F472494
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 650 | 331 | 587 | 390 |
Family's Representative Sequence
| Representative Sequence | 3300005289|Ga0065704_10071330|Ga0065704_100713302 |
| Length | 416 |
| Sequence | VVRSLAPTQPNAQRKAVPMETRAGDPGAFAHFDLSRVDSPAFVVDVQALRRNLSTLADIRDRAGIKVLAALKAFSMWQVAPVVGEYLDGVCTSGLWEAKLAAEHYQGEIATYCAAYKAEDLPEICALSDHVIFNSPFQIARFQPVLDAARAAGHAFDVGLRINPLHQEGEVPRYDPCAPHSRLGFPVDQLRPEHLEGVSGLHFHTLCEQDFEPLRRTWDSLAPRIAPFLGRLKWLNFGGGHHVTRADYQREDLIAFLRDVKAQTGCELYLEPGEAVALDAGILVGTVLDRHWNGMDIAITDISATCHMPDVIEAPYRPAMLGELPIDEYEDGEGDKPVRLGGPSCLAGDVIGDYRLPVAAEPGARFAFLDQAHYSMVKTTTFNGVPLPSIWLWDSNTDTLDLIRTFAYEDFRDRLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 3 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 4 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 5 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 6 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 7 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 8 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 9 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 10 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 11 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 12 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 13 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 14 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 15 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 16 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 17 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 18 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 19 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 20 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 21 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 22 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 23 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 24 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 25 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 26 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 27 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 28 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 29 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 30 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 31 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 32 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 33 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 34 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 35 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 36 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 37 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 38 | 2857504554 | Caulobacter sp. R-72291 | Isolate | Unclassified |
| 39 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 40 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 41 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 42 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 43 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 44 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 45 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 46 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 47 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 48 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 49 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 50 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 51 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 52 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 53 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 54 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 55 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 56 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 57 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 58 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 59 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 60 | 3000865235 | Altericroceibacterium indicum DSM 18604 | Isolate | Rhizosphere |
| 61 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 62 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 63 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 64 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 65 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 66 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 67 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 68 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 69 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 70 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 71 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 72 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 75 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 91 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 96 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 97 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 98 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 99 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 100 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 101 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 102 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 103 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 104 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 105 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 106 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 109 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 110 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 113 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 124 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 182 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 185 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 186 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 187 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 228 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 229 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 230 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 231 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 242 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 243 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 244 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 245 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 246 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 247 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 278 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 279 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 280 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 281 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 288 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 290 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 291 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 292 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 293 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 294 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 295 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 297 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 298 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 299 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 300 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 301 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 302 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 303 