F472499

General Info

Members Datasets Scaffolds Average Seq Length
650 341 1300 132

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100481607|Ga0070708_1004816073
Length 139
Sequence MAVLERLLAVVDRVRAPETVHAHCDLPCGVYDPAQARIEADAVKAIMEKYHDSKDETFRQRAIMIKEQRAEFLKHHLWVLWTDYFKPDHLEQYPDLHTLFWNATKAAGESKKSVDPADAQKTIDLVAQIEKIFWETKKA

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
135 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
136 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
137 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
138 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
149 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
169 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
170 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
171 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
172 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
173 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
174 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
175 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
209 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
269 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
270 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
271 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
272 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
273 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
274 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
278 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
279 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
280 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
281 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
300 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
301 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
302 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
303 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
304 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
305 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059606 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 159R_AD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
323 2517572101 Frankia sp. DC12 Isolate Nodule
324 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
325 2643221548 Streptomyces sp. Root55 Isolate Unclassified
326 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
327 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
328 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
329 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
330 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
331 2867475112 Streptomyces sp. TM32 Isolate Unclassified
332 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
333 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
334 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
335 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
336 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
337 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
338 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
339 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
340 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
341 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.15
Metatranscriptomes 6.92
Isolates 2.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0.15
Rhizoplane 4.46
Rhizosphere 89.08
Stem 0
Stem Tuber 0
Unclassified 0.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100481607 3300005445 Bacteria 1171
2 LJQas_1018315 3300000549 Bacteria 815
3 Ga0032354_1031616 3300003693 Bacteria 580
4 JGI25405J52794_10013171 3300003911 Bacteria 1600
5 JGI25405J52794_10166103 3300003911 Bacteria 506
6 Ga0058861_12043763 3300004800 Bacteria 521
7 Ga0058861_12078238 3300004800 Bacteria 622
8 Ga0058862_10001739 3300004803 Bacteria 619
9 Ga0058862_10077924 3300004803 Bacteria 801
10 Ga0058862_12850602 3300004803 Bacteria 594
11 Ga0070658_10017874 3300005327 Bacteria 5672
12 Ga0070658_10094707 3300005327 Bacteria 2464
13 Ga0070658_10520099 3300005327 Bacteria 1029
14 Ga0070658_11379491 3300005327 Bacteria 612
15 Ga0070683_100080480 3300005329 Bacteria 3049
16 Ga0070683_100452893 3300005329 Bacteria 1224
17 Ga0070683_100466395 3300005329 Bacteria 1205
18 Ga0070683_100726140 3300005329 Bacteria 952
19 Ga0070666_10005041 3300005335 Bacteria 8078
20 Ga0070680_100041680 3300005336 Bacteria 3722
21 Ga0070682_100455811 3300005337 Bacteria 980
22 Ga0068868_100628858 3300005338 Bacteria 954
23 Ga0070660_100032980 3300005339 Bacteria 3900
24 Ga0070691_10030940 3300005341 Bacteria 2509
25 Ga0070692_10481161 3300005345 Bacteria 801
26 Ga0070668_100097899 3300005347 Bacteria 2320
27 Ga0070671_100054089 3300005355 Bacteria 3337
28 Ga0070674_100434659 3300005356 Bacteria 1080
29 Ga0070667_100080328 3300005367 Bacteria 2789
30 Ga0070667_100184756 3300005367 Bacteria 1845
31 Ga0070667_101959893 3300005367 Bacteria 552
32 Ga0070714_100735976 3300005435 Bacteria 953
33 Ga0070710_10000038 3300005437 Bacteria 60347
34 Ga0070663_100014057 3300005455 Bacteria 5128
35 Ga0070678_100903050 3300005456 Bacteria 808
36 Ga0070678_101265695 3300005456 Bacteria 686
37 Ga0070681_10021980 3300005458 Bacteria 6401
38 Ga0070681_10781681 3300005458 Bacteria 871
39 Ga0070685_11283246 3300005466 Bacteria 559
40 Ga0070706_100259425 3300005467 Bacteria 1622
41 Ga0070679_100051213 3300005530 Bacteria 4112
42 Ga0070679_100112026 3300005530 Bacteria 2714
43 Ga0070684_100003045 3300005535 Bacteria 12505
44 Ga0070684_100276279 3300005535 Bacteria 1538
45 Ga0070684_100565581 3300005535 Bacteria 1056
46 Ga0070693_101168777 3300005547 Bacteria 590
47 Ga0070665_100032457 3300005548 Bacteria 5255
48 Ga0070665_100096289 3300005548 Bacteria 2965
49 Ga0070665_100168944 3300005548 Bacteria 2189
50 Ga0070665_100339121 3300005548 Bacteria 1508
51 Ga0068855_100012855 3300005563 Bacteria 10100
52 Ga0068855_100510147 3300005563 Bacteria 1306
53 Ga0068855_100637293 3300005563 Bacteria 1146
54 Ga0068857_100120413 3300005577 Bacteria 2362
55 Ga0068854_100025068 3300005578 Bacteria 4092
56 Ga0068856_100019532 3300005614 Bacteria 6577
57 Ga0068856_100501726 3300005614 Bacteria 1234
58 Ga0068856_100641565 3300005614 Bacteria 1083
59 Ga0068856_100900506 3300005614 Bacteria 903
60 Ga0068856_101641855 3300005614 Bacteria 656
