300048920 Ga0496117_0277947 Ga0496117_0277947_24_887 258
7 3300047322 Ga0495680_0240942 Ga0495680_0240942_13_867 259
8 3300035118 Ga0373954_0130253 Ga0373954_0130253_347_1213 263
9 3300009176 Ga0105242_10466405 Ga0105242_104664052 287
10 3300013250 Ga0171462_1006 Ga0171462_1006243 287
11 3300028786 Ga0307517_10000035 Ga0307517_1000003517 289
12 3300031344 Ga0265316_10034824 Ga0265316_100348243 289
13 3300035114 Ga0373939_0047016 Ga0373939_0047016_11_970 289
14 3300031711 Ga0265314_10022120 Ga0265314_100221202 290
15 3300044694 Ga0466963_0081796 Ga0466963_0081796_43_1053 290
16 3300009094 Ga0111539_10446066 Ga0111539_104460662 292
17 3300009177 Ga0105248_10154603 Ga0105248_101546032 292
18 3300025941 Ga0207711_10167976 Ga0207711_101679762 292
19 3300046471 Ga0495650_0005584 Ga0495650_0005584_2020_3033 292
20 3300025923 Ga0207681_10242611 Ga0207681_102426111 294
21 3300025916 Ga0207663_10147379 Ga0207663_101473792 296
22 3300009177 Ga0105248_10045931 Ga0105248_100459312 297
23 3300025941 Ga0207711_10002701 Ga0207711_100027018 297
24 3300035172 Ga0373955_0083145 Ga0373955_0083145_223_1263 297
25 3300036401 Ga0373937_0152984 Ga0373937_0152984_910_1950 297
26 3300046454 Ga0495592_0042004 Ga0495592_0042004_669_1709 297
27 3300046455 Ga0495603_0155076 Ga0495603_0155076_127_1167 297
28 3300046475 Ga0495639_0014171 Ga0495639_0014171_1381_2469 297
29 3300046477 Ga0495664_0003650 Ga0495664_0003650_544_1632 297
30 3300046511 Ga0495608_0027602 Ga0495608_0027602_49_1077 297
31 3300046514 Ga0495618_0018884 Ga0495618_0018884_1725_2813 297
32 3300046642 Ga0495634_0026684 Ga0495634_0026684_1725_2813 297
33 3300046663 Ga0495635_0154424 Ga0495635_0154424_161_1201 297
34 3300046683 Ga0495658_0014372 Ga0495658_0014372_827_1915 297
35 3300047322 Ga0495680_0032946 Ga0495680_0032946_1326_2414 297
36 3300048921 Ga0496118_0005078 Ga0496118_0005078_9739_10722 297
37 3300048922 Ga0496119_0017505 Ga0496119_0017505_457_1440 297
38 3300048924 Ga0496121_0000334 Ga0496121_0000334_89075_90058 297
39 3300053084 Ga0495595_0000497 Ga0495595_0000497_316_1356 297
40 3300053085 Ga0495619_0018781 Ga0495619_0018781_1113_2201 297
41 3300005439 Ga0070711_100277695 Ga0070711_1002776952 298
42 3300005458 Ga0070681_10004669 Ga0070681_100046694 300
43 3300025912 Ga0207707_10003376 Ga0207707_100033764 300
44 3300044694 Ga0466963_0038754 Ga0466963_0038754_28_1005 300
45 3300046539 Ga0495621_0038727 Ga0495621_0038727_675_1652 301
46 3300049574 Ga0501038_0191967 Ga0501038_0191967_611_1603 301
47 3300053099 Ga0500654_097784 Ga0500654_097784_252_1229 301
48 iso_pu_bacteria 2510917021 2511129637 302
49 iso_pu_bacteria 8054302542 8054305655 302
50 iso_pu_bacteria 2513237101 2513694144 303
51 3300005339 Ga0070660_100237172 Ga0070660_1002371721 304
52 3300005535 Ga0070684_100156444 Ga0070684_1001564442 304
53 3300005546 Ga0070696_100098774 Ga0070696_1000987742 304
54 3300006353 Ga0075370_10110381 Ga0075370_101103812 304
55 3300006871 Ga0075434_100224360 Ga0075434_1002243603 304
56 3300009093 Ga0105240_10583655 Ga0105240_105836551 304
57 3300009094 Ga0111539_10035614 Ga0111539_100356145 304
58 3300014325 Ga0163163_10100935 Ga0163163_101009353 304
59 3300025919 Ga0207657_10160494 Ga0207657_101604941 304
60 3300035171 Ga0373946_0118887 Ga0373946_0118887_86_1090 304
61 3300036401 Ga0373937_0090031 Ga0373937_0090031_630_1625 304
62 3300036401 Ga0373937_0235397 Ga0373937_0235397_678_1673 304
63 3300037068 Ga0373925_0152124 Ga0373925_0152124_512_1507 304
64 3300037068 Ga0373925_0184619 Ga0373925_0184619_104_1108 304
65 3300037853 Ga0436364_0087625 Ga0436364_0087625_739_1740 304
66 3300039453 Ga0436362_1099131 Ga0436362_1099131_237_1232 304
67 3300044656 Ga0466969_0000478 Ga0466969_0000478_3412_4446 304
68 3300044684 Ga0466966_0011428 Ga0466966_0011428_2963_3997 304
69 3300045049 Ga0466959_0040108 Ga0466959_0040108_1683_2717 304
70 3300046473 Ga0495582_0060992 Ga0495582_0060992_306_1304 304
71 3300046511 Ga0495608_0006495 Ga0495608_0006495_3773_4771 304
72 3300046511 Ga0495608_0188315 Ga0495608_0188315_59_1054 304
73 3300046514 Ga0495618_0011158 Ga0495618_0011158_866_1864 304
74 3300046516 Ga0495628_0025793 Ga0495628_0025793_387_1385 304
75 3300046517 Ga0495630_0001124 Ga0495630_0001124_13792_14790 304
76 3300046517 Ga0495630_0032177 Ga0495630_0032177_1077_2072 304
77 3300046529 Ga0495652_0077373 Ga0495652_0077373_454_1452 304
78 3300046529 Ga0495652_0154581 Ga0495652_0154581_233_1228 304
79 3300046533 Ga0495640_0001398 Ga0495640_0001398_10597_11595 304
80 3300046533 Ga0495640_0027750 Ga0495640_0027750_737_1732 304
81 3300046535 Ga0495586_0015399 Ga0495586_0015399_2121_3116 304
82 3300046535 Ga0495586_0031920 Ga0495586_0031920_539_1537 304
83 3300046559 Ga0495667_0047026 Ga0495667_0047026_1298_2296 304
84 3300046642 Ga0495634_0004109 Ga0495634_0004109_3433_4431 304
85 3300046678 Ga0495599_0005443 Ga0495599_0005443_2992_3990 304
86 3300046678 Ga0495599_0176299 Ga0495599_0176299_60_1055 304
87 3300046681 Ga0495647_0085245 Ga0495647_0085245_255_1253 304
88 3300046683 Ga0495658_0045239 Ga0495658_0045239_1250_2248 304
89 3300046809 Ga0495600_0008961 Ga0495600_0008961_3525_4523 304
90 3300047315 Ga0495581_0155139 Ga0495581_0155139_136_1140 304
91 3300047317 Ga0495604_0001361 Ga0495604_0001361_7268_8266 304
92 3300047318 Ga0495636_0012336 Ga0495636_0012336_1316_2314 304
93 3300047319 Ga0495674_0212675 Ga0495674_0212675_272_1270 304
94 3300047321 Ga0495676_0163613 Ga0495676_0163613_58_1062 304
95 3300047322 Ga0495680_0014826 Ga0495680_0014826_5537_6535 304
96 3300048903 Ga0496100_0042503 Ga0496100_0042503_1492_2496 304