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 304 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 306 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 307 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 308 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 309 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 310 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 311 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 313 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 314 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 316 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 317 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 318 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 319 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 320 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 322 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 324 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 326 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 328 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 329 | 8054302542 | Novosphingobium kaempferiae Sx8-5 | Isolate | Rhizosphere |
| 330 | 8057473075 | Paenibacillus endoradicis T3-5-0-4 | Isolate | Unclassified |
| 331 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.85 |
| Metatranscriptomes | 4.46 |
| Isolates | 9.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 21.54 |
| Nodule | 0 |
| Rhizoplane | 3.54 |
| Rhizosphere | 60.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1604904 | 2162886007 | Bacteria | 1867 |
| 2 | SwRhRL2b_contig_2199698 | 2162886007 | Bacteria | 2705 |
| 3 | SwRhRL2b_contig_2586087 | 2162886007 | Bacteria | 50518 |
| 4 | SwRhRL2b_contig_988 | 2162886007 | Bacteria | 6046 |
| 5 | JGI24736J21556_1001407 | 3300001904 | Bacteria | 4403 |
| 6 | JGI24741J21665_1000004 | 3300001915 | Bacteria | 51710 |
| 7 | JGI24740J21852_10002677 | 3300001979 | Bacteria | 7993 |
| 8 | JGI24739J22299_10002528 | 3300001989 | Bacteria | 7046 |
| 9 | JGI24737J22298_10003083 | 3300001990 | Bacteria | 5904 |
| 10 | JGI24735J21928_10004164 | 3300002067 | Bacteria | 4884 |
| 11 | JGI24738J21930_10003221 | 3300002075 | Bacteria | 4163 |
| 12 | JGI24751J29686_10000080 | 3300002459 | Bacteria | 54264 |
| 13 | JGI24751J29686_10005837 | 3300002459 | Bacteria | 2512 |
| 14 | JGI25151J46595_10008100 | 3300003187 | Bacteria | 5091 |
| 15 | Ga0055536_1003479 | 3300003781 | Bacteria | 8441 |
| 16 | Ga0055536_1007179 | 3300003781 | Bacteria | 5034 |
| 17 | Ga0055536_1012462 | 3300003781 | Bacteria | 3153 |
| 18 | Ga0055530_10000013 | 3300003791 | Bacteria | 153390 |
| 19 | Ga0055531_10006519 | 3300003794 | Bacteria | 6618 |
| 20 | Ga0055531_10011896 | 3300003794 | Bacteria | 4145 |
| 21 | Ga0065704_10000191 | 3300005289 | Bacteria | 318191 |
| 22 | Ga0065704_10003246 | 3300005289 | Bacteria | 6094 |
| 23 | Ga0065704_10005515 | 3300005289 | Bacteria | 5443 |
| 24 | Ga0065704_10071330 | 3300005289 | Bacteria | 11689 |
| 25 | Ga0065704_10082800 | 3300005289 | Bacteria | 3548 |
| 26 | Ga0065704_10109097 | 3300005289 | Bacteria | 2009 |
| 27 | Ga0065707_10090532 | 3300005295 | Bacteria | 4123 |
| 28 | Ga0070658_10000351 | 3300005327 | Bacteria | 39857 |
| 29 | Ga0070658_10045637 | 3300005327 | Bacteria | 3543 |
| 30 | Ga0070683_100117271 | 3300005329 | Bacteria | 2514 |
| 31 | Ga0070670_100000344 | 3300005331 | Bacteria | 39044 |
| 32 | Ga0070670_100088611 | 3300005331 | Bacteria | 2660 |
| 33 | Ga0070670_100128704 | 3300005331 | Bacteria | 2185 |
| 34 | Ga0070677_10000516 | 3300005333 | Bacteria | 13259 |
| 35 | Ga0070666_10000305 | 3300005335 | Bacteria | 31836 |
| 36 | Ga0070660_100088429 | 3300005339 | Bacteria | 2440 |
| 37 | Ga0070668_100000093 | 3300005347 | Bacteria | 56453 |
| 38 | Ga0070669_100000013 | 3300005353 | Bacteria | 210577 |
| 39 | Ga0070669_100000990 | 3300005353 | Bacteria | 20731 |
| 40 | Ga0070669_100001337 | 3300005353 | Bacteria | 17776 |
| 41 | Ga0070669_100003132 | 3300005353 | Bacteria | 11894 |
| 42 | Ga0070669_100132467 | 3300005353 | Bacteria | 1914 |
| 43 | Ga0070671_100000009 | 3300005355 | Bacteria | 206508 |
| 44 | Ga0070671_100000050 | 3300005355 | Bacteria | 80843 |
| 45 | Ga0070671_100015177 | 3300005355 | Bacteria | 6222 |
| 46 | Ga0070671_100015289 | 3300005355 | Bacteria | 6198 |
| 47 | Ga0070671_100095887 | 3300005355 | Bacteria | 2487 |
| 48 | Ga0070671_100234006 | 3300005355 | Bacteria | 1559 |
| 49 | Ga0070659_100046199 | 3300005366 | Bacteria | 3413 |
| 50 | Ga0070667_100000162 | 3300005367 | Bacteria | 83150 |
| 51 | Ga0070667_100000678 | 3300005367 | Bacteria | 33073 |
| 52 | Ga0070667_100003157 | 3300005367 | Bacteria | 14136 |
| 53 | Ga0070705_100079508 | 3300005440 | Bacteria | 2009 |
| 54 | Ga0070708_100152401 | 3300005445 | Bacteria | 2150 |
| 55 | Ga0070663_100009782 | 3300005455 | Bacteria | 5954 |
| 56 | Ga0068853_100001399 | 3300005539 | Bacteria | 17408 |
| 57 | Ga0068853_100040880 | 3300005539 | Bacteria | 3958 |
| 58 | Ga0068853_100076322 | 3300005539 | Bacteria | 2926 |
| 59 | Ga0070686_100000171 | 3300005544 | Bacteria | 45415 |
| 60 | Ga0070665_100000038 | 3300005548 | Bacteria | 309230 |
| 61 | Ga0070665_100064630 | 3300005548 | Bacteria | 3670 |
| 62 | Ga0070665_100090119 | 3300005548 | Bacteria | 3072 |
| 63 | Ga0070665_100151967 | 3300005548 | Bacteria | 2318 |
| 64 | Ga0068855_100001903 | 3300005563 | Bacteria | 25898 |
| 65 | Ga0068855_100041968 | 3300005563 | Bacteria | 5421 |
| 66 | Ga0068855_100046889 | 3300005563 | Bacteria | 5107 |
| 67 | Ga0068855_100131337 | 3300005563 | Bacteria | 2860 |
| 68 | Ga0068857_100010124 | 3300005577 | Bacteria | 8192 |
| 69 | Ga0068857_100143292 | 3300005577 | Bacteria | 2161 |
| 70 | Ga0068857_100205444 | 3300005577 | Bacteria | 1796 |
| 71 | Ga0068854_100002051 | 3300005578 | Bacteria | 12337 |
| 72 | Ga0068856_100003768 | 3300005614 | Bacteria | 15196 |
| 73 | Ga0068859_100000202 | 3300005617 | Bacteria | 58573 |
| 74 | Ga0068859_100242352 | 3300005617 | Bacteria | 1892 |
| 75 | Ga0068864_100006790 | 3300005618 | Bacteria | 9372 |
| 76 | Ga0068864_100065917 | 3300005618 | Bacteria | 3142 |
| 77 | Ga0068851_10074010 | 3300005834 | Bacteria | 1767 |
| 78 | Ga0068863_100000047 | 3300005841 | Bacteria | 140249 |
| 79 | Ga0068863_100001389 | 3300005841 | Bacteria | 24002 |
| 80 | Ga0068863_100004204 | 3300005841 | Bacteria | 14218 |
| 81 | Ga0068863_100017898 | 3300005841 | Bacteria | 6781 |
| 82 | Ga0068863_100019188 | 3300005841 | Bacteria | 6545 |
| 83 | Ga0068863_100042659 | 3300005841 | Bacteria | 4311 |
| 84 | Ga0068863_100055440 | 3300005841 | Bacteria | 3753 |
| 85 | Ga0068858_100012887 | 3300005842 | Bacteria | 7884 |
| 86 | Ga0068858_100017658 | 3300005842 | Bacteria | 6688 |
| 87 | Ga0068858_100032105 | 3300005842 | Bacteria | 4877 |
| 88 | Ga0068858_100038491 | 3300005842 | Bacteria | 4436 |
| 89 | Ga0068858_100274190 | 3300005842 | Bacteria | 1605 |
| 90 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 91 | Ga0068860_100032312 | 3300005843 | Bacteria | 5029 |
| 92 | Ga0068860_100048688 | 3300005843 | Bacteria | 4039 |
| 93 | Ga0068860_100112502 | 3300005843 | Bacteria | 2603 |
| 94 | Ga0068860_100413288 | 3300005843 | Bacteria | 1336 |
| 95 | Ga0068862_100005421 | 3300005844 | Bacteria | 10653 |
| 96 | Ga0068862_100006147 | 3300005844 | Bacteria | 9993 |
| 97 | Ga0075365_10171319 | 3300006038 | Bacteria | 1515 |
| 98 | Ga0075368_10000180 | 3300006042 | Bacteria | 17240 |
| 99 | Ga0075368_10001487 | 3300006042 | Bacteria | 7510 |
| 100 | Ga0075363_100000064 | 3300006048 | Bacteria | 21836 |