61 Ga0070702_100312471 3300005615 Bacteria 1092
62 Ga0068852_100017691 3300005616 Bacteria 5599
63 Ga0068852_100073680 3300005616 Bacteria 3005
64 Ga0068852_100379310 3300005616 Bacteria 1387
65 Ga0068859_100000105 3300005617 Bacteria 78213
66 Ga0068861_101460250 3300005719 Bacteria 670
67 Ga0068861_102715629 3300005719 Bacteria 500
68 Ga0068863_100000263 3300005841 Bacteria 54959
69 Ga0068858_100009275 3300005842 Bacteria 9397
70 Ga0068858_100409234 3300005842 Bacteria 1304
71 Ga0068860_100000067 3300005843 Bacteria 180176
72 Ga0068862_100000025 3300005844 Bacteria 197313
73 Ga0068862_100989688 3300005844 Bacteria 831
74 Ga0081455_10000279 3300005937 Bacteria 67790
75 Ga0081455_10001643 3300005937 Bacteria 27216
76 Ga0081538_10026253 3300005981 Bacteria 4079
77 Ga0075365_10000232 3300006038 Bacteria 19058
78 Ga0075364_10002663 3300006051 Bacteria 10027
79 Ga0075364_10465764 3300006051 Bacteria 864
80 Ga0075432_10368737 3300006058 Bacteria 613
81 Ga0070716_101404856 3300006173 Bacteria 568
82 Ga0075367_10185827 3300006178 Bacteria 1296
83 Ga0075369_10070085 3300006186 Bacteria 1542
84 Ga0075428_100016259 3300006844 Bacteria 8225
85 Ga0075430_100017872 3300006846 Bacteria 6036
86 Ga0075430_100171369 3300006846 Bacteria 1806
87 Ga0075431_100001095 3300006847 Bacteria 24268
88 Ga0075431_100466128 3300006847 Bacteria 1257
89 Ga0075433_10194395 3300006852 Bacteria 1805
90 Ga0075429_100002372 3300006880 Bacteria 15859
91 Ga0075429_100117062 3300006880 Bacteria 2329
92 Ga0075436_100050922 3300006914 Bacteria 2858
93 Ga0097620_100000105 3300006931 Bacteria 78213
94 Ga0105250_10431503 3300009092 Bacteria 589
95 Ga0105240_10004666 3300009093 Bacteria 20736
96 Ga0105240_10096820 3300009093 Bacteria 3596
97 Ga0111539_10346138 3300009094 Bacteria 1730
98 Ga0111539_11284962 3300009094 Bacteria 849
99 Ga0105245_10004901 3300009098 Bacteria 11770
100 Ga0105245_10468893 3300009098 Bacteria 1271
101 Ga0105245_11057464 3300009098 Bacteria 857
102 Ga0105247_10069906 3300009101 Bacteria 2192
103 Ga0114129_10008919 3300009147 Bacteria 14294
104 Ga0114129_10174721 3300009147 Bacteria 2926
105 Ga0114129_11494546 3300009147 Bacteria 830
106 Ga0105241_10002732 3300009174 Bacteria 13225
107 Ga0105248_10240076 3300009177 Bacteria 2040
108 Ga0105248_13032722 3300009177 Bacteria 535
109 Ga0105237_10055421 3300009545 Bacteria 3970
110 Ga0105238_10000200 3300009551 Bacteria 66219
111 Ga0105238_10083046 3300009551 Bacteria 3193
112 Ga0105238_10535917 3300009551 Bacteria 1174
113 Ga0105238_11341409 3300009551 Bacteria 742
114 Ga0105249_10034506 3300009553 Bacteria 4586
115 Ga0105249_11120966 3300009553 Bacteria 857
116 Ga0105249_11878352 3300009553 Bacteria 672
117 Ga0105239_10097388 3300010375 Bacteria 3251
118 Ga0105246_10792820 3300011119 Bacteria 840
119 Ga0157371_10625257 3300013102 Bacteria 802
120 Ga0157370_10057355 3300013104 Bacteria 3703
121 Ga0157370_10465662 3300013104 Bacteria 1162
122 Ga0157369_10021748 3300013105 Bacteria 7173
123 Ga0157369_10112902 3300013105 Bacteria 2887
124 Ga0157369_10118707 3300013105 Bacteria 2807
125 Ga0157374_10014020 3300013296 Bacteria 7006
126 Ga0157374_10304111 3300013296 Bacteria 1578
127 Ga0157374_10334440 3300013296 Bacteria 1503
128 Ga0157378_11443720 3300013297 Bacteria 732
129 Ga0163162_10773505 3300013306 Bacteria 1078
130 Ga0157372_10465033 3300013307 Bacteria 1474
131 Ga0157372_10785310 3300013307 Bacteria 1107
132 Ga0157375_10361013 3300013308 Bacteria 1619
133 Ga0157375_10615601 3300013308 Bacteria 1244
134 Ga0163163_10006313 3300014325 Bacteria 10351
135 Ga0163163_10276120 3300014325 Bacteria 1732
136 Ga0163163_10740073 3300014325 Bacteria 1047
137 Ga0157380_10387424 3300014326 Bacteria 1321
138 Ga0157379_10008148 3300014968 Bacteria 9102
139 Ga0163161_10008564 3300017792 Bacteria 7076
140 Ga0197907_10146738 3300020069 Bacteria 3501
141 Ga0197907_11360295 3300020069 Bacteria 1267
142 Ga0206356_11494199 3300020070 Bacteria 1345
143 Ga0206349_1014000 3300020075 Bacteria 552
144 Ga0206349_1381826 3300020075 Bacteria 795
145 Ga0206349_1479830 3300020075 Bacteria 2130
146 Ga0206355_1316726 3300020076 Bacteria 547
147 Ga0206352_11186015 3300020078 Bacteria 556
148 Ga0206350_10181301 3300020080 Bacteria 535
149 Ga0206350_10611482 3300020080 Bacteria 2673
150 Ga0206350_11473719 3300020080 Bacteria 925
151 Ga0206354_10170047 3300020081 Bacteria 1091
152 Ga0206353_10615328 3300020082 Bacteria 1327
153 Ga0206353_11015532 3300020082 Bacteria 1046
154 Ga0154015_1123723 3300020610 Bacteria 684
155 Ga0154015_1254107 3300020610 Bacteria 604
156 Ga0213875_10049373 3300021388 Bacteria 1972
157 Ga0224712_10021902 3300022467 Bacteria 2195
158 Ga0207426_1003130 3300025302 Bacteria 9429
159 Ga0207426_1006405 3300025302 Bacteria 5128
160 Ga0207692_10008214 3300025898 Bacteria 4315
161 Ga0207680_10019945 3300025903 Bacteria 3597
162 Ga0207647_10006072 3300025904 Bacteria 8804
163 Ga0207647_10537732 3300025904 Bacteria 649
164 Ga0207643_10139529 3300025908 Bacteria 1447
165 Ga0207705_10021857 3300025909 Bacteria 4564
166 Ga0207705_10047089 3300025909 Bacteria 3100
167 Ga0207705_10066840 3300025909 Bacteria 2601
168 Ga0207705_10596976 3300025909 Bacteria 859
169 Ga0207705_10627500 3300025909 Bacteria 836
170 Ga0207684_10043036 3300025910 Bacteria 3828
171 Ga0207654_10008788 3300025911 Bacteria 5124
172 Ga0207707_10028462 3300025912 Bacteria 4884
173 Ga0207707_10109798 3300025912 Bacteria 2411
174 Ga0207695_10000449 3300025913 Bacteria 89856
175 Ga0207695_10085840 3300025913 Bacteria 3175
176 Ga0207695_10150902 3300025913 Bacteria 2263
177 Ga0207695_10359227 3300025913 Bacteria 1343
178 Ga0207671_10000052 3300025914 Bacteria 188462
179 Ga0207660_10026662 3300025917 Bacteria 3936
180 Ga0207657_10043213 3300025919 Bacteria 3971
181 Ga0207657_10510912 3300025919 Bacteria 941
182 Ga0207652_10036395 3300025921 Bacteria 4161
183 Ga0207652_10232499 3300025921 Bacteria 1661
184 Ga0207694_10000079 3300025924 Bacteria 111767
185 Ga0207694_10064237 3300025924 Bacteria 2861
186 Ga0207650_10496336 3300025925 Bacteria 1020
187 Ga0207687_10012206 3300025927 Bacteria 5619
188 Ga0207687_10678193 3300025927 Bacteria 873
189 Ga0207687_11033481 3300025927 Bacteria 705
190 Ga0207664_10000002 3300025929 Bacteria 657053
191 Ga0207664_10001960 3300025929 Bacteria 13565
192 Ga0207664_10981342 3300025929 Bacteria 757