97 3300048905 Ga0496102_0140430 Ga0496102_0140430_974_1978 304
98 3300048907 Ga0496104_0000303 Ga0496104_0000303_2790_3794 304
99 3300048907 Ga0496104_0026767 Ga0496104_0026767_3536_4540 304
100 3300048908 Ga0496105_0000975 Ga0496105_0000975_2790_3794 304
101 3300048908 Ga0496105_0008362 Ga0496105_0008362_5503_6507 304
102 3300048911 Ga0496108_0092653 Ga0496108_0092653_1062_2066 304
103 3300048914 Ga0496111_0018369 Ga0496111_0018369_1808_2812 304
104 3300048915 Ga0496112_0005559 Ga0496112_0005559_9083_10087 304
105 3300048915 Ga0496112_0054758 Ga0496112_0054758_1050_2054 304
106 3300048916 Ga0496113_0044397 Ga0496113_0044397_1696_2700 304
107 3300048916 Ga0496113_0120508 Ga0496113_0120508_182_1186 304
108 3300048917 Ga0496114_0366390 Ga0496114_0366390_178_1182 304
109 3300048918 Ga0496115_0165963 Ga0496115_0165963_511_1509 304
110 3300048928 Ga0496125_0167269 Ga0496125_0167269_457_1461 304
111 3300048929 Ga0496126_0091268 Ga0496126_0091268_892_1887 304
112 3300050496 nmdc:mga07m45_34554_c1 nmdc:mga07m45_34554_c1_1404_2438 304
113 3300050511 nmdc:mga08y16_7589_c1 nmdc:mga08y16_7589_c1_4440_5435 304
114 3300050513 nmdc:mga0rr50_42431_c1 nmdc:mga0rr50_42431_c1_220_1218 304
115 3300053077 Ga0495601_0007195 Ga0495601_0007195_3461_4459 304
116 3300035695 Ga0373927_0259415 Ga0373927_0259415_72_1073 305
117 3300039450 Ga0436363_1577385 Ga0436363_1577385_19_1020 305
118 3300005295 Ga0065707_10083819 Ga0065707_100838194 306
119 3300005843 Ga0068860_100059127 Ga0068860_1000591272 306
120 3300031456 Ga0307513_10131756 Ga0307513_101317562 306
121 3300031911 Ga0307412_10005336 Ga0307412_100053364 306
122 3300032004 Ga0307414_10001811 Ga0307414_100018113 306
123 3300032004 Ga0307414_10009988 Ga0307414_100099885 306
124 3300046471 Ga0495650_0002022 Ga0495650_0002022_14816_15871 306
125 3300046500 Ga0495596_0000074 Ga0495596_0000074_49337_50392 306
126 3300046501 Ga0495607_0035152 Ga0495607_0035152_761_1816 306
127 3300046512 Ga0495610_0000390 Ga0495610_0000390_2919_3974 306
128 3300046522 Ga0495643_0000945 Ga0495643_0000945_11298_12353 306
129 3300046522 Ga0495643_0006293 Ga0495643_0006293_2909_3964 306
130 3300046538 Ga0495609_0001395 Ga0495609_0001395_5894_6949 306
131 3300046692 Ga0495671_0068964 Ga0495671_0068964_632_1687 306
132 3300049663 Ga0501223_000049 Ga0501223_000049_33949_34980 306
133 3300049664 Ga0501224_000007 Ga0501224_000007_6189_7220 306
134 3300049705 Ga0501225_0000055 Ga0501225_0000055_31689_32720 306
135 3300049707 Ga0501234_000426 Ga0501234_000426_4517_5548 306
136 3300049853 Ga0501226_000025 Ga0501226_000025_83972_85003 306
137 3300006051 Ga0075364_10262087 Ga0075364_102620871 307
138 iso_pu_bacteria 2937877337 2937884875 307
139 iso_pu_bacteria 2958084443 2958092184 307
140 3300033180 Ga0307510_10010315 Ga0307510_100103153 308
141 iso_pu_bacteria 2508501050 2508728767 308
142 iso_pu_bacteria 2643221734 2644736663 308
143 iso_pu_bacteria 2818991467 2819719302 308
144 iso_pu_bacteria 2883291878 2883292355 308
145 iso_pu_bacteria 2891968417 2891973625 308
146 iso_pu_bacteria 2915650412 2915651852 308
147 3300006195 Ga0075366_10124963 Ga0075366_101249632 309
148 3300006946 Ga0079104_1008499 Ga0079104_10084993 309
149 3300009176 Ga0105242_10245130 Ga0105242_102451302 309
150 3300013306 Ga0163162_10110991 Ga0163162_101109913 309
151 3300013307 Ga0157372_10132090 Ga0157372_101320902 309
152 3300025927 Ga0207687_10263533 Ga0207687_102635332 309
153 3300048903 Ga0496100_0347824 Ga0496100_0347824_29_1030 309
154 3300048904 Ga0496101_0155050 Ga0496101_0155050_426_1454 309
155 3300048904 Ga0496101_0227163 Ga0496101_0227163_164_1165 309
156 3300048907 Ga0496104_0074509 Ga0496104_0074509_613_1617 309
157 3300048914 Ga0496111_0037939 Ga0496111_0037939_2154_3182 309
158 3300048915 Ga0496112_0047790 Ga0496112_0047790_1319_2320 309
159 3300048915 Ga0496112_0335928 Ga0496112_0335928_287_1288 309
160 3300048916 Ga0496113_0324883 Ga0496113_0324883_77_1078 309
161 3300050493 nmdc:mga0k408_119692_c1 nmdc:mga0k408_119692_c1_152_1186 309
162 3300053087 Ga0500643_010958 Ga0500643_010958_2235_3269 309
163 3300053156 Ga0500622_0049136 Ga0500622_0049136_885_1919 309
164 iso_pu_bacteria 2545555834 2545679316 309
165 iso_pu_bacteria 2599185156 2599332316 309
166 iso_pu_bacteria 2643221561 2643823616 309
167 iso_pu_bacteria 2643221696 2644535297 309
168 iso_pu_bacteria 2738543031 2739347729 309
169 iso_pu_bacteria 2739367898 2740166199 309
170 iso_pu_bacteria 2773857762 2774395266 309
171 iso_pu_bacteria 2808606439 2809193900 309
172 iso_pu_bacteria 2811994878 2812348640 309
173 iso_pu_bacteria 2842922631 2842924673 309
174 iso_pu_bacteria 2857542790 2857544213 309
175 iso_pu_bacteria 2857576091 2857579771 309
176 iso_pu_bacteria 2945961074 2945963094 309
177 iso_pu_bacteria 2974315732 2974318231 309
178 iso_pu_bacteria 2984523437 2984526443 309
179 iso_pu_bacteria 3003665799 3003667584 309
180 iso_pu_bacteria 641522639 641644595 309
181 iso_pu_bacteria 643348564 643602827 309
182 3300005618 Ga0068864_100196970 Ga0068864_1001969702 310
183 3300014325 Ga0163163_10131690 Ga0163163_101316902 310
184 3300033180 Ga0307510_10017848 Ga0307510_100178486 310
185 3300037418 Ga0395900_0343274 Ga0395900_0343274_363_1367 310
186 3300037466 Ga0395898_0064590 Ga0395898_0064590_852_1856 310
187 3300038443 Ga0395901_0004498 Ga0395901_0004498_5580_6584 310
188 3300044901 Ga0466960_0079913 Ga0466960_0079913_93_1103 310
189 3300046511 Ga0495608_0199364 Ga0495608_0199364_60_1070 310
190 3300046642 Ga0495634_0038587 Ga0495634_0038587_610_1620 310
191 3300048912 Ga0496109_0396048 Ga0496109_0396048_39_1046 310