| 101 | Ga0075363_100002606 | 3300006048 | Bacteria | 7430 |
| 102 | Ga0075364_10004077 | 3300006051 | Bacteria | 8383 |
| 103 | Ga0075364_10093813 | 3300006051 | Bacteria | 1993 |
| 104 | Ga0075362_10000093 | 3300006177 | Bacteria | 24981 |
| 105 | Ga0075362_10004784 | 3300006177 | Bacteria | 4890 |
| 106 | Ga0075362_10011866 | 3300006177 | Bacteria | 3443 |
| 107 | Ga0075367_10000047 | 3300006178 | Bacteria | 28179 |
| 108 | Ga0075367_10052589 | 3300006178 | Bacteria | 2411 |
| 109 | Ga0075369_10003568 | 3300006186 | Bacteria | 5667 |
| 110 | Ga0075369_10004395 | 3300006186 | Bacteria | 5205 |
| 111 | Ga0075366_10000014 | 3300006195 | Bacteria | 66940 |
| 112 | Ga0075366_10001540 | 3300006195 | Bacteria | 11534 |
| 113 | Ga0075366_10031282 | 3300006195 | Bacteria | 3131 |
| 114 | Ga0075370_10000056 | 3300006353 | Bacteria | 33386 |
| 115 | Ga0075370_10014025 | 3300006353 | Bacteria | 4267 |
| 116 | Ga0075370_10015522 | 3300006353 | Bacteria | 4079 |
| 117 | Ga0075370_10068604 | 3300006353 | Bacteria | 2025 |
| 118 | Ga0075434_100019793 | 3300006871 | Bacteria | 6515 |
| 119 | Ga0097620_100000202 | 3300006931 | Bacteria | 58573 |
| 120 | Ga0097620_100242356 | 3300006931 | Bacteria | 1892 |
| 121 | Ga0105251_10002779 | 3300009011 | Bacteria | 13307 |
| 122 | Ga0105251_10045041 | 3300009011 | Bacteria | 2128 |
| 123 | Ga0105250_10028650 | 3300009092 | Bacteria | 2242 |
| 124 | Ga0105240_10023774 | 3300009093 | Bacteria | 8095 |
| 125 | Ga0105240_10188971 | 3300009093 | Bacteria | 2423 |
| 126 | Ga0105240_10312200 | 3300009093 | Bacteria | 1795 |
| 127 | Ga0105247_10000831 | 3300009101 | Bacteria | 23501 |
| 128 | Ga0114129_10112701 | 3300009147 | Bacteria | 3751 |
| 129 | Ga0105248_10096952 | 3300009177 | Bacteria | 3322 |
| 130 | Ga0105248_10150915 | 3300009177 | Bacteria | 2621 |
| 131 | Ga0105248_10199782 | 3300009177 | Bacteria | 2253 |
| 132 | Ga0105248_10346510 | 3300009177 | Bacteria | 1672 |
| 133 | Ga0105237_10195441 | 3300009545 | Bacteria | 2023 |
| 134 | Ga0105238_10280126 | 3300009551 | Bacteria | 1649 |
| 135 | Ga0105148_100098 | 3300009978 | Bacteria | 13718 |
| 136 | Ga0105239_10033054 | 3300010375 | Bacteria | 5681 |
| 137 | Ga0157371_10007213 | 3300013102 | Bacteria | 9030 |
| 138 | Ga0157371_10017568 | 3300013102 | Bacteria | 5311 |
| 139 | Ga0163162_10011771 | 3300013306 | Bacteria | 8534 |
| 140 | Ga0163162_10031350 | 3300013306 | Bacteria | 5273 |
| 141 | Ga0157380_10171278 | 3300014326 | Bacteria | 1897 |
| 142 | Ga0163161_10001436 | 3300017792 | Bacteria | 17585 |
| 143 | Ga0163161_10014729 | 3300017792 | Bacteria | 5446 |
| 144 | Ga0163161_10215341 | 3300017792 | Bacteria | 1485 |
| 145 | Ga0206356_11452870 | 3300020070 | Bacteria | 1879 |
| 146 | Ga0209566_100115 | 3300025225 | Bacteria | 107765 |
| 147 | Ga0209147_101123 | 3300025229 | Bacteria | 11047 |
| 148 | Ga0209147_103046 | 3300025229 | Bacteria | 3543 |
| 149 | Ga0209437_100249 | 3300025233 | Bacteria | 85649 |
| 150 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 151 | Ga0209676_1000221 | 3300025292 | Bacteria | 124715 |
| 152 | Ga0209676_1000228 | 3300025292 | Bacteria | 123024 |
| 153 | Ga0209676_1000276 | 3300025292 | Bacteria | 106867 |
| 154 | Ga0209676_1018017 | 3300025292 | Bacteria | 2477 |
| 155 | Ga0209676_1019053 | 3300025292 | Bacteria | 2372 |
| 156 | Ga0209025_1020711 | 3300025294 | Bacteria | 3579 |
| 157 | Ga0209025_1031191 | 3300025294 | Bacteria | 2528 |
| 158 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 159 | Ga0209050_1000265 | 3300025298 | Bacteria | 112618 |
| 160 | Ga0209050_1004010 | 3300025298 | Bacteria | 10379 |
| 161 | Ga0209050_1013953 | 3300025298 | Bacteria | 3515 |
| 162 | Ga0209050_1026158 | 3300025298 | Bacteria | 1961 |
| 163 | Ga0209257_1000135 | 3300025304 | Bacteria | 205668 |
| 164 | Ga0209257_1000229 | 3300025304 | Bacteria | 133121 |
| 165 | Ga0209257_1000695 | 3300025304 | Bacteria | 52248 |
| 166 | Ga0207697_10003991 | 3300025315 | Bacteria | 7149 |
| 167 | Ga0207682_10000712 | 3300025893 | Bacteria | 15424 |
| 168 | Ga0207710_10019206 | 3300025900 | Bacteria | 2915 |
| 169 | Ga0207680_10000429 | 3300025903 | Bacteria | 19832 |
| 170 | Ga0207647_10011216 | 3300025904 | Bacteria | 6293 |
| 171 | Ga0207647_10027822 | 3300025904 | Bacteria | 3682 |
| 172 | Ga0207695_10002012 | 3300025913 | Bacteria | 31349 |
| 173 | Ga0207695_10046288 | 3300025913 | Bacteria | 4612 |
| 174 | Ga0207657_10033667 | 3300025919 | Bacteria | 4616 |
| 175 | Ga0207681_10000008 | 3300025923 | Bacteria | 414329 |
| 176 | Ga0207681_10000174 | 3300025923 | Bacteria | 52934 |
| 177 | Ga0207681_10001207 | 3300025923 | Bacteria | 16625 |
| 178 | Ga0207681_10002809 | 3300025923 | Bacteria | 11019 |
| 179 | Ga0207681_10023588 | 3300025923 | Bacteria | 3938 |
| 180 | Ga0207681_10056858 | 3300025923 | Bacteria | 2670 |
| 181 | Ga0207650_10044248 | 3300025925 | Bacteria | 3271 |
| 182 | Ga0207650_10077617 | 3300025925 | Bacteria | 2511 |
| 183 | Ga0207650_10087141 | 3300025925 | Bacteria | 2379 |
| 184 | Ga0207650_10130054 | 3300025925 | Bacteria | 1969 |
| 185 | Ga0207687_10051764 | 3300025927 | Bacteria | 2863 |
| 186 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 187 | Ga0207644_10000006 | 3300025931 | Bacteria | 408793 |
| 188 | Ga0207644_10004801 | 3300025931 | Bacteria | 8802 |
| 189 | Ga0207644_10018358 | 3300025931 | Bacteria | 4731 |
| 190 | Ga0207644_10059077 | 3300025931 | Bacteria | 2773 |
| 191 | Ga0207711_10078860 | 3300025941 | Bacteria | 2874 |
| 192 | Ga0207711_10092915 | 3300025941 | Bacteria | 2656 |
| 193 | Ga0207711_10099603 | 3300025941 | Bacteria | 2569 |
| 194 | Ga0207711_10141679 | 3300025941 | Bacteria | 2164 |
| 195 | Ga0207711_10222963 | 3300025941 | Bacteria | 1725 |
| 196 | Ga0207667_10006181 | 3300025949 | Bacteria | 14538 |
| 197 | Ga0207667_10033487 | 3300025949 | Bacteria | 5523 |
| 198 | Ga0207712_10009699 | 3300025961 | Bacteria | 6102 |
| 199 | Ga0207668_10000195 | 3300025972 | Bacteria | 41701 |
| 200 | Ga0207668_10000731 | 3300025972 | Bacteria | 20103 |
| 201 | Ga0207668_10053922 | 3300025972 | Bacteria | 2789 |
| 202 | Ga0207640_10000662 | 3300025981 | Bacteria | 20165 |
| 203 | Ga0207640_10003032 | 3300025981 | Bacteria | 9041 |
| 204 | Ga0207658_10000127 | 3300025986 | Bacteria | 83164 |
| 205 | Ga0207658_10001246 | 3300025986 | Bacteria | 20116 |
| 206 | Ga0207658_10002244 | 3300025986 | Bacteria | 14324 |
| 207 | Ga0207658_10006257 | 3300025986 | Bacteria | 8132 |
| 208 | Ga0207658_10010740 | 3300025986 | Bacteria | 6226 |
| 209 | Ga0207703_10000733 | 3300026035 | Bacteria | 32263 |
| 210 | Ga0207703_10025840 | 3300026035 | Bacteria | 4621 |
| 211 | Ga0207703_10027104 | 3300026035 | Bacteria | 4513 |
| 212 | Ga0207703_10135661 | 3300026035 | Bacteria | 2130 |
| 213 | Ga0207639_10004275 | 3300026041 | Bacteria | 9629 |
| 214 | Ga0207639_10004953 | 3300026041 | Bacteria | 8969 |
| 215 | Ga0207639_10058042 | 3300026041 | Bacteria | 2975 |
| 216 | Ga0207678_10000072 | 3300026067 | Bacteria | 81033 |
| 217 | Ga0207702_10377212 | 3300026078 | Bacteria | 1363 |
| 218 | Ga0207641_10000042 | 3300026088 | Bacteria | 186384 |
| 219 | Ga0207641_10000079 | 3300026088 | Bacteria | 141110 |
| 220 | Ga0207641_10005158 | 3300026088 | Bacteria | 11175 |
| 221 | Ga0207641_10009520 | 3300026088 | Bacteria | 8008 |
| 222 | Ga0207641_10013920 | 3300026088 | Bacteria | 6597 |
| 223 | Ga0207641_10019253 | 3300026088 | Bacteria | 5601 |
| 224 | Ga0207676_10002410 | 3300026095 | Bacteria | 13340 |