193 Ga0207664_11157962 3300025929 Bacteria 690
194 Ga0207644_10259425 3300025931 Bacteria 1389
195 Ga0207669_10183044 3300025937 Bacteria 1504
196 Ga0207669_10329003 3300025937 Bacteria 1172
197 Ga0207711_10299671 3300025941 Bacteria 1482
198 Ga0207661_10156481 3300025944 Bacteria 1974
199 Ga0207661_10283782 3300025944 Bacteria 1480
200 Ga0207661_10652124 3300025944 Bacteria 967
201 Ga0207661_11797173 3300025944 Bacteria 558
202 Ga0207667_10007559 3300025949 Bacteria 13041
203 Ga0207667_10558974 3300025949 Bacteria 1157
204 Ga0207712_10019050 3300025961 Bacteria 4477
205 Ga0207712_10534553 3300025961 Bacteria 1006
206 Ga0207668_10197005 3300025972 Bacteria 1601
207 Ga0207640_11245965 3300025981 Bacteria 663
208 Ga0207658_11164938 3300025986 Bacteria 704
209 Ga0207703_10014023 3300026035 Bacteria 6246
210 Ga0207678_10036055 3300026067 Bacteria 4305
211 Ga0207702_10051254 3300026078 Bacteria 3487
212 Ga0207702_10165595 3300026078 Bacteria 2022
213 Ga0207702_10272313 3300026078 Bacteria 1597
214 Ga0207641_10002599 3300026088 Bacteria 16574
215 Ga0207676_11349656 3300026095 Bacteria 708
216 Ga0207674_10043157 3300026116 Bacteria 4651
217 Ga0207674_10726300 3300026116 Bacteria 959
218 Ga0207674_11460085 3300026116 Bacteria 653
219 Ga0207683_10610437 3300026121 Bacteria 1010
220 Ga0207698_10003302 3300026142 Bacteria 9694
221 Ga0207698_10505648 3300026142 Bacteria 1177
222 Ga0207698_11471300 3300026142 Bacteria 696
223 Ga0207428_10090607 3300027907 Bacteria 2375
224 Ga0268266_10005488 3300028379 Bacteria 11806
225 Ga0268266_10110952 3300028379 Bacteria 2430
226 Ga0268265_10000017 3300028380 Bacteria 293875
227 Ga0268265_11205990 3300028380 Bacteria 754
228 Ga0268264_10000114 3300028381 Bacteria 203211
229 Ga0265338_10024814 3300028800 Bacteria 6109
230 Ga0316177_1030992 3300030731 Bacteria 3993
231 Ga0316176_1183649 3300030732 Bacteria 1304
232 Ga0314311_1246044 3300030733 Bacteria 2555
233 Ga0316180_1168500 3300030736 Bacteria 2322
234 Ga0316181_1261866 3300030744 Bacteria 690
235 Ga0316182_1378382 3300030745 Bacteria 1080
236 Ga0265330_10178742 3300031235 Bacteria 899
237 Ga0265325_10014046 3300031241 Bacteria 4540
238 Ga0265340_10016902 3300031247 Bacteria 3774
239 Ga0265316_10042377 3300031344 Bacteria 3639
240 Ga0307509_10200258 3300031507 Bacteria 1835
241 Ga0307408_100121899 3300031548 Bacteria 2021
242 Ga0265313_10163486 3300031595 Bacteria 944
243 Ga0307508_10392813 3300031616 Bacteria 978
244 Ga0307405_10120463 3300031731 Bacteria 1795
245 Ga0307405_10921566 3300031731 Bacteria 740
246 Ga0307413_10031682 3300031824 Bacteria 2987
247 Ga0307413_10227598 3300031824 Bacteria 1367
248 Ga0307413_10477769 3300031824 Bacteria 995
249 Ga0307410_10005870 3300031852 Bacteria 6556
250 Ga0307410_10013411 3300031852 Bacteria 4781
251 Ga0307410_10102010 3300031852 Bacteria 2058
252 Ga0307406_10189141 3300031901 Bacteria 1505
253 Ga0307407_10168804 3300031903 Bacteria 1439
254 Ga0307407_10495648 3300031903 Bacteria 894
255 Ga0307407_10629958 3300031903 Bacteria 801
256 Ga0307407_11446750 3300031903 Bacteria 542
257 Ga0307409_100014728 3300031995 Bacteria 5101
258 Ga0307409_100034057 3300031995 Bacteria 3715
259 Ga0307409_100065734 3300031995 Bacteria 2855
260 Ga0307409_100204619 3300031995 Bacteria 1769
261 Ga0307409_100402262 3300031995 Bacteria 1308
262 Ga0307409_100891609 3300031995 Bacteria 902
263 Ga0307409_101000102 3300031995 Bacteria 854
264 Ga0307409_101055777 3300031995 Bacteria 832
265 Ga0307409_101267718 3300031995 Bacteria 761
266 Ga0307409_101857398 3300031995 Bacteria 632
267 Ga0307409_101932549 3300031995 Bacteria 619
268 Ga0307409_102760025 3300031995 Bacteria 519
269 Ga0307416_100039874 3300032002 Bacteria 3641
270 Ga0307416_100081084 3300032002 Bacteria 2742
271 Ga0307416_100086046 3300032002 Bacteria 2678
272 Ga0307416_100108398 3300032002 Bacteria 2440
273 Ga0307416_100310119 3300032002 Bacteria 1574
274 Ga0307416_100630949 3300032002 Bacteria 1154
275 Ga0307416_100832207 3300032002 Bacteria 1020
276 Ga0307416_101124116 3300032002 Bacteria 890
277 Ga0307414_10114187 3300032004 Bacteria 2063
278 Ga0307411_10334182 3300032005 Bacteria 1229
279 Ga0307411_11151658 3300032005 Bacteria 701
280 Ga0307415_100050429 3300032126 Bacteria 2820
281 Ga0307415_100228217 3300032126 Bacteria 1497
282 Ga0307507_10087453 3300033179 Bacteria 2694
283 Ga0307507_10475274 3300033179 Bacteria 682
284 Ga0373960_0136383 3300035121 Bacteria 827
285 Ga0373933_0503688 3300035724 Bacteria 793
286 Ga0373947_1229102 3300035725 Bacteria 510
287 Ga0373925_0212820 3300037068 Bacteria 1540
288 Ga0395898_0020694 3300037466 Bacteria 6678
289 Ga0395898_0623099 3300037466 Bacteria 1021
290 Ga0395905_0040904 3300037471 Bacteria 4348
291 Ga0436364_0187884 3300037853 Bacteria 5748
292 Ga0436364_0591186 3300037853 Bacteria 542
293 Ga0436364_1071345 3300037853 Bacteria 646
294 Ga0395901_0052983 3300038443 Bacteria 4216
295 Ga0395901_1935556 3300038443 Bacteria 537
296 Ga0436363_1159262 3300039450 Bacteria 551
297 Ga0451789_0988145 3300041443 Bacteria 1149
298 Ga0451791_1784907 3300041451 Bacteria 617
299 Ga0451802_0357782 3300041460 Bacteria 1183
300 Ga0439442_012032 3300042002 Bacteria 1767
301 Ga0450888_001799 3300042126 Bacteria 2072
302 Ga0450894_076503 3300042131 Bacteria 518
303 Ga0450909_057683 3300042185 Bacteria 611
304 Ga0439444_0095223 3300042437 Bacteria 669
305 Ga0466969_0144751 3300044656 Bacteria 1097
306 Ga0466969_0281244 3300044656 Bacteria 753
307 Ga0466972_0009806 3300044658 Bacteria 4809
308 Ga0466972_0011691 3300044658 Bacteria 4407
309 Ga0466972_0113864 3300044658 Bacteria 1277
310 Ga0466972_0130478 3300044658 Bacteria 1184
311 Ga0466972_0273244 3300044658 Bacteria 790
312 Ga0466965_0028095 3300044683 Bacteria 2731
313 Ga0466965_0321741 3300044683 Bacteria 842
314 Ga0466965_0370217 3300044683 Bacteria 787
315 Ga0466965_0436900 3300044683 Bacteria 727
316 Ga0466966_0016828 3300044684 Bacteria 4831
317 Ga0466966_0033072 3300044684 Bacteria 3348
318 Ga0466966_0080685 3300044684 Bacteria 2026
319 Ga0466966_0148766 3300044684 Bacteria 1429
320 Ga0466966_0553252 3300044684 Bacteria 692
321 Ga0466966_0641749 3300044684 Bacteria 639
322 Ga0466961_0067058 3300044693 Bacteria 2279
323 Ga0466961_0082954 3300044693 Bacteria 2027
324 Ga0466961_0085963 3300044693 Bacteria 1988
325 Ga0466961_0166036 3300044693 Bacteria 1374
326 Ga0466961_0249536 3300044693 Bacteria 1090