192 3300048915 Ga0496112_0022841 Ga0496112_0022841_3831_4838 310
193 iso_pu_bacteria 2599185292 2599903753 310
194 iso_pu_bacteria 2643221569 2643860261 310
195 iso_pu_bacteria 2643221594 2643979517 310
196 iso_pu_bacteria 2643221621 2644120022 310
197 iso_pu_bacteria 2738541281 2738746249 310
198 iso_pu_bacteria 2738543032 2739355479 310
199 iso_pu_bacteria 2751185725 2753039507 310
200 iso_pu_bacteria 2751185792 2753327870 310
201 iso_pu_bacteria 2808606395 2809035788 310
202 iso_pu_bacteria 2829745981 2829747798 310
203 iso_pu_bacteria 2842698319 2842701651 310
204 iso_pu_bacteria 2857537821 2857538944 310
205 iso_pu_bacteria 2857710386 2857712688 310
206 iso_pu_bacteria 2902330777 2902335581 310
207 iso_pu_bacteria 2941479691 2941485524 310
208 3300005344 Ga0070661_100052294 Ga0070661_1000522942 311
209 3300005435 Ga0070714_100172330 Ga0070714_1001723301 311
210 3300005436 Ga0070713_100066589 Ga0070713_1000665892 311
211 3300005455 Ga0070663_100018495 Ga0070663_1000184953 311
212 3300005535 Ga0070684_100021383 Ga0070684_1000213834 311
213 3300005564 Ga0070664_100261595 Ga0070664_1002615952 311
214 3300005577 Ga0068857_100144650 Ga0068857_1001446502 311
215 3300005937 Ga0081455_10005973 Ga0081455_1000597313 311
216 3300007788 Ga0099795_10025670 Ga0099795_100256701 311
217 3300013105 Ga0157369_10168036 Ga0157369_101680362 311
218 3300025920 Ga0207649_10033501 Ga0207649_100335012 311
219 3300025944 Ga0207661_10101242 Ga0207661_101012422 311
220 3300026067 Ga0207678_10007840 Ga0207678_1000784010 311
221 3300026116 Ga0207674_10058309 Ga0207674_100583094 311
222 3300027512 Ga0209179_1002295 Ga0209179_10022951 311
223 3300048929 Ga0496126_0012581 Ga0496126_0012581_4988_6037 311
224 3300053153 Ga0500616_0000399 Ga0500616_0000399_29217_30233 311
225 iso_pu_bacteria 2582581307 2585274750 311
226 iso_pu_bacteria 2585427531 2585562116 311
227 iso_pu_bacteria 2595698237 2596372728 311
228 iso_pu_bacteria 2643221651 2644288846 311
229 iso_pu_bacteria 2744054900 2746090086 311
230 iso_pu_bacteria 2744054901 2746095526 311
231 iso_pu_bacteria 2902405164 2902410857 311
232 iso_pu_bacteria 2928125067 2928127478 311
233 3300003187 JGI25151J46595_10000191 JGI25151J46595_1000019144 312
234 3300003771 Ga0055526_1000471 Ga0055526_100047114 312
235 3300003771 Ga0055526_1001260 Ga0055526_100126011 312
236 3300003775 Ga0055524_1000068 Ga0055524_100006856 312
237 3300003775 Ga0055524_1010677 Ga0055524_10106773 312
238 3300005329 Ga0070683_100076231 Ga0070683_1000762312 312
239 3300005330 Ga0070690_100090767 Ga0070690_1000907672 312
240 3300005339 Ga0070660_100084493 Ga0070660_1000844932 312
241 3300005340 Ga0070689_100007342 Ga0070689_1000073423 312
242 3300005341 Ga0070691_10037616 Ga0070691_100376162 312
243 3300005345 Ga0070692_10089884 Ga0070692_100898843 312
244 3300005435 Ga0070714_100315026 Ga0070714_1003150262 312
245 3300005441 Ga0070700_100003113 Ga0070700_1000031132 312
246 3300005455 Ga0070663_100079007 Ga0070663_1000790072 312
247 3300005535 Ga0070684_100060829 Ga0070684_1000608293 312
248 3300005535 Ga0070684_100249984 Ga0070684_1002499842 312
249 3300005547 Ga0070693_100124470 Ga0070693_1001244702 312
250 3300005614 Ga0068856_100359013 Ga0068856_1003590132 312
251 3300005615 Ga0070702_100030356 Ga0070702_1000303563 312
252 3300005840 Ga0068870_10022375 Ga0068870_100223753 312
253 3300005981 Ga0081538_10040369 Ga0081538_100403692 312
254 3300006038 Ga0075365_10202302 Ga0075365_102023022 312
255 3300006042 Ga0075368_10009941 Ga0075368_100099411 312
256 3300006175 Ga0070712_100127875 Ga0070712_1001278753 312
257 3300006178 Ga0075367_10042424 Ga0075367_100424242 312
258 3300007788 Ga0099795_10012781 Ga0099795_100127813 312
259 3300009094 Ga0111539_10013527 Ga0111539_100135272 312
260 3300009098 Ga0105245_10017929 Ga0105245_100179292 312
261 3300009177 Ga0105248_10377458 Ga0105248_103774582 312
262 3300009551 Ga0105238_10109873 Ga0105238_101098733 312
263 3300010159 Ga0099796_10025801 Ga0099796_100258013 312
264 3300013104 Ga0157370_10039429 Ga0157370_100394292 312
265 3300013105 Ga0157369_10019075 Ga0157369_100190752 312
266 3300014326 Ga0157380_10050440 Ga0157380_100504403 312
267 3300014745 Ga0157377_10200270 Ga0157377_102002701 312
268 3300020082 Ga0206353_11413154 Ga0206353_114131542 312
269 3300021388 Ga0213875_10012022 Ga0213875_100120222 312
270 3300025273 Ga0209673_1038672 Ga0209673_10386722 312
271 3300025291 Ga0209675_1000566 Ga0209675_100056622 312
272 3300025292 Ga0209676_1034226 Ga0209676_10342262 312
273 3300025294 Ga0209025_1000008 Ga0209025_1000008549 312
274 3300025295 Ga0209564_1000041 Ga0209564_1000041196 312
275 3300025295 Ga0209564_1000065 Ga0209564_1000065305 312
276 3300025299 Ga0209256_1000014 Ga0209256_100001456 312
277 3300025299 Ga0209256_1000266 Ga0209256_100026631 312
278 3300025908 Ga0207643_10013851 Ga0207643_100138514 312
279 3300025915 Ga0207693_10025911 Ga0207693_100259113 312
280 3300025918 Ga0207662_10035256 Ga0207662_100352562 312
281 3300025919 Ga0207657_10023413 Ga0207657_100234133 312
282 3300025927 Ga0207687_10299806 Ga0207687_102998062 312
283 3300025927 Ga0207687_10313838 Ga0207687_103138382 312
284 3300025928 Ga0207700_10165296 Ga0207700_101652961 312
285 3300025935 Ga0207709_10032823 Ga0207709_100328233 312
286 3300025938 Ga0207704_10022201 Ga0207704_100222012 312
287 3300025939 Ga0207665_10116156 Ga0207665_101161562 312
288 3300025940 Ga0207691_10124765 Ga0207691_101247652 312
289 3300025941 Ga0207711_10188536 Ga0207711_101885363 312
290 3300025945 Ga0207679_10258980 Ga0207679_102589802 312
291 3300026067 Ga0207678_10041147 Ga0207678_100411472 312