| 225 | Ga0207676_10036956 | 3300026095 | Bacteria | 3718 |
| 226 | Ga0207676_10149672 | 3300026095 | Bacteria | 2009 |
| 227 | Ga0207674_10005919 | 3300026116 | Bacteria | 14465 |
| 228 | Ga0207674_10030787 | 3300026116 | Bacteria | 5640 |
| 229 | Ga0207674_10111626 | 3300026116 | Bacteria | 2708 |
| 230 | Ga0207675_100006560 | 3300026118 | Bacteria | 11012 |
| 231 | Ga0207698_10000005 | 3300026142 | Bacteria | 295687 |
| 232 | Ga0207698_10024470 | 3300026142 | Bacteria | 4238 |
| 233 | Ga0209813_10000118 | 3300027866 | Bacteria | 28637 |
| 234 | Ga0209813_10000267 | 3300027866 | Bacteria | 14702 |
| 235 | Ga0209974_10014668 | 3300027876 | Bacteria | 2605 |
| 236 | Ga0268266_10000118 | 3300028379 | Bacteria | 163466 |
| 237 | Ga0268266_10005550 | 3300028379 | Bacteria | 11742 |
| 238 | Ga0268266_10017340 | 3300028379 | Bacteria | 6145 |
| 239 | Ga0268266_10047584 | 3300028379 | Bacteria | 3675 |
| 240 | Ga0268266_10099992 | 3300028379 | Bacteria | 2554 |
| 241 | Ga0268266_10236322 | 3300028379 | Bacteria | 1685 |
| 242 | Ga0268265_10000392 | 3300028380 | Bacteria | 46740 |
| 243 | Ga0268265_10003351 | 3300028380 | Bacteria | 11569 |
| 244 | Ga0268265_10116846 | 3300028380 | Bacteria | 2189 |
| 245 | Ga0268264_10000134 | 3300028381 | Bacteria | 179475 |
| 246 | Ga0268264_10000310 | 3300028381 | Bacteria | 78142 |
| 247 | Ga0268264_10003810 | 3300028381 | Bacteria | 12938 |
| 248 | Ga0268264_10010868 | 3300028381 | Bacteria | 7522 |
| 249 | Ga0268264_10034608 | 3300028381 | Bacteria | 4156 |
| 250 | Ga0307515_10029188 | 3300028794 | Bacteria | 9337 |
| 251 | Ga0307515_10030159 | 3300028794 | Bacteria | 9125 |
| 252 | Ga0307408_100058204 | 3300031548 | Bacteria | 2808 |
| 253 | Ga0307408_100200177 | 3300031548 | Bacteria | 1616 |
| 254 | Ga0307408_100282793 | 3300031548 | Bacteria | 1382 |
| 255 | Ga0307508_10024853 | 3300031616 | Bacteria | 5435 |
| 256 | Ga0307410_10003860 | 3300031852 | Bacteria | 7619 |
| 257 | Ga0307407_10061646 | 3300031903 | Bacteria | 2193 |
| 258 | Ga0307412_10000348 | 3300031911 | Bacteria | 28830 |
| 259 | Ga0307412_10008388 | 3300031911 | Bacteria | 5895 |
| 260 | Ga0307412_10170937 | 3300031911 | Bacteria | 1625 |
| 261 | Ga0307412_10189526 | 3300031911 | Bacteria | 1553 |
| 262 | Ga0307416_100158467 | 3300032002 | Bacteria | 2088 |
| 263 | Ga0307414_10000105 | 3300032004 | Bacteria | 59546 |
| 264 | Ga0307414_10001344 | 3300032004 | Bacteria | 12713 |
| 265 | Ga0307414_10001394 | 3300032004 | Bacteria | 12521 |
| 266 | Ga0307414_10004671 | 3300032004 | Bacteria | 7466 |
| 267 | Ga0307414_10033431 | 3300032004 | Bacteria | 3399 |
| 268 | Ga0307411_10096940 | 3300032005 | Bacteria | 2074 |
| 269 | Ga0307415_100184941 | 3300032126 | Bacteria | 1639 |
| 270 | Ga0316583_10011256 | 3300032133 | Bacteria | 3222 |
| 271 | Ga0307510_10102461 | 3300033180 | Bacteria | 2645 |
| 272 | Ga0316582_0096788 | 3300036647 | Bacteria | 1949 |
| 273 | Ga0237819_00788 | 3300038705 | Bacteria | 10135 |
| 274 | Ga0436365_0361176 | 3300039437 | Bacteria | 17748 |
| 275 | Ga0436362_0795015 | 3300039453 | Bacteria | 1547 |
| 276 | Ga0451843_1520595 | 3300041509 | Bacteria | 1795 |
| 277 | Ga0439459_0020220 | 3300042438 | Bacteria | 1269 |
| 278 | Ga0453684_0410421 | 3300044712 | Bacteria | 1515 |
| 279 | Ga0451576_0000007 | 3300045051 | Bacteria | 782228 |
| 280 | Ga0495617_030146 | 3300046452 | Bacteria | 1824 |
| 281 | Ga0495627_000153 | 3300046453 | Bacteria | 80825 |
| 282 | Ga0495627_001065 | 3300046453 | Bacteria | 18144 |
| 283 | Ga0495627_006692 | 3300046453 | Bacteria | 4489 |
| 284 | Ga0495627_012656 | 3300046453 | Bacteria | 2988 |
| 285 | Ga0495627_039505 | 3300046453 | Bacteria | 1456 |
| 286 | Ga0495590_0001563 | 3300046457 | Bacteria | 9806 |
| 287 | Ga0495638_0000249 | 3300046460 | Bacteria | 73312 |
| 288 | Ga0495638_0000301 | 3300046460 | Bacteria | 63603 |
| 289 | Ga0495638_0000538 | 3300046460 | Bacteria | 43673 |
| 290 | Ga0495638_0005278 | 3300046460 | Bacteria | 9656 |
| 291 | Ga0495638_0037924 | 3300046460 | Bacteria | 3065 |
| 292 | Ga0495650_0001599 | 3300046471 | Bacteria | 21190 |
| 293 | Ga0495650_0015489 | 3300046471 | Bacteria | 3907 |
| 294 | Ga0495605_0037360 | 3300046474 | Bacteria | 2444 |
| 295 | Ga0495605_0043655 | 3300046474 | Bacteria | 2221 |
| 296 | Ga0495584_0025509 | 3300046491 | Bacteria | 2997 |
| 297 | Ga0495596_0000823 | 3300046500 | Bacteria | 18771 |
| 298 | Ga0495596_0010361 | 3300046500 | Bacteria | 4061 |
| 299 | Ga0495607_0016876 | 3300046501 | Bacteria | 4701 |
| 300 | Ga0495583_0000001 | 3300046506 | Bacteria | 811973 |
| 301 | Ga0495583_0000262 | 3300046506 | Bacteria | 86241 |
| 302 | Ga0495583_0035032 | 3300046506 | Bacteria | 2400 |
| 303 | Ga0495606_0035299 | 3300046507 | Bacteria | 3419 |
| 304 | Ga0495610_0000044 | 3300046512 | Bacteria | 156847 |
| 305 | Ga0495610_0000071 | 3300046512 | Bacteria | 121210 |
| 306 | Ga0495610_0000157 | 3300046512 | Bacteria | 75701 |
| 307 | Ga0495610_0001676 | 3300046512 | Bacteria | 19476 |
| 308 | Ga0495610_0002386 | 3300046512 | Bacteria | 15820 |
| 309 | Ga0495616_0000521 | 3300046513 | Bacteria | 29127 |
| 310 | Ga0495620_0067975 | 3300046515 | Bacteria | 1464 |
| 311 | Ga0495631_0006999 | 3300046518 | Bacteria | 5773 |
| 312 | Ga0495632_0000382 | 3300046519 | Bacteria | 42287 |
| 313 | Ga0495632_0004994 | 3300046519 | Bacteria | 8891 |
| 314 | Ga0495632_0007134 | 3300046519 | Bacteria | 7067 |
| 315 | Ga0495632_0045754 | 3300046519 | Bacteria | 2178 |
| 316 | Ga0495637_0009782 | 3300046520 | Bacteria | 4665 |
| 317 | Ga0495637_0013103 | 3300046520 | Bacteria | 3944 |
| 318 | Ga0495637_0022716 | 3300046520 | Bacteria | 2858 |
| 319 | Ga0495637_0086130 | 3300046520 | Bacteria | 1246 |
| 320 | Ga0495643_0000007 | 3300046522 | Bacteria | 383435 |
| 321 | Ga0495643_0000053 | 3300046522 | Bacteria | 202031 |
| 322 | Ga0495643_0003981 | 3300046522 | Bacteria | 10561 |
| 323 | Ga0495643_0033129 | 3300046522 | Bacteria | 2861 |
| 324 | Ga0495648_0000015 | 3300046524 | Bacteria | 285838 |
| 325 | Ga0495648_0000509 | 3300046524 | Bacteria | 41858 |
| 326 | Ga0495648_0020032 | 3300046524 | Bacteria | 4679 |
| 327 | Ga0495663_0000020 | 3300046525 | Bacteria | 124560 |
| 328 | Ga0495609_0002808 | 3300046538 | Bacteria | 10464 |
| 329 | Ga0495597_0003545 | 3300046542 | Bacteria | 9026 |
| 330 | Ga0495622_0012466 | 3300046557 | Bacteria | 3936 |
| 331 | Ga0495622_0026398 | 3300046557 | Bacteria | 2712 |
| 332 | Ga0495633_0000400 | 3300046558 | Bacteria | 45378 |
| 333 | Ga0495633_0002316 | 3300046558 | Bacteria | 13569 |
| 334 | Ga0495633_0007042 | 3300046558 | Bacteria | 6549 |
| 335 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 336 | Ga0495668_0000105 | 3300046616 | Bacteria | 133981 |
| 337 | Ga0495668_0006076 | 3300046616 | Bacteria | 7996 |
| 338 | Ga0495668_0036879 | 3300046616 | Bacteria | 2738 |
| 339 | Ga0495668_0061898 | 3300046616 | Bacteria | 2063 |
| 340 | Ga0495625_0000198 | 3300046660 | Bacteria | 95530 |
| 341 | Ga0495625_0004423 | 3300046660 | Bacteria | 13289 |
| 342 | Ga0495625_0005243 | 3300046660 | Bacteria | 11925 |
| 343 | Ga0495625_0007331 | 3300046660 | Bacteria | 9630 |
| 344 | Ga0495625_0023261 | 3300046660 | Bacteria | 4735 |
| 345 | Ga0495625_0056483 | 3300046660 | Bacteria | 2794 |
| 346 | Ga0495671_0000031 | 3300046692 | Bacteria | 202030 |
| 347 | Ga0495671_0000084 | 3300046692 | Bacteria | 89406 |
| 348 | Ga0495671_0005263 | 3300046692 | Bacteria | 7598 |
| 349 | Ga0495671_0056849 | 3300046692 | Bacteria | 1937 |
| 350 | Ga0495649_0000684 | 3300046694 | Bacteria | 27605 |