327 Ga0466961_0265327 3300044693 Bacteria 1052
328 Ga0466963_0041604 3300044694 Bacteria 3014
329 Ga0466963_0204681 3300044694 Bacteria 1380
330 Ga0466964_0507626 3300044706 Bacteria 648
331 Ga0466964_0764209 3300044706 Bacteria 543
332 Ga0466971_0103126 3300044719 Bacteria 1312
333 Ga0466971_0112046 3300044719 Bacteria 1259
334 Ga0466971_0139056 3300044719 Bacteria 1130
335 Ga0466968_0107645 3300044735 Bacteria 1251
336 Ga0466968_0165856 3300044735 Bacteria 1021
337 Ga0466968_0594945 3300044735 Bacteria 558
338 Ga0466968_0620228 3300044735 Bacteria 547
339 Ga0466970_0015779 3300044765 Bacteria 3888
340 Ga0466970_0133761 3300044765 Bacteria 1363
341 Ga0466970_0187877 3300044765 Bacteria 1147
342 Ga0466970_0896214 3300044765 Bacteria 521
343 Ga0466957_0002798 3300044842 Bacteria 9434
344 Ga0466957_0232014 3300044842 Bacteria 1222
345 Ga0466957_0239517 3300044842 Bacteria 1203
346 Ga0466957_1296398 3300044842 Bacteria 528
347 Ga0466960_0043699 3300044901 Bacteria 2133
348 Ga0466960_0073582 3300044901 Bacteria 1705
349 Ga0466960_0102818 3300044901 Bacteria 1474
350 Ga0466960_0110695 3300044901 Bacteria 1426
351 Ga0466960_0502701 3300044901 Bacteria 710
352 Ga0466960_0731271 3300044901 Bacteria 595
353 Ga0466960_0791159 3300044901 Bacteria 574
354 Ga0466960_0806908 3300044901 Bacteria 568
355 Ga0466959_0009500 3300045049 Bacteria 6919
356 Ga0466959_0042588 3300045049 Bacteria 3348
357 Ga0466959_0083944 3300045049 Bacteria 2293
358 Ga0466959_0088219 3300045049 Bacteria 2230
359 Ga0466959_0096677 3300045049 Bacteria 2117
360 Ga0466959_0333560 3300045049 Bacteria 1035
361 Ga0466959_0402969 3300045049 Bacteria 930
362 Ga0466959_1190938 3300045049 Bacteria 506
363 Ga0466958_0001883 3300045836 Bacteria 10248
364 Ga0466958_0004465 3300045836 Bacteria 7385
365 Ga0466958_0094524 3300045836 Bacteria 1852
366 Ga0466958_0267081 3300045836 Bacteria 1095
367 Ga0466958_0366415 3300045836 Bacteria 928
368 Ga0466958_0570495 3300045836 Bacteria 735
369 Ga0466958_0712149 3300045836 Bacteria 654
370 Ga0466967_0007198 3300045976 Bacteria 7992
371 Ga0466967_0024742 3300045976 Bacteria 4941
372 Ga0466967_0036773 3300045976 Bacteria 4183
373 Ga0466967_0047098 3300045976 Bacteria 3757
374 Ga0466967_0118595 3300045976 Bacteria 2441
375 Ga0466967_0206203 3300045976 Bacteria 1863
376 Ga0466967_0572167 3300045976 Bacteria 1113
377 Ga0466967_0651422 3300045976 Bacteria 1041
378 Ga0466967_1302545 3300045976 Bacteria 724
379 Ga0466967_2518995 3300045976 Bacteria 509
380 Ga0495592_0014738 3300046454 Bacteria 5935
381 Ga0495592_0434666 3300046454 Bacteria 825
382 Ga0495603_0688834 3300046455 Bacteria 584
383 Ga0495651_0102090 3300046462 Bacteria 2133
384 Ga0495664_0072404 3300046477 Bacteria 2059
385 Ga0495664_0158884 3300046477 Bacteria 1371
386 Ga0495585_0007633 3300046492 Bacteria 6610
387 Ga0495594_0123460 3300046499 Bacteria 1464
388 Ga0495608_0100348 3300046511 Bacteria 1867
389 Ga0495608_0337371 3300046511 Bacteria 929
390 Ga0495608_0453483 3300046511 Bacteria 780
391 Ga0495628_0017257 3300046516 Bacteria 6011
392 Ga0495628_0146049 3300046516 Bacteria 1803
393 Ga0495628_0275727 3300046516 Bacteria 1250
394 Ga0495628_0298859 3300046516 Bacteria 1192
395 Ga0495628_0629362 3300046516 Bacteria 764
396 Ga0495666_0049647 3300046526 Bacteria 2018
397 Ga0495652_0002488 3300046529 Bacteria 18923
398 Ga0495652_0058334 3300046529 Bacteria 3268
399 Ga0495640_0010696 3300046533 Bacteria 7077
400 Ga0495640_0052439 3300046533 Bacteria 2801
401 Ga0495640_0804173 3300046533 Bacteria 560
402 Ga0495598_0240624 3300046537 Bacteria 667
403 Ga0495597_0394486 3300046542 Bacteria 527
404 Ga0495622_0158502 3300046557 Bacteria 1021
405 Ga0495622_0172855 3300046557 Bacteria 971
406 Ga0495667_0061566 3300046559 Bacteria 2461
407 Ga0495667_0117976 3300046559 Bacteria 1714
408 Ga0495656_0762579 3300046615 Bacteria 522
409 Ga0495634_0073842 3300046642 Bacteria 2242
410 Ga0495611_0231875 3300046648 Bacteria 858
411 Ga0495611_0429563 3300046648 Bacteria 603
412 Ga0495635_0297603 3300046663 Bacteria 1082
413 Ga0495635_0799649 3300046663 Bacteria 608
414 Ga0495661_0561441 3300046665 Bacteria 539
415 Ga0495657_0016789 3300046675 Bacteria 5323
416 Ga0495657_0351840 3300046675 Bacteria 872
417 Ga0495599_0491685 3300046678 Bacteria 723
418 Ga0495623_0363109 3300046679 Bacteria 786
419 Ga0495623_0572226 3300046679 Bacteria 589
420 Ga0495658_0872011 3300046683 Bacteria 576
421 Ga0495613_0096521 3300046689 Bacteria 2137
422 Ga0495624_0010963 3300046690 Bacteria 6244
423 Ga0495670_0497851 3300046691 Bacteria 662
424 Ga0495589_0039709 3300046794 Bacteria 2351
425 Ga0495600_0006480 3300046809 Bacteria 7124
426 Ga0495600_0085957 3300046809 Bacteria 2052
427 Ga0495600_0264836 3300046809 Bacteria 1091
428 Ga0495604_0004434 3300047317 Bacteria 11118
429 Ga0495604_0110104 3300047317 Bacteria 2009
430 Ga0495604_0126702 3300047317 Bacteria 1840
431 Ga0495636_0366980 3300047318 Bacteria 681
432 Ga0495636_0455193 3300047318 Bacteria 615
433 Ga0495676_0002202 3300047321 Bacteria 17267
434 Ga0495680_0138054 3300047322 Bacteria 1786
435 Ga0495675_0047646 3300047444 Bacteria 2727
436 Ga0495685_151371 3300047447 Bacteria 753
437 Ga0495685_255608 3300047447 Bacteria 555
438 Ga0495602_0508238 3300048088 Bacteria 841
439 Ga0495602_0607064 3300048088 Bacteria 752
440 Ga0496100_0459137 3300048903 Bacteria 977
441 Ga0496100_0588286 3300048903 Bacteria 863
442 Ga0496101_0358449 3300048904 Bacteria 1146
443 Ga0496102_0054734 3300048905 Bacteria 3639
444 Ga0496103_0213498 3300048906 Bacteria 1241
445 Ga0496104_0002424 3300048907 Bacteria 16066
446 Ga0496105_0010288 3300048908 Bacteria 7354
447 Ga0496106_0157219 3300048909 Bacteria 1796
448 Ga0496106_0417083 3300048909 Bacteria 1079
449 Ga0496106_1203598 3300048909 Bacteria 591
450 Ga0496107_0292597 3300048910 Bacteria 1212
451 Ga0496107_0538236 3300048910 Bacteria 865
452 Ga0496108_0009511 3300048911 Bacteria 7873
453 Ga0496108_0233917 3300048911 Bacteria 1598
454 Ga0496108_1452345 3300048911 Bacteria 572
455 Ga0496109_0004867 3300048912 Bacteria 11210
456 Ga0496109_1215491 3300048912 Bacteria 690
457 Ga0496109_1881421 3300048912 Bacteria 531
458 Ga0496110_0009977 3300048913 Bacteria 7703
459 Ga0496111_0000232 3300048914 Bacteria 26683
460 Ga0496112_0834172 3300048915 Bacteria 846
461 Ga0496113_0003587 3300048916 Bacteria 9318