292 3300026075 Ga0207708_10002132 Ga0207708_100021323 312
293 3300026089 Ga0207648_10005257 Ga0207648_100052571 312
294 3300026118 Ga0207675_100001223 Ga0207675_1000012236 312
295 3300026142 Ga0207698_10187818 Ga0207698_101878182 312
296 3300037466 Ga0395898_0114523 Ga0395898_0114523_70_1086 312
297 3300037853 Ga0436364_0645366 Ga0436364_0645366_3531_4541 312
298 3300045976 Ga0466967_0085180 Ga0466967_0085180_1439_2482 312
299 3300048911 Ga0496108_0263171 Ga0496108_0263171_312_1328 312
300 3300048912 Ga0496109_0037527 Ga0496109_0037527_2757_3770 312
301 3300048917 Ga0496114_0073072 Ga0496114_0073072_1106_2119 312
302 3300048920 Ga0496117_0057283 Ga0496117_0057283_1203_2222 312
303 3300048925 Ga0496122_0000137 Ga0496122_0000137_142847_143872 312
304 3300048925 Ga0496122_0016172 Ga0496122_0016172_245_1264 312
305 3300048926 Ga0496123_0000022 Ga0496123_0000022_24668_25693 312
306 3300048926 Ga0496123_0025051 Ga0496123_0025051_1462_2481 312
307 3300050511 nmdc:mga08y16_32074_c1 nmdc:mga08y16_32074_c1_2127_3140 312
308 3300053140 Ga0500573_0062449 Ga0500573_0062449_56_1069 312
309 iso_pu_bacteria 2984592036 2984593008 312
310 3300003215 JGI25153J46596_10000740 JGI25153J46596_1000074013 313
311 3300003792 Ga0055540_1002498 Ga0055540_100249811 313
312 3300003794 Ga0055531_10003985 Ga0055531_1000398510 313
313 3300005548 Ga0070665_100479020 Ga0070665_1004790201 313
314 3300006028 Ga0070717_10038580 Ga0070717_100385803 313
315 3300006038 Ga0075365_10012802 Ga0075365_100128025 313
316 3300006038 Ga0075365_10053157 Ga0075365_100531573 313
317 3300006038 Ga0075365_10059459 Ga0075365_100594593 313
318 3300006048 Ga0075363_100011915 Ga0075363_1000119155 313
319 3300006051 Ga0075364_10066553 Ga0075364_100665533 313
320 3300006051 Ga0075364_10133592 Ga0075364_101335922 313
321 3300006173 Ga0070716_100043621 Ga0070716_1000436212 313
322 3300006177 Ga0075362_10139880 Ga0075362_101398801 313
323 3300006178 Ga0075367_10063287 Ga0075367_100632872 313
324 3300009011 Ga0105251_10005643 Ga0105251_100056435 313
325 3300013306 Ga0163162_10074247 Ga0163162_100742474 313
326 3300025297 Ga0209758_1001968 Ga0209758_100196813 313
327 3300025298 Ga0209050_1016094 Ga0209050_10160942 313
328 3300025303 Ga0209051_1002484 Ga0209051_10024843 313
329 3300025304 Ga0209257_1000741 Ga0209257_100074110 313
330 3300025735 Ga0207713_1015185 Ga0207713_10151853 313
331 3300025906 Ga0207699_10028543 Ga0207699_100285435 313
332 3300025916 Ga0207663_10082847 Ga0207663_100828472 313
333 3300027866 Ga0209813_10037993 Ga0209813_100379932 313
334 3300028381 Ga0268264_10000398 Ga0268264_1000039854 313
335 3300031251 Ga0265327_10022512 Ga0265327_100225122 313
336 3300031995 Ga0307409_100183846 Ga0307409_1001838462 313
337 3300037068 Ga0373925_0000294 Ga0373925_0000294_9383_10447 313
338 3300037418 Ga0395900_0157643 Ga0395900_0157643_715_1731 313
339 3300037853 Ga0436364_0627056 Ga0436364_0627056_968_1984 313
340 3300038443 Ga0395901_0122084 Ga0395901_0122084_530_1546 313
341 3300039438 Ga0436360_1317574 Ga0436360_1317574_210_1226 313
342 3300045976 Ga0466967_0093540 Ga0466967_0093540_269_1285 313
343 3300046501 Ga0495607_0000048 Ga0495607_0000048_34483_35502 313
344 3300046515 Ga0495620_0000236 Ga0495620_0000236_2769_3794 313
345 3300046559 Ga0495667_0015548 Ga0495667_0015548_2290_3318 313
346 3300046794 Ga0495589_0000297 Ga0495589_0000297_11209_12234 313
347 3300047323 Ga0495683_0000527 Ga0495683_0000527_4288_5304 313
348 3300047446 Ga0495679_002910 Ga0495679_002910_6482_7507 313
349 3300048913 Ga0496110_0137598 Ga0496110_0137598_843_1859 313
350 3300048922 Ga0496119_0005330 Ga0496119_0005330_8048_9073 313
351 3300048922 Ga0496119_0028119 Ga0496119_0028119_219_1247 313
352 3300048923 Ga0496120_0001278 Ga0496120_0001278_5583_6608 313
353 3300048923 Ga0496120_0002868 Ga0496120_0002868_15032_16060 313
354 3300048924 Ga0496121_0022990 Ga0496121_0022990_2926_3954 313
355 3300048924 Ga0496121_0024299 Ga0496121_0024299_801_1820 313
356 3300048927 Ga0496124_0000007 Ga0496124_0000007_508988_510007 313
357 3300048927 Ga0496124_0000309 Ga0496124_0000309_49700_50725 313
358 3300048928 Ga0496125_0000459 Ga0496125_0000459_39801_40826 313
359 3300050489 nmdc:mga03683_29380_c1 nmdc:mga03683_29380_c1_319_1338 313
360 3300050492 nmdc:mga0yw44_40083_c1 nmdc:mga0yw44_40083_c1_1555_2577 313
361 3300050492 nmdc:mga0yw44_46201_c1 nmdc:mga0yw44_46201_c1_1237_2256 313
362 3300050494 nmdc:mga06z11_136424_c1 nmdc:mga06z11_136424_c1_213_1232 313
363 3300050495 nmdc:mga04h51_32183_c1 nmdc:mga04h51_32183_c1_446_1465 313
364 3300050496 nmdc:mga07m45_2407_c1 nmdc:mga07m45_2407_c1_4260_5279 313
365 3300050496 nmdc:mga07m45_9552_c1 nmdc:mga07m45_9552_c1_2800_3816 313
366 iso_pu_bacteria 2643221681 2644455685 313
367 iso_pu_bacteria 2643221961 2645721091 313
368 iso_pu_bacteria 2643221962 2645724880 313
369 iso_pu_bacteria 2738543005 2739203931 313
370 iso_pu_bacteria 2738543011 2739238588 313
371 iso_pu_bacteria 2857542790 2857544112 313
372 iso_pu_bacteria 2889300758 2889303022 313
373 iso_pu_bacteria 2928142448 2928145662 313
374 iso_pu_bacteria 2939743619 2939746100 313
375 3300005329 Ga0070683_100139344 Ga0070683_1001393442 314
376 3300006051 Ga0075364_10000803 Ga0075364_1000080317 314
377 3300013102 Ga0157371_10069363 Ga0157371_100693632 314
378 3300025292 Ga0209676_1020388 Ga0209676_10203881 314
379 3300025303 Ga0209051_1019007 Ga0209051_10190073 314
380 3300027866 Ga0209813_10003780 Ga0209813_100037804 314
381 3300031903 Ga0307407_10167875 Ga0307407_101678752 314
382 3300031911 Ga0307412_10000635 Ga0307412_1000063510 314