| 351 | Ga0495589_0010961 | 3300046794 | Bacteria | 4706 |
| 352 | Ga0495672_0004227 | 3300047320 | Bacteria | 11863 |
| 353 | Ga0495673_0000156 | 3300047469 | Bacteria | 118831 |
| 354 | Ga0495673_0000206 | 3300047469 | Bacteria | 89432 |
| 355 | Ga0495673_0001785 | 3300047469 | Bacteria | 16335 |
| 356 | Ga0495673_0002305 | 3300047469 | Bacteria | 13652 |
| 357 | Ga0495681_0000008 | 3300047470 | Bacteria | 215295 |
| 358 | Ga0495681_0000662 | 3300047470 | Bacteria | 26162 |
| 359 | Ga0495681_0009019 | 3300047470 | Bacteria | 6189 |
| 360 | Ga0495686_0001010 | 3300047472 | Bacteria | 34135 |
| 361 | Ga0495686_0059177 | 3300047472 | Bacteria | 2386 |
| 362 | Ga0495686_0080216 | 3300047472 | Bacteria | 1995 |
| 363 | Ga0495686_0129455 | 3300047472 | Bacteria | 1497 |
| 364 | Ga0495602_0109186 | 3300048088 | Bacteria | 2251 |
| 365 | Ga0495626_0028652 | 3300048091 | Bacteria | 2698 |
| 366 | Ga0496100_0034817 | 3300048903 | Bacteria | 3163 |
| 367 | Ga0496101_0138813 | 3300048904 | Bacteria | 1851 |
| 368 | Ga0496102_0000305 | 3300048905 | Bacteria | 62646 |
| 369 | Ga0496102_0021718 | 3300048905 | Bacteria | 5679 |
| 370 | Ga0496103_0000475 | 3300048906 | Bacteria | 33792 |
| 371 | Ga0496103_0069361 | 3300048906 | Bacteria | 2204 |
| 372 | Ga0496104_0000293 | 3300048907 | Bacteria | 44125 |
| 373 | Ga0496104_0047635 | 3300048907 | Bacteria | 4040 |
| 374 | Ga0496105_0003464 | 3300048908 | Bacteria | 11669 |
| 375 | Ga0496106_0046888 | 3300048909 | Bacteria | 3250 |
| 376 | Ga0496107_0000069 | 3300048910 | Bacteria | 51309 |
| 377 | Ga0496107_0004656 | 3300048910 | Bacteria | 9309 |
| 378 | Ga0496108_0003383 | 3300048911 | Bacteria | 12807 |
| 379 | Ga0496108_0089226 | 3300048911 | Bacteria | 2620 |
| 380 | Ga0496108_0257288 | 3300048911 | Bacteria | 1519 |
| 381 | Ga0496109_0138646 | 3300048912 | Bacteria | 2274 |
| 382 | Ga0496110_0006266 | 3300048913 | Bacteria | 9387 |
| 383 | Ga0496110_0031488 | 3300048913 | Bacteria | 4577 |
| 384 | Ga0496110_0145990 | 3300048913 | Bacteria | 2140 |
| 385 | Ga0496111_0067377 | 3300048914 | Bacteria | 2601 |
| 386 | Ga0496113_0000622 | 3300048916 | Bacteria | 17801 |
| 387 | Ga0496113_0006350 | 3300048916 | Bacteria | 7478 |
| 388 | Ga0496114_0052783 | 3300048917 | Bacteria | 3387 |
| 389 | Ga0496116_0000017 | 3300048919 | Bacteria | 554463 |
| 390 | Ga0496116_0004504 | 3300048919 | Bacteria | 13263 |
| 391 | Ga0496116_0020967 | 3300048919 | Bacteria | 4942 |
| 392 | Ga0496116_0036430 | 3300048919 | Bacteria | 3443 |
| 393 | Ga0496116_0073181 | 3300048919 | Bacteria | 2162 |
| 394 | Ga0496116_0098204 | 3300048919 | Bacteria | 1758 |
| 395 | Ga0496116_0179149 | 3300048919 | Bacteria | 1137 |
| 396 | Ga0496117_0000694 | 3300048920 | Bacteria | 53676 |
| 397 | Ga0496117_0006257 | 3300048920 | Bacteria | 12135 |
| 398 | Ga0496117_0014877 | 3300048920 | Bacteria | 6674 |
| 399 | Ga0496118_0030554 | 3300048921 | Bacteria | 4493 |
| 400 | Ga0496118_0035308 | 3300048921 | Bacteria | 4062 |
| 401 | Ga0496118_0052082 | 3300048921 | Bacteria | 3126 |
| 402 | Ga0496119_0000040 | 3300048922 | Bacteria | 208180 |
| 403 | Ga0496120_0004492 | 3300048923 | Bacteria | 11674 |
| 404 | Ga0496120_0053889 | 3300048923 | Bacteria | 2283 |
| 405 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 406 | Ga0496121_0000517 | 3300048924 | Bacteria | 73561 |
| 407 | Ga0496121_0001861 | 3300048924 | Bacteria | 33858 |
| 408 | Ga0496121_0005216 | 3300048924 | Bacteria | 16837 |
| 409 | Ga0496121_0007980 | 3300048924 | Bacteria | 12640 |
| 410 | Ga0496121_0013581 | 3300048924 | Bacteria | 8733 |
| 411 | Ga0496121_0054144 | 3300048924 | Bacteria | 3356 |
| 412 | Ga0496122_0000934 | 3300048925 | Bacteria | 53129 |
| 413 | Ga0496122_0002119 | 3300048925 | Bacteria | 29307 |
| 414 | Ga0496122_0003521 | 3300048925 | Bacteria | 20526 |
| 415 | Ga0496122_0009363 | 3300048925 | Bacteria | 10340 |
| 416 | Ga0496122_0016810 | 3300048925 | Bacteria | 6889 |
| 417 | Ga0496122_0033047 | 3300048925 | Bacteria | 4263 |
| 418 | Ga0496123_0000740 | 3300048926 | Bacteria | 52939 |
| 419 | Ga0496123_0000968 | 3300048926 | Bacteria | 44375 |
| 420 | Ga0496123_0000991 | 3300048926 | Bacteria | 43637 |
| 421 | Ga0496123_0002006 | 3300048926 | Bacteria | 26286 |
| 422 | Ga0496123_0007611 | 3300048926 | Bacteria | 10142 |
| 423 | Ga0496124_0002517 | 3300048927 | Bacteria | 23808 |
| 424 | Ga0496124_0007646 | 3300048927 | Bacteria | 11438 |
| 425 | Ga0496124_0010873 | 3300048927 | Bacteria | 9159 |
| 426 | Ga0496124_0015705 | 3300048927 | Bacteria | 7239 |
| 427 | Ga0496124_0016533 | 3300048927 | Bacteria | 7006 |
| 428 | Ga0496124_0078087 | 3300048927 | Bacteria | 2729 |
| 429 | Ga0496124_0098406 | 3300048927 | Bacteria | 2373 |
| 430 | Ga0496125_0000174 | 3300048928 | Bacteria | 144548 |
| 431 | Ga0496125_0000335 | 3300048928 | Bacteria | 90043 |
| 432 | Ga0496125_0001363 | 3300048928 | Bacteria | 35966 |
| 433 | Ga0496125_0004626 | 3300048928 | Bacteria | 15732 |
| 434 | Ga0496125_0030396 | 3300048928 | Bacteria | 4833 |
| 435 | Ga0496125_0032733 | 3300048928 | Bacteria | 4614 |
| 436 | Ga0496125_0065945 | 3300048928 | Bacteria | 2864 |
| 437 | Ga0496125_0068607 | 3300048928 | Bacteria | 2788 |
| 438 | Ga0496125_0092389 | 3300048928 | Bacteria | 2263 |
| 439 | Ga0496125_0119155 | 3300048928 | Bacteria | 1888 |
| 440 | Ga0496126_0000044 | 3300048929 | Bacteria | 335904 |
| 441 | Ga0496126_0000359 | 3300048929 | Bacteria | 94946 |
| 442 | Ga0496126_0003609 | 3300048929 | Bacteria | 19367 |
| 443 | Ga0496126_0010711 | 3300048929 | Bacteria | 9579 |
| 444 | Ga0501309_002561 | 3300049129 | Bacteria | 1973 |
| 445 | Ga0501343_000212 | 3300049132 | Bacteria | 3048 |
| 446 | Ga0501343_000430 | 3300049132 | Bacteria | 2426 |
| 447 | Ga0501305_002511 | 3300049161 | Bacteria | 1989 |
| 448 | Ga0501305_008446 | 3300049161 | Bacteria | 1332 |
| 449 | Ga0495678_000680 | 3300049459 | Bacteria | 31270 |
| 450 | Ga0501311_001435 | 3300049527 | Bacteria | 2068 |
| 451 | Ga0501312_001623 | 3300049528 | Bacteria | 2257 |
| 452 | Ga0501313_000634 | 3300049529 | Bacteria | 2540 |
| 453 | Ga0501314_000504 | 3300049530 | Bacteria | 2449 |
| 454 | Ga0501314_000883 | 3300049530 | Bacteria | 2015 |
| 455 | Ga0501315_000133 | 3300049531 | Bacteria | 4114 |
| 456 | Ga0501315_007230 | 3300049531 | Bacteria | 1261 |
| 457 | Ga0501316_000527 | 3300049532 | Bacteria | 2690 |
| 458 | Ga0501316_001980 | 3300049532 | Bacteria | 1837 |
| 459 | Ga0501317_000344 | 3300049533 | Bacteria | 3096 |
| 460 | Ga0501317_000700 | 3300049533 | Bacteria | 2522 |
| 461 | Ga0501318_000537 | 3300049534 | Bacteria | 2476 |
| 462 | Ga0501321_000477 | 3300049537 | Bacteria | 2574 |
| 463 | Ga0501321_003152 | 3300049537 | Bacteria | 1491 |
| 464 | Ga0501330_000108 | 3300049546 | Bacteria | 2621 |
| 465 | Ga0501330_000615 | 3300049546 | Bacteria | 1596 |
| 466 | Ga0501332_01136 | 3300049548 | Bacteria | 1345 |
| 467 | Ga0501333_000078 | 3300049549 | Bacteria | 3089 |
| 468 | Ga0501334_00586 | 3300049550 | Bacteria | 1739 |
| 469 | Ga0501334_02067 | 3300049550 | Bacteria | 1166 |
| 470 | Ga0501335_000089 | 3300049551 | Bacteria | 4077 |
| 471 | Ga0501336_001879 | 3300049552 | Bacteria | 1305 |
| 472 | Ga0501338_00172 | 3300049554 | Bacteria | 2450 |
| 473 | Ga0501031_0129881 | 3300049568 | Bacteria | 1646 |
| 474 | Ga0501032_0020975 | 3300049569 | Bacteria | 4545 |
| 475 | Ga0501034_0011101 | 3300049571 | Bacteria | 9353 |
| 476 | Ga0501034_0041377 | 3300049571 | Bacteria | 4662 |
| 477 | Ga0501034_0113084 | 3300049571 | Bacteria | 2705 |