462 Ga0496113_0006111 3300048916 Bacteria 7599
463 Ga0496114_0360495 3300048917 Bacteria 1286
464 Ga0496114_0393050 3300048917 Bacteria 1228
465 Ga0496115_0086150 3300048918 Bacteria 2563
466 Ga0496119_0000153 3300048922 Bacteria 95945
467 Ga0496119_0353646 3300048922 Bacteria 711
468 Ga0496120_0007596 3300048923 Bacteria 8039
469 Ga0496124_0495357 3300048927 Bacteria 821
470 Ga0496126_0027934 3300048929 Bacteria 5381
471 Ga0501309_087420 3300049129 Bacteria 528
472 Ga0501312_088140 3300049528 Bacteria 569
473 Ga0501317_074691 3300049533 Bacteria 577
474 Ga0501317_110341 3300049533 Bacteria 505
475 Ga0501320_043844 3300049536 Bacteria 593
476 Ga0501031_0001703 3300049568 Bacteria 13799
477 Ga0501031_0031473 3300049568 Bacteria 3461
478 Ga0501031_0264088 3300049568 Bacteria 1118
479 Ga0501031_0279982 3300049568 Bacteria 1082
480 Ga0501031_0557730 3300049568 Bacteria 738
481 Ga0501032_0000592 3300049569 Bacteria 29230
482 Ga0501032_0011479 3300049569 Bacteria 6363
483 Ga0501032_0054351 3300049569 Bacteria 2695
484 Ga0501032_0508645 3300049569 Bacteria 769
485 Ga0501033_0002518 3300049570 Bacteria 15511
486 Ga0501033_0003378 3300049570 Bacteria 13168
487 Ga0501033_0024597 3300049570 Bacteria 4542
488 Ga0501033_0064445 3300049570 Bacteria 2697
489 Ga0501034_0001638 3300049571 Bacteria 28947
490 Ga0501034_0026039 3300049571 Bacteria 5958
491 Ga0501034_0265913 3300049571 Bacteria 1657
492 Ga0501034_0444317 3300049571 Bacteria 1215
493 Ga0501036_0002015 3300049572 Bacteria 15801
494 Ga0501036_0072166 3300049572 Bacteria 2918
495 Ga0501036_0184748 3300049572 Bacteria 1754
496 Ga0501036_0463284 3300049572 Bacteria 1055
497 Ga0501037_0003778 3300049573 Bacteria 10984
498 Ga0501037_0041481 3300049573 Bacteria 3384
499 Ga0501037_0050613 3300049573 Bacteria 3040
500 Ga0501037_0114611 3300049573 Bacteria 1940
501 Ga0501037_0790613 3300049573 Bacteria 627
502 Ga0501038_0001745 3300049574 Bacteria 20203
503 Ga0501038_0010821 3300049574 Bacteria 8337
504 Ga0501038_0014435 3300049574 Bacteria 7200
505 Ga0501038_0030775 3300049574 Bacteria 4745
506 Ga0501038_0212167 3300049574 Bacteria 1548
507 Ga0501038_0980263 3300049574 Bacteria 621
508 Ga0501039_0002815 3300049575 Bacteria 13000
509 Ga0501039_0005824 3300049575 Bacteria 9331
510 Ga0501039_0059211 3300049575 Bacteria 2967
511 Ga0501039_0191909 3300049575 Bacteria 1606
512 Ga0501040_0030335 3300049576 Bacteria 3652
513 Ga0501040_0034767 3300049576 Bacteria 3414
514 Ga0501041_0006491 3300049577 Bacteria 6846
515 Ga0501041_0006584 3300049577 Bacteria 6803
516 Ga0501042_0004398 3300049578 Bacteria 8989
517 Ga0501042_0009798 3300049578 Bacteria 6401
518 Ga0501042_0036577 3300049578 Bacteria 3483
519 Ga0501042_1229340 3300049578 Bacteria 546
520 Ga0501043_0001121 3300049579 Bacteria 23501
521 Ga0501043_0087083 3300049579 Bacteria 2454
522 Ga0501043_0102337 3300049579 Bacteria 2251
523 Ga0501046_0000406 3300049580 Bacteria 43051
524 Ga0501046_0003431 3300049580 Bacteria 14548
525 Ga0501047_0001699 3300049581 Bacteria 21398
526 Ga0501047_0017968 3300049581 Bacteria 6778
527 Ga0501048_0008834 3300049582 Bacteria 7590
528 Ga0501048_0102264 3300049582 Bacteria 2022
529 Ga0501067_0006646 3300049583 Bacteria 6415
530 Ga0501068_0000733 3300049584 Bacteria 16812
531 Ga0501068_0801083 3300049584 Bacteria 618
532 Ga0501069_0000556 3300049585 Bacteria 17173
533 Ga0501070_0001359 3300049586 Bacteria 21923
534 Ga0501070_0004325 3300049586 Bacteria 12209
535 Ga0501070_0041445 3300049586 Bacteria 3836
536 Ga0501070_0076062 3300049586 Bacteria 2779
537 Ga0501070_0251732 3300049586 Bacteria 1445
538 Ga0501070_0839426 3300049586 Bacteria 719
539 Ga0501071_0012027 3300049587 Bacteria 5850
540 Ga0501071_0696299 3300049587 Bacteria 782
541 Ga0501071_0704460 3300049587 Bacteria 777
542 Ga0501072_0002260 3300049588 Bacteria 14395
543 Ga0501072_1240173 3300049588 Bacteria 579
544 Ga0501073_0002957 3300049589 Bacteria 12748
545 Ga0501073_0080793 3300049589 Bacteria 2261
546 Ga0501073_0225440 3300049589 Bacteria 1295
547 Ga0501074_0002006 3300049590 Bacteria 14029
548 Ga0501074_0003956 3300049590 Bacteria 10559
549 Ga0501074_0519586 3300049590 Bacteria 843
550 Ga0501075_0038887 3300049591 Bacteria 3558
551 Ga0501075_0974126 3300049591 Bacteria 644
552 Ga0501076_0048090 3300049592 Bacteria 3372
553 Ga0501077_0048726 3300049593 Bacteria 2692
554 Ga0501077_0124057 3300049593 Bacteria 1637
555 Ga0501206_013255 3300049653 Bacteria 1126
556 Ga0501223_070310 3300049663 Bacteria 691
557 Ga0501252_050388 3300049682 Bacteria 627
558 Ga0501253_026940 3300049683 Bacteria 1064
559 Ga0501261_109609 3300049690 Bacteria 535
560 Ga0501079_0000971 3300049741 Bacteria 19779
561 Ga0501079_0002345 3300049741 Bacteria 13734
562 Ga0501079_0231074 3300049741 Bacteria 1445
563 Ga0501080_0001014 3300049742 Bacteria 23076
564 Ga0501080_0003445 3300049742 Bacteria 13964
565 Ga0501080_0048084 3300049742 Bacteria 3971
566 Ga0501080_0061046 3300049742 Bacteria 3510
567 Ga0501080_0738685 3300049742 Bacteria 866
568 Ga0501081_0098165 3300049743 Bacteria 2068
569 Ga0501083_0002438 3300049744 Bacteria 12724
570 Ga0501264_051717 3300049761 Bacteria 532
571 Ga0501035_0015110 3300049822 Bacteria 7124
572 Ga0501035_0026404 3300049822 Bacteria 5312
573 Ga0501035_0205651 3300049822 Bacteria 1686
574 Ga0501035_0511431 3300049822 Bacteria 987
575 Ga0501044_0007315 3300049823 Bacteria 12134
576 Ga0501044_0062211 3300049823 Bacteria 3815
577 Ga0501044_0106104 3300049823 Bacteria 2821
578 Ga0501045_0002389 3300049824 Bacteria 12748
579 Ga0501045_0081851 3300049824 Bacteria 2381
580 Ga0501045_0082131 3300049824 Bacteria 2376
581 Ga0501045_1217161 3300049824 Bacteria 549
582 nmdc:mga00v17_2126_c1 3300050491 Bacteria 10185
583 nmdc:mga00v17_406425_c1 3300050491 Unclassified 885
584 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
585 nmdc:mga05p37_22037_c1 3300050507 Bacteria 7720
586 nmdc:mga05p37_309756_c1 3300050507 Bacteria 1872
587 nmdc:mga09592_763_c1 3300050508 Bacteria 24805
588 nmdc:mga0qj67_47938_c1 3300050509 Bacteria 3376
589 nmdc:mga06r32_2275_c1 3300050510 Bacteria 17172
590 nmdc:mga06r32_3618_c1 3300050510 Bacteria 13792
591 nmdc:mga08y16_959_c1 3300050511 Bacteria 28003
592 nmdc:mga08x19_1119133_c1 3300050514 Bacteria 559
593 nmdc:mga0sz30_243661_c1 3300050516 Unclassified 800
594 nmdc:mga0sz30_33607_c2 3300050516 Bacteria 1542