383 3300044658 Ga0466972_0048525 Ga0466972_0048525_970_1989 314
384 3300044765 Ga0466970_0006381 Ga0466970_0006381_1794_2861 314
385 3300044765 Ga0466970_0049019 Ga0466970_0049019_468_1502 314
386 3300044842 Ga0466957_0037795 Ga0466957_0037795_302_1369 314
387 3300044901 Ga0466960_0001467 Ga0466960_0001467_5773_6792 314
388 3300044901 Ga0466960_0038146 Ga0466960_0038146_1218_2246 314
389 3300044901 Ga0466960_0068880 Ga0466960_0068880_279_1346 314
390 3300044901 Ga0466960_0107939 Ga0466960_0107939_246_1274 314
391 3300048917 Ga0496114_0244667 Ga0496114_0244667_158_1186 314
392 3300048922 Ga0496119_0063365 Ga0496119_0063365_259_1287 314
393 3300048928 Ga0496125_0000146 Ga0496125_0000146_25662_26690 314
394 3300048928 Ga0496125_0134275 Ga0496125_0134275_102_1130 314
395 3300048929 Ga0496126_0102621 Ga0496126_0102621_648_1676 314
396 3300049581 Ga0501047_0022832 Ga0501047_0022832_3790_4860 314
397 3300049583 Ga0501067_0199421 Ga0501067_0199421_74_1102 314
398 3300049822 Ga0501035_0024781 Ga0501035_0024781_148_1218 314
399 3300049823 Ga0501044_0005606 Ga0501044_0005606_8993_10063 314
400 3300050491 nmdc:mga00v17_2236_c1 nmdc:mga00v17_2236_c1_7984_9003 314
401 3300050495 nmdc:mga04h51_22348_c1 nmdc:mga04h51_22348_c1_166_1188 314
402 3300053096 Ga0500641_0001088 Ga0500641_0001088_6508_7536 314
403 iso_pu_bacteria 2551306166 2552111567 314
404 iso_pu_bacteria 2855767633 2855772002 314
405 iso_pu_bacteria 2881412998 2881416058 314
406 3300005436 Ga0070713_100095026 Ga0070713_1000950262 315
407 3300005467 Ga0070706_100094425 Ga0070706_1000944253 315
408 3300005471 Ga0070698_100074437 Ga0070698_1000744374 315
409 3300005518 Ga0070699_100064207 Ga0070699_1000642074 315
410 3300005614 Ga0068856_100372921 Ga0068856_1003729212 315
411 3300005614 Ga0068856_100435800 Ga0068856_1004358002 315
412 3300005841 Ga0068863_100271647 Ga0068863_1002716471 315
413 3300009551 Ga0105238_10064454 Ga0105238_100644542 315
414 3300025910 Ga0207684_10170844 Ga0207684_101708442 315
415 3300025928 Ga0207700_10007673 Ga0207700_100076736 315
416 3300026088 Ga0207641_10278928 Ga0207641_102789281 315
417 3300027671 Ga0209588_1015550 Ga0209588_10155503 315
418 3300031241 Ga0265325_10000603 Ga0265325_1000060316 315
419 3300035086 Ga0373934_0048186 Ga0373934_0048186_256_1299 315
420 3300035113 Ga0373936_0129534 Ga0373936_0129534_13_1056 315
421 3300035119 Ga0373956_0008030 Ga0373956_0008030_3051_4094 315
422 3300035172 Ga0373955_0067756 Ga0373955_0067756_172_1215 315
423 3300037312 Ga0395899_0179694 Ga0395899_0179694_140_1174 315
424 3300039447 Ga0436361_0740605 Ga0436361_0740605_472_1497 315
425 3300041443 Ga0451789_0514626 Ga0451789_0514626_951_1976 315
426 3300041451 Ga0451791_0202860 Ga0451791_0202860_3044_4069 315
427 3300041453 Ga0451797_1285060 Ga0451797_1285060_185_1210 315
428 3300041498 Ga0451841_0647158 Ga0451841_0647158_232_1257 315
429 3300044694 Ga0466963_0095633 Ga0466963_0095633_563_1594 315
430 3300045976 Ga0466967_0089661 Ga0466967_0089661_1445_2476 315
431 3300046454 Ga0495592_0050596 Ga0495592_0050596_620_1663 315
432 3300046511 Ga0495608_0110281 Ga0495608_0110281_341_1384 315
433 3300046529 Ga0495652_0066716 Ga0495652_0066716_423_1466 315
434 3300046533 Ga0495640_0028381 Ga0495640_0028381_326_1369 315
435 3300046543 Ga0495645_0187037 Ga0495645_0187037_59_1102 315
436 3300046660 Ga0495625_0146807 Ga0495625_0146807_299_1330 315
437 3300046663 Ga0495635_0005390 Ga0495635_0005390_1295_2338 315
438 3300046674 Ga0495588_0011532 Ga0495588_0011532_2026_3060 315
439 3300046675 Ga0495657_0027550 Ga0495657_0027550_2547_3590 315
440 3300046679 Ga0495623_0086589 Ga0495623_0086589_45_1088 315
441 3300046680 Ga0495646_0181351 Ga0495646_0181351_46_1089 315
442 3300046690 Ga0495624_0130326 Ga0495624_0130326_286_1329 315
443 3300047315 Ga0495581_0064565 Ga0495581_0064565_504_1538 315
444 3300047317 Ga0495604_0034652 Ga0495604_0034652_2899_3942 315
445 3300047319 Ga0495674_0162867 Ga0495674_0162867_131_1174 315
446 3300047470 Ga0495681_0068664 Ga0495681_0068664_181_1209 315
447 3300047471 Ga0495684_0009361 Ga0495684_0009361_5635_6678 315
448 3300047472 Ga0495686_0032402 Ga0495686_0032402_402_1436 315
449 3300048088 Ga0495602_0091199 Ga0495602_0091199_695_1738 315
450 3300048917 Ga0496114_0049308 Ga0496114_0049308_844_1869 315
451 3300048922 Ga0496119_0000708 Ga0496119_0000708_40659_41696 315
452 3300049568 Ga0501031_0019772 Ga0501031_0019772_280_1314 315
453 3300049568 Ga0501031_0027638 Ga0501031_0027638_1264_2298 315
454 3300049569 Ga0501032_0001822 Ga0501032_0001822_5909_6943 315
455 3300049569 Ga0501032_0014355 Ga0501032_0014355_2968_4002 315
456 3300049570 Ga0501033_0000108 Ga0501033_0000108_77716_78750 315
457 3300049570 Ga0501033_0001583 Ga0501033_0001583_479_1513 315
458 3300049571 Ga0501034_0002449 Ga0501034_0002449_6105_7139 315
459 3300049571 Ga0501034_0303794 Ga0501034_0303794_248_1282 315
460 3300049572 Ga0501036_0000149 Ga0501036_0000149_6542_7576 315
461 3300049573 Ga0501037_0000153 Ga0501037_0000153_58946_59980 315
462 3300049573 Ga0501037_0034024 Ga0501037_0034024_1628_2662 315
463 3300049574 Ga0501038_0000138 Ga0501038_0000138_4494_5528 315
464 3300049575 Ga0501039_0000842 Ga0501039_0000842_15960_16994 315
465 3300049575 Ga0501039_0006162 Ga0501039_0006162_6333_7367 315
466 3300049578 Ga0501042_0035858 Ga0501042_0035858_1794_2828 315
467 3300049578 Ga0501042_0109064 Ga0501042_0109064_436_1470 315
468 3300049579 Ga0501043_0000085 Ga0501043_0000085_519_1553 315
469 3300049579 Ga0501043_0014894 Ga0501043_0014894_3871_4905 315
470 3300049579 Ga0501043_0082269 Ga0501043_0082269_987_2021 315