| 478 | Ga0501034_0307683 | 3300049571 | Bacteria | 1520 |
| 479 | Ga0501036_0017409 | 3300049572 | Bacteria | 6007 |
| 480 | Ga0501037_0038452 | 3300049573 | Bacteria | 3525 |
| 481 | Ga0501038_0036373 | 3300049574 | Bacteria | 4321 |
| 482 | Ga0501039_0075322 | 3300049575 | Bacteria | 2623 |
| 483 | Ga0501047_0054028 | 3300049581 | Bacteria | 3885 |
| 484 | Ga0501198_007894 | 3300049649 | Bacteria | 1536 |
| 485 | Ga0501208_000170 | 3300049655 | Bacteria | 4405 |
| 486 | Ga0501217_005711 | 3300049661 | Bacteria | 2614 |
| 487 | Ga0501223_000043 | 3300049663 | Bacteria | 44137 |
| 488 | Ga0501223_000082 | 3300049663 | Bacteria | 28639 |
| 489 | Ga0501224_000019 | 3300049664 | Bacteria | 78204 |
| 490 | Ga0501235_009973 | 3300049669 | Bacteria | 2077 |
| 491 | Ga0501225_0000059 | 3300049705 | Bacteria | 36394 |
| 492 | Ga0501225_0000065 | 3300049705 | Bacteria | 34445 |
| 493 | Ga0501234_003656 | 3300049707 | Bacteria | 2416 |
| 494 | Ga0501035_0062642 | 3300049822 | Bacteria | 3309 |
| 495 | Ga0501044_0000346 | 3300049823 | Bacteria | 58137 |
| 496 | Ga0501226_000080 | 3300049853 | Bacteria | 29131 |
| 497 | nmdc:mga03683_1450_c1 | 3300050489 | Bacteria | 4908 |
| 498 | nmdc:mga03683_17009_c1 | 3300050489 | Bacteria | 2744 |
| 499 | nmdc:mga03683_64_c1 | 3300050489 | Bacteria | 40516 |
| 500 | nmdc:mga03683_744_c1 | 3300050489 | Bacteria | 9325 |
| 501 | nmdc:mga03n38_1850_c1 | 3300050490 | Bacteria | 6311 |
| 502 | nmdc:mga00v17_1913_c1 | 3300050491 | Bacteria | 10770 |
| 503 | nmdc:mga0k408_38425_c1 | 3300050493 | Bacteria | 2747 |
| 504 | nmdc:mga0k408_52349_c1 | 3300050493 | Bacteria | 1987 |
| 505 | nmdc:mga0k408_7_c1 | 3300050493 | Bacteria | 164270 |
| 506 | nmdc:mga06z11_7_c1 | 3300050494 | Bacteria | 121804 |
| 507 | nmdc:mga04h51_582_c1 | 3300050495 | Bacteria | 8723 |
| 508 | nmdc:mga04h51_70_c1 | 3300050495 | Bacteria | 32617 |
| 509 | nmdc:mga07m45_3_c1 | 3300050496 | Bacteria | 421414 |
| 510 | nmdc:mga07m45_43585_c1 | 3300050496 | Bacteria | 2516 |
| 511 | nmdc:mga07m45_47739_c1 | 3300050496 | Bacteria | 2407 |
| 512 | nmdc:mga0n895_23671_c1 | 3300050512 | Bacteria | 5776 |
| 513 | nmdc:mga0sz30_2963_c1 | 3300050516 | Bacteria | 6088 |
| 514 | nmdc:mga0sz30_55631_c1 | 3300050516 | Bacteria | 1684 |
| 515 | Ga0500635_0000049 | 3300053080 | Bacteria | 80019 |
| 516 | Ga0500578_0000166 | 3300053086 | Bacteria | 78688 |
| 517 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 518 | Ga0500643_000420 | 3300053087 | Bacteria | 32288 |
| 519 | Ga0500643_000905 | 3300053087 | Bacteria | 18778 |
| 520 | Ga0500643_000969 | 3300053087 | Bacteria | 17804 |
| 521 | Ga0500643_006102 | 3300053087 | Bacteria | 5092 |
| 522 | Ga0500643_006176 | 3300053087 | Bacteria | 5050 |
| 523 | Ga0500643_006792 | 3300053087 | Bacteria | 4717 |
| 524 | Ga0500644_0000913 | 3300053088 | Bacteria | 9408 |
| 525 | Ga0500644_0003579 | 3300053088 | Bacteria | 3854 |
| 526 | Ga0500647_0063787 | 3300053091 | Bacteria | 1772 |
| 527 | Ga0500641_0000140 | 3300053096 | Bacteria | 26611 |
| 528 | Ga0500641_0019886 | 3300053096 | Bacteria | 2543 |
| 529 | Ga0500650_0059730 | 3300053098 | Bacteria | 1779 |
| 530 | Ga0500556_0000157 | 3300053104 | Bacteria | 56425 |
| 531 | Ga0500556_0001174 | 3300053104 | Bacteria | 12502 |
| 532 | Ga0500556_0002655 | 3300053104 | Bacteria | 5577 |
| 533 | Ga0500562_000275 | 3300053108 | Bacteria | 12696 |
| 534 | Ga0500562_000906 | 3300053108 | Bacteria | 7191 |
| 535 | Ga0500562_004234 | 3300053108 | Bacteria | 3628 |
| 536 | Ga0500562_014413 | 3300053108 | Bacteria | 2024 |
| 537 | Ga0500592_012266 | 3300053116 | Bacteria | 1370 |
| 538 | Ga0500594_0000310 | 3300053118 | Bacteria | 10933 |
| 539 | Ga0500594_0003550 | 3300053118 | Bacteria | 3433 |
| 540 | Ga0500595_001328 | 3300053119 | Bacteria | 13404 |
| 541 | Ga0500595_004701 | 3300053119 | Bacteria | 6063 |
| 542 | Ga0500607_000443 | 3300053121 | Bacteria | 39768 |
| 543 | Ga0500607_002276 | 3300053121 | Bacteria | 15819 |
| 544 | Ga0500608_000089 | 3300053122 | Bacteria | 37325 |
| 545 | Ga0500608_000443 | 3300053122 | Bacteria | 15591 |
| 546 | Ga0500608_000512 | 3300053122 | Bacteria | 14520 |
| 547 | Ga0500618_000413 | 3300053125 | Bacteria | 28853 |
| 548 | Ga0500618_004254 | 3300053125 | Bacteria | 4638 |
| 549 | Ga0500642_0000002 | 3300053130 | Bacteria | 795093 |
| 550 | Ga0500559_0000070 | 3300053136 | Bacteria | 82088 |
| 551 | Ga0500559_0002480 | 3300053136 | Bacteria | 9519 |
| 552 | Ga0500559_0004237 | 3300053136 | Bacteria | 6863 |
| 553 | Ga0500559_0007978 | 3300053136 | Bacteria | 4664 |
| 554 | Ga0500559_0036444 | 3300053136 | Bacteria | 2127 |
| 555 | Ga0500564_003263 | 3300053138 | Bacteria | 6259 |
| 556 | Ga0500564_028774 | 3300053138 | Bacteria | 2557 |
| 557 | Ga0500568_0006701 | 3300053139 | Bacteria | 5756 |
| 558 | Ga0500568_0025081 | 3300053139 | Bacteria | 2520 |
| 559 | Ga0500573_0000045 | 3300053140 | Bacteria | 98878 |
| 560 | Ga0500577_0004110 | 3300053142 | Bacteria | 3819 |
| 561 | Ga0500590_000657 | 3300053148 | Bacteria | 12371 |
| 562 | Ga0500590_045171 | 3300053148 | Bacteria | 2256 |
| 563 | Ga0500604_0025338 | 3300053151 | Bacteria | 1704 |
| 564 | Ga0500604_0046330 | 3300053151 | Bacteria | 1330 |
| 565 | Ga0500616_0004927 | 3300053153 | Bacteria | 9274 |
| 566 | Ga0500622_0000491 | 3300053156 | Bacteria | 36964 |
| 567 | Ga0500622_0000784 | 3300053156 | Bacteria | 27604 |
| 568 | Ga0500622_0001641 | 3300053156 | Bacteria | 17525 |
| 569 | Ga0500622_0002715 | 3300053156 | Bacteria | 12518 |
| 570 | Ga0500622_0011133 | 3300053156 | Bacteria | 4911 |
| 571 | Ga0500622_0045283 | 3300053156 | Bacteria | 2278 |
| 572 | Ga0500624_000007 | 3300053157 | Bacteria | 184487 |
| 573 | Ga0500624_000249 | 3300053157 | Bacteria | 18976 |
| 574 | Ga0500627_0000005 | 3300053158 | Bacteria | 167950 |
| 575 | Ga0500627_0062286 | 3300053158 | Bacteria | 1643 |
| 576 | Ga0500636_0004345 | 3300053177 | Bacteria | 8017 |
| 577 | Ga0500636_0036569 | 3300053177 | Bacteria | 2906 |
| 578 | Ga0500636_0072345 | 3300053177 | Bacteria | 1998 |
| 579 | Ga0500625_000010 | 3300053729 | Bacteria | 154401 |
| 580 | Ga0500625_067245 | 3300053729 | Bacteria | 1607 |
| 581 | Ga0500645_000262 | 3300053730 | Bacteria | 37926 |
| 582 | Ga0500645_000313 | 3300053730 | Bacteria | 34585 |
| 583 | Ga0500645_000449 | 3300053730 | Bacteria | 28159 |
| 584 | Ga0500645_002606 | 3300053730 | Bacteria | 7913 |
| 585 | Ga0500645_002637 | 3300053730 | Bacteria | 7844 |
| 586 | Ga0500596_000147 | 3300053735 | Bacteria | 10735 |
| 587 | Ga0500661_005870 | 3300055283 | Bacteria | 2287 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048919 | Ga0496116_0098204 | Ga0496116_0098204_78_986 | 296 |
| 2 | iso_pu_bacteria | 2563366752 | 2563928217 | 309 |
| 3 | 3300049550 | Ga0501334_02067 | Ga0501334_02067_123_1109 | 322 |
| 4 | 3300025294 | Ga0209025_1031191 | Ga0209025_10311913 | 324 |
| 5 | iso_pu_bacteria | 2885526491 | 2885531555 | 337 |
| 6 | iso_pu_bacteria | 2904162308 | 2904163911 | 337 |
| 7 | 3300026116 | Ga0207674_10111626 | Ga0207674_101116264 | 339 |
| 8 | 3300048919 | Ga0496116_0179149 | Ga0496116_0179149_75_1118 | 341 |
| 9 | 3300049649 | Ga0501198_007894 | Ga0501198_007894_21_1049 | 342 |
| 10 | 3300050493 | nmdc:mga0k408_38425_c1 | nmdc:mga0k408_38425_c1_14_1069 | 347 |
| 11 | iso_pu_bacteria | 2907202186 | 2907206913 | 360 |
| 12 | 3300048913 | Ga0496110_0031488 | Ga0496110_0031488_301_1473 | 364 |
| 13 | iso_pu_bacteria | 2524023129 | 2524189612 | 365 |
| 14 | iso_pu_bacteria | 2643221543 | 2643735668 | 365 |
| 15 | iso_pu_bacteria | 2738541295 | 2738817060 | 365 |