595 Ga0495612_0266266 3300053078 Bacteria 764
596 Ga0495655_0235805 3300053083 Bacteria 610
597 Ga0500562_104562 3300053108 Bacteria 771
598 Ga0500559_0005952 3300053136 Bacteria 5543
599 Ga0500573_0056693 3300053140 Bacteria 2249
600 Ga0500596_050195 3300053735 Bacteria 681
601 Ga0500587_049522 3300053739 Bacteria 620
602 Ga0501084_0002773 3300054114 Bacteria 14156
603 Ga0501084_0279847 3300054114 Bacteria 1409
604 Ga0501084_0501546 3300054114 Bacteria 1026
605 Ga0501084_0966011 3300054114 Bacteria 716
606 Ga0587066_210246 3300059490 Bacteria 516
607 Ga0587082_053982 3300059504 Bacteria 775
608 Ga0587082_122650 3300059504 Bacteria 589
609 Ga0587121_15153 3300059606 Bacteria 511
610 Ga0587109_056528 3300059624 Bacteria 817
611 Ga0587113_033379 3300059625 Bacteria 593
612 Ga0587113_050896 3300059625 Bacteria 517
613 Ga0587122_049863 3300059628 Bacteria 541
614 Ga0587068_099797 3300059641 Bacteria 608
615 Ga0587069_072142 3300059642 Bacteria 658
616 Ga0587069_131963 3300059642 Bacteria 539
617 Ga0587076_166247 3300059645 Bacteria 546
618 Ga0587102_063614 3300059649 Bacteria 519
619 Ga0587102_066089 3300059649 Bacteria 513
620 Ga0587107_072784 3300059652 Bacteria 631
621 Ga0587110_063771 3300059654 Bacteria 514
622 Ga0587114_096335 3300059655 Bacteria 571
623 Ga0501082_0004680 3300060353 Bacteria 11932
624 Ga0466962_0009080 3300061719 Bacteria 4762
625 Ga0466962_0019002 3300061719 Bacteria 3301
626 Ga0466962_0047768 3300061719 Bacteria 2045
627 Ga0466962_0256047 3300061719 Bacteria 861
628 Ga0466962_0476124 3300061719 Bacteria 630
629 Ga0466962_0722113 3300061719 Bacteria 512
630 Ga0530510_0037224 3300061734 Bacteria 3508
631 Ga0530510_0152061 3300061734 Bacteria 1709
632 2517760623 2517572101 Bacteria 6884336
633 2623501671 2622736605 Bacteria 4992138
634 2643763894 2643221548 Bacteria 8053412
635 2644017600 2643221601 Bacteria 7493239
636 2644173440 2643221631 Bacteria 8168043
637 2644461672 2643221682 Bacteria 6743283
638 2753075917 2751185734 Bacteria 8863695
639 2819740708 2818991472 Bacteria 10089953
640 2867480149 2867475112 Bacteria 6909112
641 2870727202 2870721527 Bacteria 9689237
642 2880495542 2880489317 Bacteria 7096270
643 2929225436 2929219909 Bacteria 6984360
644 2935394578 2935390628 Bacteria 7043367
645 2966600951 2966598605 Bacteria 7676064
646 2997453172 2997451912 Bacteria 8492419
647 3001890776 3001889506 Bacteria 2975194
648 3006396070 3006393351 Bacteria 6615579
649 8047717041 8047710418 Bacteria 11023148
650 8054161102 8054160619 Bacteria 7783213
651 Ga0070708_100481607
652 LJQas_1018315
653 Ga0032354_1031616
654 JGI25405J52794_10013171
655 JGI25405J52794_10166103
656 Ga0058861_12043763
657 Ga0058861_12078238
658 Ga0058862_10001739
659 Ga0058862_10077924
660 Ga0058862_12850602
661 Ga0070658_10017874
662 Ga0070658_10094707
663 Ga0070658_10520099
664 Ga0070658_11379491
665 Ga0070683_100080480
666 Ga0070683_100452893
667 Ga0070683_100466395
668 Ga0070683_100726140
669 Ga0070666_10005041
670 Ga0070680_100041680
671 Ga0070682_100455811
672 Ga0068868_100628858
673 Ga0070660_100032980
674 Ga0070691_10030940
675 Ga0070692_10481161
676 Ga0070668_100097899
677 Ga0070671_100054089
678 Ga0070674_100434659
679 Ga0070667_100080328
680 Ga0070667_100184756
681 Ga0070667_101959893
682 Ga0070714_100735976
683 Ga0070710_10000038
684 Ga0070663_100014057
685 Ga0070678_100903050
686 Ga0070678_101265695
687 Ga0070681_10021980
688 Ga0070681_10781681
689 Ga0070685_11283246
690 Ga0070706_100259425
691 Ga0070679_100051213
692 Ga0070679_100112026
693 Ga0070684_100003045
694 Ga0070684_100276279
695 Ga0070684_100565581
696 Ga0070693_101168777
697 Ga0070665_100032457
698 Ga0070665_100096289
699 Ga0070665_100168944
700 Ga0070665_100339121
701 Ga0068855_100012855
702 Ga0068855_100510147
703 Ga0068855_100637293
704 Ga0068857_100120413
705 Ga0068854_100025068
706 Ga0068856_100019532
707 Ga0068856_100501726
708 Ga0068856_100641565
709 Ga0068856_100900506
710 Ga0068856_101641855
711 Ga0070702_100312471
712 Ga0068852_100017691
713 Ga0068852_100073680
714 Ga0068852_100379310
715 Ga0068859_100000105
716 Ga0068861_101460250
717 Ga0068861_102715629
718 Ga0068863_100000263
719 Ga0068858_100009275
720 Ga0068858_100409234
721 Ga0068860_100000067
722 Ga0068862_100000025
723 Ga0068862_100989688
724 Ga0081455_10000279
725 Ga0081455_10001643
726 Ga0081538_10026253
727 Ga0075365_10000232
728 Ga0075364_10002663
729 Ga0075364_10465764
730 Ga0075432_10368737
731 Ga0070716_101404856
732 Ga0075367_10185827
733 Ga0075369_10070085
734 Ga0075428_100016259
735 Ga0075430_100017872
736 Ga0075430_100171369
737 Ga0075431_100001095
738 Ga0075431_100466128
739 Ga0075433_10194395
740 Ga0075429_100002372
741 Ga0075429_100117062
742 Ga0075436_100050922
743 Ga0097620_100000105
744 Ga0105250_10431503
745 Ga0105240_10004666
746 Ga0105240_10096820
747 Ga0111539_10346138
748 Ga0111539_11284962
749 Ga0105245_10004901
750 Ga0105245_10468893
751 Ga0105245_11057464
752 Ga0105247_10069906
753 Ga0114129_10008919
754 Ga0114129_10174721
755 Ga0114129_11494546
756 Ga0105241_10002732
757 Ga0105248_10240076
758 Ga0105248_13032722
759 Ga0105237_10055421
760 Ga0105238_10000200
761 Ga0105238_10083046
762 Ga0105238_10535917
763 Ga0105238_11341409
764 Ga0105249_10034506
765 Ga0105249_11120966
766 Ga0105249_11878352
767 Ga0105239_10097388
768 Ga0105246_10792820
769 Ga0157371_10625257
770 Ga0157370_10057355
771 Ga0157370_10465662
772 Ga0157369_10021748
773 Ga0157369_10112902
774 Ga0157369_10118707
775 Ga0157374_10014020
776 Ga0157374_10304111
777 Ga0157374_10334440
778 Ga0157378_11443720
779 Ga0163162_10773505
780 Ga0157372_10465033
781 Ga0157372_10785310
782 Ga0157375_10361013
783 Ga0157375_10615601
784 Ga0163163_10006313
785 Ga0163163_10276120
786 Ga0163163_10740073
787 Ga0157380_10387424
788 Ga0157379_10008148
789 Ga0163161_10008564
790 Ga0197907_10146738
791 Ga0197907_11360295
792 Ga0206356_11494199
793 Ga0206349_1014000
794 Ga0206349_1381826
795 Ga0206349_1479830
796 Ga0206355_1316726
797 Ga0206352_11186015
798 Ga0206350_10181301
799 Ga0206350_10611482
800 Ga0206350_11473719
801 Ga0206354_10170047
802 Ga0206353_10615328
803 Ga0206353_11015532
804 Ga0154015_1123723
805 Ga0154015_1254107
806 Ga0213875_10049373
807 Ga0224712_10021902
808 Ga0207426_1003130
809 Ga0207426_1006405
810 Ga0207692_10008214
811 Ga0207680_10019945
812 Ga0207647_10006072
813 Ga0207647_10537732