471 3300049579 Ga0501043_0225163 Ga0501043_0225163_106_1140 315
472 3300049580 Ga0501046_0000267 Ga0501046_0000267_1538_2572 315
473 3300049580 Ga0501046_0003985 Ga0501046_0003985_11731_12765 315
474 3300049581 Ga0501047_0001785 Ga0501047_0001785_10435_11469 315
475 3300049581 Ga0501047_0095373 Ga0501047_0095373_1279_2352 315
476 3300049581 Ga0501047_0119727 Ga0501047_0119727_528_1562 315
477 3300049582 Ga0501048_0000396 Ga0501048_0000396_4494_5528 315
478 3300049583 Ga0501067_0000104 Ga0501067_0000104_46647_47681 315
479 3300049584 Ga0501068_0004084 Ga0501068_0004084_2546_3580 315
480 3300049585 Ga0501069_0005888 Ga0501069_0005888_4283_5317 315
481 3300049586 Ga0501070_0002230 Ga0501070_0002230_11732_12766 315
482 3300049586 Ga0501070_0027438 Ga0501070_0027438_505_1539 315
483 3300049586 Ga0501070_0038371 Ga0501070_0038371_2805_3878 315
484 3300049586 Ga0501070_0071191 Ga0501070_0071191_818_1852 315
485 3300049587 Ga0501071_0118156 Ga0501071_0118156_89_1123 315
486 3300049588 Ga0501072_0002565 Ga0501072_0002565_8501_9535 315
487 3300049589 Ga0501073_0000221 Ga0501073_0000221_7882_8916 315
488 3300049589 Ga0501073_0068404 Ga0501073_0068404_280_1314 315
489 3300049590 Ga0501074_0001821 Ga0501074_0001821_435_1469 315
490 3300049742 Ga0501080_0011359 Ga0501080_0011359_3882_4916 315
491 3300049742 Ga0501080_0015912 Ga0501080_0015912_635_1669 315
492 3300049744 Ga0501083_0008249 Ga0501083_0008249_5229_6263 315
493 3300049822 Ga0501035_0004322 Ga0501035_0004322_4645_5679 315
494 3300049823 Ga0501044_0000369 Ga0501044_0000369_5963_6997 315
495 3300053139 Ga0500568_0014921 Ga0500568_0014921_1247_2308 315
496 3300054114 Ga0501084_0040995 Ga0501084_0040995_94_1128 315
497 3300060353 Ga0501082_0016777 Ga0501082_0016777_2762_3796 315
498 iso_pu_bacteria 2511231006 2511263842 315
499 iso_pu_bacteria 2597489887 2597857091 315
500 iso_pu_bacteria 2599185185 2599484113 315
501 iso_pu_bacteria 2599185257 2599801764 315
502 iso_pu_bacteria 2619619299 2621298184 315
503 iso_pu_bacteria 2671180172 2671768713 315
504 iso_pu_bacteria 2738541265 2738671433 315
505 iso_pu_bacteria 2738541282 2738749827 315
506 iso_pu_bacteria 2738541303 2738858867 315
507 iso_pu_bacteria 2816332298 2817492673 315
508 iso_pu_bacteria 2818991436 2819540584 315
509 3300005436 Ga0070713_100356476 Ga0070713_1003564762 316
510 3300005445 Ga0070708_100048137 Ga0070708_1000481372 316
511 3300005467 Ga0070706_100128207 Ga0070706_1001282072 316
512 3300005468 Ga0070707_100105914 Ga0070707_1001059143 316
513 3300005518 Ga0070699_100010173 Ga0070699_1000101733 316
514 3300005536 Ga0070697_100043435 Ga0070697_1000434353 316
515 3300005536 Ga0070697_100072318 Ga0070697_1000723182 316
516 3300005546 Ga0070696_100002893 Ga0070696_1000028938 316
517 3300005548 Ga0070665_100016585 Ga0070665_1000165856 316
518 3300005841 Ga0068863_100029381 Ga0068863_1000293811 316
519 3300005937 Ga0081455_10049156 Ga0081455_100491564 316
520 3300006852 Ga0075433_10073356 Ga0075433_100733562 316
521 3300006871 Ga0075434_100023510 Ga0075434_1000235102 316
522 3300006880 Ga0075429_100019555 Ga0075429_1000195555 316
523 3300007076 Ga0075435_100080465 Ga0075435_1000804651 316
524 3300009147 Ga0114129_10073857 Ga0114129_100738573 316
525 3300009177 Ga0105248_10010149 Ga0105248_100101497 316
526 3300014325 Ga0163163_10127279 Ga0163163_101272792 316
527 3300014325 Ga0163163_10409536 Ga0163163_104095362 316
528 3300014968 Ga0157379_10087340 Ga0157379_100873403 316
529 3300025922 Ga0207646_10054188 Ga0207646_100541882 316
530 3300025922 Ga0207646_10120052 Ga0207646_101200523 316
531 3300025941 Ga0207711_10022575 Ga0207711_100225752 316
532 3300026088 Ga0207641_10219011 Ga0207641_102190112 316
533 3300027671 Ga0209588_1000001 Ga0209588_1000001302 316
534 3300031731 Ga0307405_10037749 Ga0307405_100377493 316
535 3300031911 Ga0307412_10035919 Ga0307412_100359192 316
536 3300031995 Ga0307409_100064139 Ga0307409_1000641392 316
537 3300032002 Ga0307416_100471467 Ga0307416_1004714672 316
538 3300032126 Ga0307415_100031857 Ga0307415_1000318572 316
539 3300035207 Ga0373942_0035107 Ga0373942_0035107_262_1290 316
540 3300046462 Ga0495651_0109943 Ga0495651_0109943_989_2023 316
541 3300048905 Ga0496102_0133104 Ga0496102_0133104_823_1851 316
542 3300048907 Ga0496104_0086072 Ga0496104_0086072_952_1980 316
543 3300048908 Ga0496105_0109415 Ga0496105_0109415_432_1460 316
544 3300048910 Ga0496107_0142180 Ga0496107_0142180_213_1241 316
545 3300048911 Ga0496108_0035934 Ga0496108_0035934_1004_2032 316
546 3300048914 Ga0496111_0050990 Ga0496111_0050990_221_1252 316
547 3300048915 Ga0496112_0180754 Ga0496112_0180754_41_1069 316
548 3300048916 Ga0496113_0016896 Ga0496113_0016896_1232_2260 316
549 3300048926 Ga0496123_0040022 Ga0496123_0040022_2035_3072 316
550 3300049570 Ga0501033_0149982 Ga0501033_0149982_543_1568 316
551 3300049572 Ga0501036_0169890 Ga0501036_0169890_185_1210 316
552 3300049574 Ga0501038_0006460 Ga0501038_0006460_4376_5401 316
553 3300049575 Ga0501039_0001752 Ga0501039_0001752_9677_10702 316
554 3300049576 Ga0501040_0000458 Ga0501040_0000458_17902_18927 316
555 3300049577 Ga0501041_0007029 Ga0501041_0007029_148_1173 316
556 3300049578 Ga0501042_0000034 Ga0501042_0000034_39429_40454 316
557 3300049580 Ga0501046_0010908 Ga0501046_0010908_5197_6222 316
558 3300049582 Ga0501048_0012524 Ga0501048_0012524_5116_6141 316
559 3300049586 Ga0501070_0089536 Ga0501070_0089536_798_1823 316
560 3300049587 Ga0501071_0000148 Ga0501071_0000148_10319_11344 316
561 3300049588 Ga0501072_0002177 Ga0501072_0002177_12194_13219 316
562 3300049590 Ga0501074_0039892 Ga0501074_0039892_1254_2279 316