| 16 | iso_pu_bacteria | 2791355222 | 2793183869 | 365 |
| 17 | iso_pu_bacteria | 2821111986 | 2821112901 | 365 |
| 18 | iso_pu_bacteria | 2864733723 | 2864734810 | 365 |
| 19 | iso_pu_bacteria | 2889042446 | 2889045519 | 365 |
| 20 | iso_pu_bacteria | 2904490793 | 2904492391 | 365 |
| 21 | iso_pu_bacteria | 2919160200 | 2919161617 | 365 |
| 22 | iso_pu_bacteria | 2931384279 | 2931388952 | 365 |
| 23 | iso_pu_bacteria | 2939679117 | 2939681881 | 365 |
| 24 | iso_pu_bacteria | 2945991243 | 2945992471 | 365 |
| 25 | iso_pu_bacteria | 2946053406 | 2946055221 | 365 |
| 26 | iso_pu_bacteria | 3001892409 | 3001898405 | 365 |
| 27 | iso_pu_bacteria | 8057473075 | 8057476443 | 365 |
| 28 | iso_pu_bacteria | 8057977335 | 8057982258 | 365 |
| 29 | 3300046518 | Ga0495631_0006999 | Ga0495631_0006999_4637_5737 | 366 |
| 30 | 3300049532 | Ga0501316_000527 | Ga0501316_000527_1549_2667 | 366 |
| 31 | 3300053139 | Ga0500568_0025081 | Ga0500568_0025081_17_1132 | 366 |
| 32 | 3300053151 | Ga0500604_0046330 | Ga0500604_0046330_208_1314 | 367 |
| 33 | 3300003187 | JGI25151J46595_10008100 | JGI25151J46595_100081004 | 369 |
| 34 | 3300025225 | Ga0209566_100115 | Ga0209566_10011537 | 369 |
| 35 | 3300025229 | Ga0209147_103046 | Ga0209147_1030462 | 369 |
| 36 | 3300025233 | Ga0209437_100249 | Ga0209437_10024925 | 369 |
| 37 | 3300025292 | Ga0209676_1018017 | Ga0209676_10180172 | 369 |
| 38 | 3300031548 | Ga0307408_100200177 | Ga0307408_1002001771 | 369 |
| 39 | 3300046453 | Ga0495627_039505 | Ga0495627_039505_52_1179 | 369 |
| 40 | 3300046474 | Ga0495605_0037360 | Ga0495605_0037360_770_1897 | 369 |
| 41 | 3300046520 | Ga0495637_0086130 | Ga0495637_0086130_29_1156 | 369 |
| 42 | 3300048091 | Ga0495626_0028652 | Ga0495626_0028652_1244_2371 | 369 |
| 43 | 3300048919 | Ga0496116_0004504 | Ga0496116_0004504_9943_11070 | 369 |
| 44 | 3300048919 | Ga0496116_0020967 | Ga0496116_0020967_1720_2847 | 369 |
| 45 | 3300048925 | Ga0496122_0009363 | Ga0496122_0009363_6897_8024 | 369 |
| 46 | 3300048925 | Ga0496122_0033047 | Ga0496122_0033047_1121_2248 | 369 |
| 47 | 3300048926 | Ga0496123_0007611 | Ga0496123_0007611_6561_7688 | 369 |
| 48 | 3300048927 | Ga0496124_0002517 | Ga0496124_0002517_7409_8536 | 369 |
| 49 | 3300048927 | Ga0496124_0098406 | Ga0496124_0098406_183_1310 | 369 |
| 50 | 3300048928 | Ga0496125_0001363 | Ga0496125_0001363_10788_11915 | 369 |
| 51 | 3300048928 | Ga0496125_0004626 | Ga0496125_0004626_10005_11132 | 369 |
| 52 | 3300049129 | Ga0501309_002561 | Ga0501309_002561_831_1958 | 369 |
| 53 | 3300049132 | Ga0501343_000212 | Ga0501343_000212_1835_2962 | 369 |
| 54 | 3300049132 | Ga0501343_000430 | Ga0501343_000430_94_1221 | 369 |
| 55 | 3300049161 | Ga0501305_002511 | Ga0501305_002511_849_1976 | 369 |
| 56 | 3300049161 | Ga0501305_008446 | Ga0501305_008446_121_1248 | 369 |
| 57 | 3300049527 | Ga0501311_001435 | Ga0501311_001435_855_1982 | 369 |
| 58 | 3300049528 | Ga0501312_001623 | Ga0501312_001623_824_1951 | 369 |
| 59 | 3300049529 | Ga0501313_000634 | Ga0501313_000634_1330_2457 | 369 |
| 60 | 3300049530 | Ga0501314_000504 | Ga0501314_000504_77_1204 | 369 |
| 61 | 3300049530 | Ga0501314_000883 | Ga0501314_000883_848_1975 | 369 |
| 62 | 3300049531 | Ga0501315_000133 | Ga0501315_000133_2903_4030 | 369 |
| 63 | 3300049531 | Ga0501315_007230 | Ga0501315_007230_76_1203 | 369 |
| 64 | 3300049532 | Ga0501316_001980 | Ga0501316_001980_84_1211 | 369 |
| 65 | 3300049533 | Ga0501317_000344 | Ga0501317_000344_410_1537 | 369 |
| 66 | 3300049533 | Ga0501317_000700 | Ga0501317_000700_1340_2467 | 369 |
| 67 | 3300049534 | Ga0501318_000537 | Ga0501318_000537_1334_2461 | 369 |
| 68 | 3300049537 | Ga0501321_000477 | Ga0501321_000477_77_1204 | 369 |
| 69 | 3300049537 | Ga0501321_003152 | Ga0501321_003152_210_1337 | 369 |
| 70 | 3300049546 | Ga0501330_000108 | Ga0501330_000108_1424_2551 | 369 |
| 71 | 3300049546 | Ga0501330_000615 | Ga0501330_000615_395_1522 | 369 |
| 72 | 3300049548 | Ga0501332_01136 | Ga0501332_01136_138_1265 | 369 |
| 73 | 3300049549 | Ga0501333_000078 | Ga0501333_000078_80_1207 | 369 |
| 74 | 3300049550 | Ga0501334_00586 | Ga0501334_00586_415_1542 | 369 |
| 75 | 3300049552 | Ga0501336_001879 | Ga0501336_001879_71_1198 | 369 |
| 76 | 3300049554 | Ga0501338_00172 | Ga0501338_00172_1247_2374 | 369 |
| 77 | 3300049655 | Ga0501208_000170 | Ga0501208_000170_1196_2323 | 369 |
| 78 | 3300049661 | Ga0501217_005711 | Ga0501217_005711_248_1375 | 369 |
| 79 | 3300005355 | Ga0070671_100095887 | Ga0070671_1000958871 | 373 |
| 80 | 3300025931 | Ga0207644_10059077 | Ga0207644_100590772 | 373 |
| 81 | 3300031911 | Ga0307412_10008388 | Ga0307412_100083884 | 375 |
| 82 | 3300046660 | Ga0495625_0056483 | Ga0495625_0056483_983_2125 | 375 |
| 83 | 3300048917 | Ga0496114_0052783 | Ga0496114_0052783_321_1493 | 379 |
| 84 | 3300048929 | Ga0496126_0003609 | Ga0496126_0003609_12175_13347 | 379 |
| 85 | 3300048921 | Ga0496118_0035308 | Ga0496118_0035308_2566_3744 | 380 |
| 86 | 3300048924 | Ga0496121_0000517 | Ga0496121_0000517_56151_57329 | 380 |
| 87 | 3300050489 | nmdc:mga03683_17009_c1 | nmdc:mga03683_17009_c1_534_1733 | 381 |
| 88 | 3300005617 | Ga0068859_100242352 | Ga0068859_1002423522 | 382 |
| 89 | 3300005842 | Ga0068858_100017658 | Ga0068858_1000176583 | 382 |
| 90 | 3300006931 | Ga0097620_100242356 | Ga0097620_1002423562 | 382 |
| 91 | 3300025981 | Ga0207640_10000662 | Ga0207640_100006621 | 382 |
| 92 | 3300026035 | Ga0207703_10000733 | Ga0207703_1000073322 | 382 |
| 93 | 3300048912 | Ga0496109_0138646 | Ga0496109_0138646_1038_2210 | 382 |
| 94 | iso_pu_bacteria | 2919138771 | 2919141650 | 382 |
| 95 | 3300005618 | Ga0068864_100065917 | Ga0068864_1000659172 | 384 |
| 96 | 3300005841 | Ga0068863_100001389 | Ga0068863_1000013897 | 384 |
| 97 | 3300005843 | Ga0068860_100000007 | Ga0068860_100000007240 | 384 |
| 98 | 3300006051 | Ga0075364_10004077 | Ga0075364_100040778 | 384 |
| 99 | 3300006177 | Ga0075362_10004784 | Ga0075362_100047843 | 384 |
| 100 | 3300009177 | Ga0105248_10150915 | Ga0105248_101509152 | 384 |
| 101 | 3300025941 | Ga0207711_10099603 | Ga0207711_100996032 | 384 |
| 102 | 3300025986 | Ga0207658_10010740 | Ga0207658_100107406 | 384 |
| 103 | 3300026088 | Ga0207641_10000042 | Ga0207641_10000042182 | 384 |
| 104 | 3300026095 | Ga0207676_10036956 | Ga0207676_100369564 | 384 |
| 105 | 3300028379 | Ga0268266_10017340 | Ga0268266_100173406 | 384 |
| 106 | 3300028381 | Ga0268264_10000134 | Ga0268264_10000134175 | 384 |
| 107 | 3300050489 | nmdc:mga03683_1450_c1 | nmdc:mga03683_1450_c1_1415_2614 | 384 |
| 108 | 3300050491 | nmdc:mga00v17_1913_c1 | nmdc:mga00v17_1913_c1_5870_7069 | 384 |
| 109 | 3300050516 | nmdc:mga0sz30_55631_c1 | nmdc:mga0sz30_55631_c1_65_1264 | 384 |
| 110 | iso_pu_bacteria | 2643221614 | 2644086306 | 384 |
| 111 | iso_pu_bacteria | 2643221661 | 2644344804 | 384 |
| 112 | iso_pu_bacteria | 2643221666 | 2644367547 | 384 |
| 113 | 3300005333 | Ga0070677_10000516 | Ga0070677_100005164 | 385 |
| 114 | 3300009093 | Ga0105240_10023774 | Ga0105240_100237748 | 385 |
| 115 | 3300025893 | Ga0207682_10000712 | Ga0207682_100007129 | 385 |
| 116 | 3300025904 | Ga0207647_10027822 | Ga0207647_100278222 | 385 |
| 117 | 3300025913 | Ga0207695_10002012 | Ga0207695_1000201210 | 385 |
| 118 | 3300025949 | Ga0207667_10006181 | Ga0207667_100061818 | 385 |
| 119 | 3300026142 | Ga0207698_10000005 | Ga0207698_10000005127 | 385 |
| 120 | 3300048924 | Ga0496121_0000070 | Ga0496121_0000070_198071_199246 | 386 |
| 121 | 3300053125 | Ga0500618_004254 | Ga0500618_004254_2490_3665 | 386 |