814 Ga0207643_10139529
815 Ga0207705_10021857
816 Ga0207705_10047089
817 Ga0207705_10066840
818 Ga0207705_10596976
819 Ga0207705_10627500
820 Ga0207684_10043036
821 Ga0207654_10008788
822 Ga0207707_10028462
823 Ga0207707_10109798
824 Ga0207695_10000449
825 Ga0207695_10085840
826 Ga0207695_10150902
827 Ga0207695_10359227
828 Ga0207671_10000052
829 Ga0207660_10026662
830 Ga0207657_10043213
831 Ga0207657_10510912
832 Ga0207652_10036395
833 Ga0207652_10232499
834 Ga0207694_10000079
835 Ga0207694_10064237
836 Ga0207650_10496336
837 Ga0207687_10012206
838 Ga0207687_10678193
839 Ga0207687_11033481
840 Ga0207664_10000002
841 Ga0207664_10001960
842 Ga0207664_10981342
843 Ga0207664_11157962
844 Ga0207644_10259425
845 Ga0207669_10183044
846 Ga0207669_10329003
847 Ga0207711_10299671
848 Ga0207661_10156481
849 Ga0207661_10283782
850 Ga0207661_10652124
851 Ga0207661_11797173
852 Ga0207667_10007559
853 Ga0207667_10558974
854 Ga0207712_10019050
855 Ga0207712_10534553
856 Ga0207668_10197005
857 Ga0207640_11245965
858 Ga0207658_11164938
859 Ga0207703_10014023
860 Ga0207678_10036055
861 Ga0207702_10051254
862 Ga0207702_10165595
863 Ga0207702_10272313
864 Ga0207641_10002599
865 Ga0207676_11349656
866 Ga0207674_10043157
867 Ga0207674_10726300
868 Ga0207674_11460085
869 Ga0207683_10610437
870 Ga0207698_10003302
871 Ga0207698_10505648
872 Ga0207698_11471300
873 Ga0207428_10090607
874 Ga0268266_10005488
875 Ga0268266_10110952
876 Ga0268265_10000017
877 Ga0268265_11205990
878 Ga0268264_10000114
879 Ga0265338_10024814
880 Ga0316177_1030992
881 Ga0316176_1183649
882 Ga0314311_1246044
883 Ga0316180_1168500
884 Ga0316181_1261866
885 Ga0316182_1378382
886 Ga0265330_10178742
887 Ga0265325_10014046
888 Ga0265340_10016902
889 Ga0265316_10042377
890 Ga0307509_10200258
891 Ga0307408_100121899
892 Ga0265313_10163486
893 Ga0307508_10392813
894 Ga0307405_10120463
895 Ga0307405_10921566
896 Ga0307413_10031682
897 Ga0307413_10227598
898 Ga0307413_10477769
899 Ga0307410_10005870
900 Ga0307410_10013411
901 Ga0307410_10102010
902 Ga0307406_10189141
903 Ga0307407_10168804
904 Ga0307407_10495648
905 Ga0307407_10629958
906 Ga0307407_11446750
907 Ga0307409_100014728
908 Ga0307409_100034057
909 Ga0307409_100065734
910 Ga0307409_100204619
911 Ga0307409_100402262
912 Ga0307409_100891609
913 Ga0307409_101000102
914 Ga0307409_101055777
915 Ga0307409_101267718
916 Ga0307409_101857398
917 Ga0307409_101932549
918 Ga0307409_102760025
919 Ga0307416_100039874
920 Ga0307416_100081084
921 Ga0307416_100086046
922 Ga0307416_100108398
923 Ga0307416_100310119
924 Ga0307416_100630949
925 Ga0307416_100832207
926 Ga0307416_101124116
927 Ga0307414_10114187
928 Ga0307411_10334182
929 Ga0307411_11151658
930 Ga0307415_100050429
931 Ga0307415_100228217
932 Ga0307507_10087453
933 Ga0307507_10475274
934 Ga0373960_0136383
935 Ga0373933_0503688
936 Ga0373947_1229102
937 Ga0373925_0212820
938 Ga0395898_0020694
939 Ga0395898_0623099
940 Ga0395905_0040904
941 Ga0436364_0187884
942 Ga0436364_0591186
943 Ga0436364_1071345
944 Ga0395901_0052983
945 Ga0395901_1935556
946 Ga0436363_1159262
947 Ga0451789_0988145
948 Ga0451791_1784907
949 Ga0451802_0357782
950 Ga0439442_012032
951 Ga0450888_001799
952 Ga0450894_076503
953 Ga0450909_057683
954 Ga0439444_0095223
955 Ga0466969_0144751
956 Ga0466969_0281244
957 Ga0466972_0009806
958 Ga0466972_0011691
959 Ga0466972_0113864
960 Ga0466972_0130478
961 Ga0466972_0273244
962 Ga0466965_0028095
963 Ga0466965_0321741
964 Ga0466965_0370217
965 Ga0466965_0436900
966 Ga0466966_0016828
967 Ga0466966_0033072
968 Ga0466966_0080685
969 Ga0466966_0148766
970 Ga0466966_0553252
971 Ga0466966_0641749
972 Ga0466961_0067058
973 Ga0466961_0082954
974 Ga0466961_0085963
975 Ga0466961_0166036
976 Ga0466961_0249536
977 Ga0466961_0265327
978 Ga0466963_0041604
979 Ga0466963_0204681
980 Ga0466964_0507626
981 Ga0466964_0764209
982 Ga0466971_0103126
983 Ga0466971_0112046
984 Ga0466971_0139056
985 Ga0466968_0107645
986 Ga0466968_0165856
987 Ga0466968_0594945
988 Ga0466968_0620228
989 Ga0466970_0015779
990 Ga0466970_0133761
991 Ga0466970_0187877
992 Ga0466970_0896214
993 Ga0466957_0002798
994 Ga0466957_0232014
995 Ga0466957_0239517
996 Ga0466957_1296398
997 Ga0466960_0043699
998 Ga0466960_0073582
999 Ga0466960_0102818
1000 Ga0466960_0110695
1001 Ga0466960_0502701
1002 Ga0466960_0731271
1003 Ga0466960_0791159
1004 Ga0466960_0806908
1005 Ga0466959_0009500
1006 Ga0466959_0042588
1007 Ga0466959_0083944
1008 Ga0466959_0088219
1009 Ga0466959_0096677
1010 Ga0466959_0333560
1011 Ga0466959_0402969
1012 Ga0466959_1190938
1013 Ga0466958_0001883
1014 Ga0466958_0004465
1015 Ga0466958_0094524
1016 Ga0466958_0267081
1017 Ga0466958_0366415
1018 Ga0466958_0570495
1019 Ga0466958_0712149
1020 Ga0466967_0007198
1021 Ga0466967_0024742
1022 Ga0466967_0036773
1023 Ga0466967_0047098
1024 Ga0466967_0118595
1025 Ga0466967_0206203
1026 Ga0466967_0572167
1027 Ga0466967_0651422
1028 Ga0466967_1302545
1029 Ga0466967_2518995
1030 Ga0495592_0014738
1031 Ga0495592_0434666
1032 Ga0495603_0688834
1033 Ga0495651_0102090
1034 Ga0495664_0072404
1035 Ga0495664_0158884
1036 Ga0495585_0007633
1037 Ga0495594_0123460
1038 Ga0495608_0100348
1039 Ga0495608_0337371
1040 Ga0495608_0453483
1041 Ga0495628_0017257
1042 Ga0495628_0146049
1043 Ga0495628_0275727
1044 Ga0495628_0298859
1045 Ga0495628_0629362
1046 Ga0495666_0049647
1047 Ga0495652_0002488
1048 Ga0495652_0058334
1049 Ga0495640_0010696
1050 Ga0495640_0052439
1051 Ga0495640_0804173
1052 Ga0495598_0240624
1053 Ga0495597_0394486
1054 Ga0495622_0158502
1055 Ga0495622_0172855
1056 Ga0495667_0061566
1057 Ga0495667_0117976
1058 Ga0495656_0762579
1059 Ga0495634_0073842
1060 Ga0495611_0231875
1061 Ga0495611_0429563
1062 Ga0495635_0297603
1063 Ga0495635_0799649
1064 Ga0495661_0561441
1065 Ga0495657_0016789
1066 Ga0495657_0351840
1067 Ga0495599_0491685
1068 Ga0495623_0363109
1069 Ga0495623_0572226
1070 Ga0495658_0872011
1071 Ga0495613_0096521
1072 Ga0495624_0010963
1073 Ga0495670_0497851
1074 Ga0495589_0039709
1075 Ga0495600_0006480
1076 Ga0495600_0085957
1077 Ga0495600_0264836
1078 Ga0495604_0004434
1079 Ga0495604_0110104
1080 Ga0495604_0126702
1081 Ga0495636_0366980
1082 Ga0495636_0455193
1083 Ga0495676_0002202
1084 Ga0495680_0138054
1085 Ga0495675_0047646
1086 Ga0495685_151371
1087 Ga0495685_255608
1088 Ga0495602_0508238
1089 Ga0495602_0607064
1090 Ga0496100_0459137
1091 Ga0496100_0588286