563 3300049591 Ga0501075_0003982 Ga0501075_0003982_4772_5797 316
564 3300049592 Ga0501076_0007933 Ga0501076_0007933_1406_2431 316
565 3300049593 Ga0501077_0000051 Ga0501077_0000051_1345_2370 316
566 3300049741 Ga0501079_0011518 Ga0501079_0011518_4377_5402 316
567 3300049742 Ga0501080_0014641 Ga0501080_0014641_3427_4452 316
568 3300049743 Ga0501081_0007633 Ga0501081_0007633_4377_5402 316
569 3300049744 Ga0501083_0033735 Ga0501083_0033735_675_1700 316
570 3300049824 Ga0501045_0060453 Ga0501045_0060453_675_1700 316
571 3300050507 nmdc:mga05p37_113678_c1 nmdc:mga05p37_113678_c1_2052_3077 316
572 3300050507 nmdc:mga05p37_337000_c1 nmdc:mga05p37_337000_c1_424_1449 316
573 3300050507 nmdc:mga05p37_496154_c1 nmdc:mga05p37_496154_c1_105_1130 316
574 3300050507 nmdc:mga05p37_55038_c1 nmdc:mga05p37_55038_c1_1948_2973 316
575 3300050510 nmdc:mga06r32_72756_c1 nmdc:mga06r32_72756_c1_1551_2576 316
576 3300050512 nmdc:mga0n895_58539_c1 nmdc:mga0n895_58539_c1_882_1910 316
577 3300050513 nmdc:mga0rr50_60283_c1 nmdc:mga0rr50_60283_c1_1762_2790 316
578 3300050514 nmdc:mga08x19_158463_c1 nmdc:mga08x19_158463_c1_76_1101 316
579 3300050515 nmdc:mga0a205_173829_c1 nmdc:mga0a205_173829_c1_812_1837 316
580 3300053085 Ga0495619_0046007 Ga0495619_0046007_1798_2832 316
581 3300054114 Ga0501084_0000798 Ga0501084_0000798_5411_6436 316
582 3300060353 Ga0501082_0012174 Ga0501082_0012174_6247_7272 316
583 3300061734 Ga0530510_0001331 Ga0530510_0001331_3317_4342 316
584 3300005439 Ga0070711_100071231 Ga0070711_1000712312 317
585 3300005445 Ga0070708_100026124 Ga0070708_1000261241 317
586 3300005445 Ga0070708_100188046 Ga0070708_1001880462 317
587 3300005458 Ga0070681_10004354 Ga0070681_100043544 317
588 3300005467 Ga0070706_100277422 Ga0070706_1002774222 317
589 3300005468 Ga0070707_100088361 Ga0070707_1000883613 317
590 3300005468 Ga0070707_100360849 Ga0070707_1003608492 317
591 3300005471 Ga0070698_100040678 Ga0070698_1000406783 317
592 3300005471 Ga0070698_100212209 Ga0070698_1002122092 317
593 3300005518 Ga0070699_100045716 Ga0070699_1000457163 317
594 3300005530 Ga0070679_100115038 Ga0070679_1001150382 317
595 3300005536 Ga0070697_100090111 Ga0070697_1000901112 317
596 3300005578 Ga0068854_100120677 Ga0068854_1001206772 317
597 3300005983 Ga0081540_1000227 Ga0081540_10002274 317
598 3300006163 Ga0070715_10009256 Ga0070715_100092564 317
599 3300006175 Ga0070712_100054691 Ga0070712_1000546914 317
600 3300006871 Ga0075434_100119768 Ga0075434_1001197685 317
601 3300007076 Ga0075435_100162982 Ga0075435_1001629822 317
602 3300009148 Ga0105243_10011457 Ga0105243_100114575 317
603 3300013297 Ga0157378_10013581 Ga0157378_100135813 317
604 3300025898 Ga0207692_10005651 Ga0207692_100056517 317
605 3300025905 Ga0207685_10007603 Ga0207685_100076033 317
606 3300025910 Ga0207684_10016067 Ga0207684_100160672 317
607 3300025910 Ga0207684_10121683 Ga0207684_101216832 317
608 3300025912 Ga0207707_10001710 Ga0207707_1000171015 317
609 3300025915 Ga0207693_10064478 Ga0207693_100644784 317
610 3300025915 Ga0207693_10076942 Ga0207693_100769421 317
611 3300025915 Ga0207693_10208491 Ga0207693_102084912 317
612 3300025918 Ga0207662_10040552 Ga0207662_100405521 317
613 3300025922 Ga0207646_10131048 Ga0207646_101310481 317
614 3300025922 Ga0207646_10132689 Ga0207646_101326893 317
615 3300025929 Ga0207664_10365246 Ga0207664_103652461 317
616 3300025935 Ga0207709_10026811 Ga0207709_100268115 317
617 3300025937 Ga0207669_10353048 Ga0207669_103530481 317
618 3300025939 Ga0207665_10135017 Ga0207665_101350172 317
619 3300048904 Ga0496101_0067070 Ga0496101_0067070_1081_2112 317
620 3300048909 Ga0496106_0068778 Ga0496106_0068778_871_1902 317
621 3300048913 Ga0496110_0006378 Ga0496110_0006378_4367_5401 317
622 3300048914 Ga0496111_0044693 Ga0496111_0044693_292_1326 317
623 3300048915 Ga0496112_0073057 Ga0496112_0073057_2116_3150 317
624 3300003187 JGI25151J46595_10000156 JGI25151J46595_1000015614 318
625 3300005295 Ga0065707_10140114 Ga0065707_101401141 318
626 3300005353 Ga0070669_100017421 Ga0070669_1000174212 318
627 3300005444 Ga0070694_100010896 Ga0070694_1000108963 318
628 3300005615 Ga0070702_100176922 Ga0070702_1001769221 318
629 3300005617 Ga0068859_100089208 Ga0068859_1000892082 318
630 3300005844 Ga0068862_100039043 Ga0068862_1000390433 318
631 3300006931 Ga0097620_100089208 Ga0097620_1000892082 318
632 3300014326 Ga0157380_10014937 Ga0157380_100149371 318
633 3300025294 Ga0209025_1000019 Ga0209025_1000019547 318
634 3300041512 Ga0451853_2172144 Ga0451853_2172144_2015_3088 318
635 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001570 319
636 3300002771 JGI25163J39215_1001830 JGI25163J39215_10018302 319
637 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001558 319
638 3300003751 Ga0055538_1000001 Ga0055538_1000001476 319
639 3300003752 Ga0055539_1000001 Ga0055539_1000001476 319
640 3300003756 Ga0055533_1000003 Ga0055533_1000003558 319
641 3300003759 Ga0055525_1000003 Ga0055525_1000003558 319
642 3300003841 Ga0055541_1000001 Ga0055541_1000001558 319
643 3300005840 Ga0068870_10059696 Ga0068870_100596963 319
644 3300015262 Ga0182007_10012714 Ga0182007_100127142 319
645 3300025224 Ga0209784_100004 Ga0209784_100004553 319
646 3300025225 Ga0209566_100004 Ga0209566_100004710 319
647 3300025226 Ga0209674_100006 Ga0209674_100006710 319
648 3300025230 Ga0209563_100009 Ga0209563_100009553 319
649 3300025231 Ga0207427_100347 Ga0207427_10034728 319
650 3300025233 Ga0209437_100004 Ga0209437_100004553 319
651 3300025253 Ga0209677_100005 Ga0209677_100005553 319
652 3300025261 Ga0209233_1000005 Ga0209233_1000005710 319