1092 Ga0496101_0358449
1093 Ga0496102_0054734
1094 Ga0496103_0213498
1095 Ga0496104_0002424
1096 Ga0496105_0010288
1097 Ga0496106_0157219
1098 Ga0496106_0417083
1099 Ga0496106_1203598
1100 Ga0496107_0292597
1101 Ga0496107_0538236
1102 Ga0496108_0009511
1103 Ga0496108_0233917
1104 Ga0496108_1452345
1105 Ga0496109_0004867
1106 Ga0496109_1215491
1107 Ga0496109_1881421
1108 Ga0496110_0009977
1109 Ga0496111_0000232
1110 Ga0496112_0834172
1111 Ga0496113_0003587
1112 Ga0496113_0006111
1113 Ga0496114_0360495
1114 Ga0496114_0393050
1115 Ga0496115_0086150
1116 Ga0496119_0000153
1117 Ga0496119_0353646
1118 Ga0496120_0007596
1119 Ga0496124_0495357
1120 Ga0496126_0027934
1121 Ga0501309_087420
1122 Ga0501312_088140
1123 Ga0501317_074691
1124 Ga0501317_110341
1125 Ga0501320_043844
1126 Ga0501031_0001703
1127 Ga0501031_0031473
1128 Ga0501031_0264088
1129 Ga0501031_0279982
1130 Ga0501031_0557730
1131 Ga0501032_0000592
1132 Ga0501032_0011479
1133 Ga0501032_0054351
1134 Ga0501032_0508645
1135 Ga0501033_0002518
1136 Ga0501033_0003378
1137 Ga0501033_0024597
1138 Ga0501033_0064445
1139 Ga0501034_0001638
1140 Ga0501034_0026039
1141 Ga0501034_0265913
1142 Ga0501034_0444317
1143 Ga0501036_0002015
1144 Ga0501036_0072166
1145 Ga0501036_0184748
1146 Ga0501036_0463284
1147 Ga0501037_0003778
1148 Ga0501037_0041481
1149 Ga0501037_0050613
1150 Ga0501037_0114611
1151 Ga0501037_0790613
1152 Ga0501038_0001745
1153 Ga0501038_0010821
1154 Ga0501038_0014435
1155 Ga0501038_0030775
1156 Ga0501038_0212167
1157 Ga0501038_0980263
1158 Ga0501039_0002815
1159 Ga0501039_0005824
1160 Ga0501039_0059211
1161 Ga0501039_0191909
1162 Ga0501040_0030335
1163 Ga0501040_0034767
1164 Ga0501041_0006491
1165 Ga0501041_0006584
1166 Ga0501042_0004398
1167 Ga0501042_0009798
1168 Ga0501042_0036577
1169 Ga0501042_1229340
1170 Ga0501043_0001121
1171 Ga0501043_0087083
1172 Ga0501043_0102337
1173 Ga0501046_0000406
1174 Ga0501046_0003431
1175 Ga0501047_0001699
1176 Ga0501047_0017968
1177 Ga0501048_0008834
1178 Ga0501048_0102264
1179 Ga0501067_0006646
1180 Ga0501068_0000733
1181 Ga0501068_0801083
1182 Ga0501069_0000556
1183 Ga0501070_0001359
1184 Ga0501070_0004325
1185 Ga0501070_0041445
1186 Ga0501070_0076062
1187 Ga0501070_0251732
1188 Ga0501070_0839426
1189 Ga0501071_0012027
1190 Ga0501071_0696299
1191 Ga0501071_0704460
1192 Ga0501072_0002260
1193 Ga0501072_1240173
1194 Ga0501073_0002957
1195 Ga0501073_0080793
1196 Ga0501073_0225440
1197 Ga0501074_0002006
1198 Ga0501074_0003956
1199 Ga0501074_0519586
1200 Ga0501075_0038887
1201 Ga0501075_0974126
1202 Ga0501076_0048090
1203 Ga0501077_0048726
1204 Ga0501077_0124057
1205 Ga0501206_013255
1206 Ga0501223_070310
1207 Ga0501252_050388
1208 Ga0501253_026940
1209 Ga0501261_109609
1210 Ga0501079_0000971
1211 Ga0501079_0002345
1212 Ga0501079_0231074
1213 Ga0501080_0001014
1214 Ga0501080_0003445
1215 Ga0501080_0048084
1216 Ga0501080_0061046
1217 Ga0501080_0738685
1218 Ga0501081_0098165
1219 Ga0501083_0002438
1220 Ga0501264_051717
1221 Ga0501035_0015110
1222 Ga0501035_0026404
1223 Ga0501035_0205651
1224 Ga0501035_0511431
1225 Ga0501044_0007315
1226 Ga0501044_0062211
1227 Ga0501044_0106104
1228 Ga0501045_0002389
1229 Ga0501045_0081851
1230 Ga0501045_0082131
1231 Ga0501045_1217161
1232 nmdc:mga00v17_2126_c1
1233 nmdc:mga00v17_406425_c1
1234 nmdc:mga0yw44_3_c1
1235 nmdc:mga05p37_22037_c1
1236 nmdc:mga05p37_309756_c1
1237 nmdc:mga09592_763_c1
1238 nmdc:mga0qj67_47938_c1
1239 nmdc:mga06r32_2275_c1
1240 nmdc:mga06r32_3618_c1
1241 nmdc:mga08y16_959_c1
1242 nmdc:mga08x19_1119133_c1
1243 nmdc:mga0sz30_243661_c1
1244 nmdc:mga0sz30_33607_c2
1245 Ga0495612_0266266
1246 Ga0495655_0235805
1247 Ga0500562_104562
1248 Ga0500559_0005952
1249 Ga0500573_0056693
1250 Ga0500596_050195
1251 Ga0500587_049522
1252 Ga0501084_0002773
1253 Ga0501084_0279847
1254 Ga0501084_0501546
1255 Ga0501084_0966011
1256 Ga0587066_210246
1257 Ga0587082_053982
1258 Ga0587082_122650
1259 Ga0587121_15153
1260 Ga0587109_056528
1261 Ga0587113_033379
1262 Ga0587113_050896
1263 Ga0587122_049863
1264 Ga0587068_099797
1265 Ga0587069_072142
1266 Ga0587069_131963
1267 Ga0587076_166247
1268 Ga0587102_063614
1269 Ga0587102_066089
1270 Ga0587107_072784
1271 Ga0587110_063771
1272 Ga0587114_096335
1273 Ga0501082_0004680
1274 Ga0466962_0009080
1275 Ga0466962_0019002
1276 Ga0466962_0047768
1277 Ga0466962_0256047
1278 Ga0466962_0476124
1279 Ga0466962_0722113
1280 Ga0530510_0037224
1281 Ga0530510_0152061
1282 2517760623
1283 2623501671
1284 2643763894
1285 2644017600
1286 2644173440
1287 2644461672
1288 2753075917
1289 2819740708
1290 2867480149
1291 2870727202
1292 2880495542
1293 2929225436
1294 2935394578
1295 2966600951
1296 2997453172
1297 3001890776
1298 3006396070
1299 8047717041
1300 8054161102

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09055

Sod_Ni

Nickel-containing superoxide dismutase

18

137

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ncq-assembly1.cif.gz_C-2 crystal structure of nisod h1a mutant 0.983 23 134
4ncq-assembly1.cif.gz_B-2 crystal structure of nisod h1a mutant 0.9824 23 134
1t6i-assembly1.cif.gz_A nickel superoxide dismutase (nisod) apo structure 0.979 22 135
1t6q-assembly1.cif.gz_B-2 nickel superoxide dismutase (nisod) cn-treated apo structure 0.972 21 135
4ncq-assembly1.cif.gz_C-2 crystal structure of nisod h1a mutant 0.9653 23 134
ID Description Score Start End Superfamily
1t6qA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9817 22 134 1.20.120.400
1t6qC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9802 22 134 1.20.120.400
1t6iA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9771 22 135 1.20.120.400
1t6qA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9642 22 134 1.20.120.400
1t6qC00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nickel-containing superoxide dismutase 0.9627 22 134 1.20.120.400
ID Description Score Start End GO Terms
AF-L8PFK6-F1-model_v4 Superoxide dismutase, Ni (EC 1.15.1.1) 0.9897 24 135 GO:0004784
GO:0016151
AF-A0A536BVV8-F1-model_v4 Superoxide dismutase, Ni (EC 1.15.1.1) 0.9724 24 136 GO:0004784
GO:0016151
AF-L8PFK6-F1-model_v4 Superoxide dismutase, Ni (EC 1.15.1.1) 0.9631 24 135 GO:0004784
GO:0016151
AF-A0A535BI62-F1-model_v4 Superoxide dismutase, Ni (EC 1.15.1.1) 0.8982 23 134 GO:0004784
GO:0016151
AF-A0A257REB2-F1-model_v4 Superoxide dismutase, Ni 0.8964 11 134 GO:0004784
GO:0016151

Map