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16884

ADH_N_2

N-terminal domain of oxidoreductase

45

152

0.98

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

197

337

0.86

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

230

375

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zxu-assembly1.cif.gz_A crystal structure of cura in complex with nadph from vibrio vulnificus 0.9689 9 319
5zxn-assembly1.cif.gz_B crystal structure of cura from vibrio vulnificus 0.9545 8 318
5zxu-assembly1.cif.gz_A crystal structure of cura in complex with nadph from vibrio vulnificus 0.9421 9 319
4b7x-assembly3.cif.gz_K crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9391 7 316
4b7c-assembly1.cif.gz_B crystal structure of hypothetical protein pa1648 from pseudomonas aeruginosa. 0.9388 7 316
ID Description Score Start End Superfamily
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9779 8 128 3.90.180.10
af_Q2G2D7_2_124_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9655 8 118 3.90.180.10
af_P76113_7_128_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9621 8 128 3.90.180.10
af_Q91YR9_2_104_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9524 7 115 3.90.180.10
af_Q14914_3_121_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9428 8 118 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A2E9RBJ5-F1-model_v4 NADP-dependent oxidoreductase 0.9848 5 319 GO:0016628
AF-A0A6C8H448-F1-model_v4 Oxidoreductase YncB 0.9832 42 319 GO:0016628
AF-A0A090PR43-F1-model_v4 deleted 0.983 132 319
AF-A0A511GWU0-F1-model_v4 deleted 0.9828 44 317
AF-A0A376UB23-F1-model_v4 NADP-dependent oxidoreductase yncB (EC 1.3.1.-) 0.9828 132 273 GO:0016628

Feature Viewer

pLDDT pTM Quality
94.14 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map