| 122 | iso_pu_bacteria | 2510917020 | 2511121172 | 386 |
| 123 | iso_pu_bacteria | 2512564014 | 2512643650 | 386 |
| 124 | iso_pu_bacteria | 2582581279 | 2585148206 | 386 |
| 125 | iso_pu_bacteria | 2643221560 | 2643821636 | 386 |
| 126 | iso_pu_bacteria | 2643221563 | 2643835791 | 386 |
| 127 | iso_pu_bacteria | 2643221583 | 2643923669 | 386 |
| 128 | iso_pu_bacteria | 2643221598 | 2644001625 | 386 |
| 129 | iso_pu_bacteria | 2643221608 | 2644056717 | 386 |
| 130 | iso_pu_bacteria | 2775507255 | 2778124081 | 386 |
| 131 | iso_pu_bacteria | 2808606401 | 2809063694 | 386 |
| 132 | iso_pu_bacteria | 2808606404 | 2809079688 | 386 |
| 133 | iso_pu_bacteria | 2808606405 | 2809084053 | 386 |
| 134 | iso_pu_bacteria | 2849560528 | 2849563533 | 386 |
| 135 | iso_pu_bacteria | 2849573788 | 2849578772 | 386 |
| 136 | iso_pu_bacteria | 2851153111 | 2851157919 | 386 |
| 137 | iso_pu_bacteria | 2852653556 | 2852655398 | 386 |
| 138 | iso_pu_bacteria | 2852680915 | 2852681756 | 386 |
| 139 | iso_pu_bacteria | 2857504554 | 2857506608 | 386 |
| 140 | iso_pu_bacteria | 2880518877 | 2880519376 | 386 |
| 141 | iso_pu_bacteria | 2882806704 | 2882807527 | 386 |
| 142 | iso_pu_bacteria | 2895880812 | 2895886010 | 386 |
| 143 | iso_pu_bacteria | 2928972540 | 2928973414 | 386 |
| 144 | iso_pu_bacteria | 2941485952 | 2941487416 | 386 |
| 145 | iso_pu_bacteria | 2977240413 | 2977240608 | 386 |
| 146 | 3300046506 | Ga0495583_0000001 | Ga0495583_0000001_487150_488322 | 387 |
| 147 | iso_pu_bacteria | 3000865235 | 3000865593 | 387 |
| 148 | 3300005327 | Ga0070658_10000351 | Ga0070658_100003514 | 388 |
| 149 | iso_pu_bacteria | 2818991438 | 2819550806 | 388 |
| 150 | iso_pu_bacteria | 2848297114 | 2848299965 | 388 |
| 151 | iso_pu_bacteria | 8054302542 | 8054302591 | 388 |
| 152 | 3300005577 | Ga0068857_100143292 | Ga0068857_1001432922 | 389 |
| 153 | 3300005578 | Ga0068854_100002051 | Ga0068854_1000020514 | 389 |
| 154 | 3300025981 | Ga0207640_10003032 | Ga0207640_100030324 | 389 |
| 155 | 3300031903 | Ga0307407_10061646 | Ga0307407_100616462 | 389 |
| 156 | 3300032126 | Ga0307415_100184941 | Ga0307415_1001849412 | 389 |
| 157 | 3300046460 | Ga0495638_0000301 | Ga0495638_0000301_42986_44161 | 389 |
| 158 | iso_pu_bacteria | 2919709256 | 2919710615 | 389 |
| 159 | 2162886007 | SwRhRL2b_contig_988 | SwRhRL2b_0623.00005810 | 390 |
| 160 | 3300001904 | JGI24736J21556_1001407 | JGI24736J21556_10014072 | 390 |
| 161 | 3300001915 | JGI24741J21665_1000004 | JGI24741J21665_100000416 | 390 |
| 162 | 3300001979 | JGI24740J21852_10002677 | JGI24740J21852_100026774 | 390 |
| 163 | 3300001989 | JGI24739J22299_10002528 | JGI24739J22299_100025285 | 390 |
| 164 | 3300001990 | JGI24737J22298_10003083 | JGI24737J22298_100030831 | 390 |
| 165 | 3300002067 | JGI24735J21928_10004164 | JGI24735J21928_100041645 | 390 |
| 166 | 3300002075 | JGI24738J21930_10003221 | JGI24738J21930_100032213 | 390 |
| 167 | 3300002459 | JGI24751J29686_10005837 | JGI24751J29686_100058372 | 390 |
| 168 | 3300003781 | Ga0055536_1003479 | Ga0055536_10034797 | 390 |
| 169 | 3300003781 | Ga0055536_1007179 | Ga0055536_10071793 | 390 |
| 170 | 3300003781 | Ga0055536_1012462 | Ga0055536_10124621 | 390 |
| 171 | 3300003791 | Ga0055530_10000013 | Ga0055530_100000133 | 390 |
| 172 | 3300003794 | Ga0055531_10006519 | Ga0055531_100065194 | 390 |
| 173 | 3300003794 | Ga0055531_10011896 | Ga0055531_100118962 | 390 |
| 174 | 3300005289 | Ga0065704_10003246 | Ga0065704_100032464 | 390 |
| 175 | 3300005327 | Ga0070658_10045637 | Ga0070658_100456373 | 390 |
| 176 | 3300005329 | Ga0070683_100117271 | Ga0070683_1001172712 | 390 |
| 177 | 3300005331 | Ga0070670_100000344 | Ga0070670_1000003447 | 390 |
| 178 | 3300005331 | Ga0070670_100088611 | Ga0070670_1000886112 | 390 |
| 179 | 3300005331 | Ga0070670_100128704 | Ga0070670_1001287042 | 390 |
| 180 | 3300005335 | Ga0070666_10000305 | Ga0070666_100003054 | 390 |
| 181 | 3300005339 | Ga0070660_100088429 | Ga0070660_1000884292 | 390 |
| 182 | 3300005347 | Ga0070668_100000093 | Ga0070668_10000009331 | 390 |
| 183 | 3300005353 | Ga0070669_100000013 | Ga0070669_100000013195 | 390 |
| 184 | 3300005353 | Ga0070669_100132467 | Ga0070669_1001324672 | 390 |
| 185 | 3300005355 | Ga0070671_100000009 | Ga0070671_10000000928 | 390 |
| 186 | 3300005355 | Ga0070671_100234006 | Ga0070671_1002340062 | 390 |
| 187 | 3300005366 | Ga0070659_100046199 | Ga0070659_1000461992 | 390 |
| 188 | 3300005367 | Ga0070667_100000162 | Ga0070667_10000016218 | 390 |
| 189 | 3300005440 | Ga0070705_100079508 | Ga0070705_1000795082 | 390 |
| 190 | 3300005445 | Ga0070708_100152401 | Ga0070708_1001524011 | 390 |
| 191 | 3300005455 | Ga0070663_100009782 | Ga0070663_1000097822 | 390 |
| 192 | 3300005539 | Ga0068853_100001399 | Ga0068853_1000013992 | 390 |
| 193 | 3300005539 | Ga0068853_100040880 | Ga0068853_1000408803 | 390 |
| 194 | 3300005539 | Ga0068853_100076322 | Ga0068853_1000763222 | 390 |
| 195 | 3300005544 | Ga0070686_100000171 | Ga0070686_10000017121 | 390 |
| 196 | 3300005548 | Ga0070665_100000038 | Ga0070665_100000038187 | 390 |
| 197 | 3300005548 | Ga0070665_100151967 | Ga0070665_1001519672 | 390 |
| 198 | 3300005563 | Ga0068855_100046889 | Ga0068855_1000468892 | 390 |
| 199 | 3300005563 | Ga0068855_100131337 | Ga0068855_1001313372 | 390 |
| 200 | 3300005577 | Ga0068857_100010124 | Ga0068857_1000101247 | 390 |
| 201 | 3300005577 | Ga0068857_100205444 | Ga0068857_1002054442 | 390 |
| 202 | 3300005614 | Ga0068856_100003768 | Ga0068856_10000376814 | 390 |
| 203 | 3300005617 | Ga0068859_100000202 | Ga0068859_10000020214 | 390 |
| 204 | 3300005618 | Ga0068864_100006790 | Ga0068864_1000067903 | 390 |
| 205 | 3300005834 | Ga0068851_10074010 | Ga0068851_100740102 | 390 |
| 206 | 3300005841 | Ga0068863_100000047 | Ga0068863_10000004756 | 390 |
| 207 | 3300005841 | Ga0068863_100017898 | Ga0068863_1000178985 | 390 |
| 208 | 3300005841 | Ga0068863_100019188 | Ga0068863_1000191885 | 390 |
| 209 | 3300005842 | Ga0068858_100012887 | Ga0068858_1000128877 | 390 |
| 210 | 3300005843 | Ga0068860_100032312 | Ga0068860_1000323122 | 390 |
| 211 | 3300005843 | Ga0068860_100112502 | Ga0068860_1001125022 | 390 |
| 212 | 3300005844 | Ga0068862_100006147 | Ga0068862_1000061475 | 390 |
| 213 | 3300006042 | Ga0075368_10000180 | Ga0075368_100001804 | 390 |
| 214 | 3300006178 | Ga0075367_10000047 | Ga0075367_1000004722 | 390 |
| 215 | 3300006871 | Ga0075434_100019793 | Ga0075434_1000197935 | 390 |
| 216 | 3300006931 | Ga0097620_100000202 | Ga0097620_10000020246 | 390 |
| 217 | 3300009011 | Ga0105251_10045041 | Ga0105251_100450412 | 390 |
| 218 | 3300009093 | Ga0105240_10188971 | Ga0105240_101889712 | 390 |
| 219 | 3300009101 | Ga0105247_10000831 | Ga0105247_100008313 | 390 |
| 220 | 3300009147 | Ga0114129_10112701 | Ga0114129_101127012 | 390 |
| 221 | 3300009177 | Ga0105248_10199782 | Ga0105248_101997822 | 390 |
| 222 | 3300009545 | Ga0105237_10195441 | Ga0105237_101954412 | 390 |
| 223 | 3300009551 | Ga0105238_10280126 | Ga0105238_102801262 | 390 |
| 224 | 3300009978 | Ga0105148_100098 | Ga0105148_1000986 | 390 |
| 225 | 3300010375 | Ga0105239_10033054 | Ga0105239_100330542 | 390 |
| 226 | 3300013102 | Ga0157371_10007213 | Ga0157371_100072133 | 390 |
| 227 | 3300013102 | Ga0157371_10017568 | Ga0157371_100175685 | 390 |
| 228 | 3300014326 | Ga0157380_10171278 | Ga0157380_101712782 | 390 |
| 229 | 3300017792 | Ga0163161_10014729 | Ga0163161_100147295 | 390 |
| 230 | 3300017792 | Ga0163161_10215341 | Ga0163161_102153411 | 390 |
| 231 | 3300020070 | Ga0206356_11452870 | Ga0206356_114528702 | 390 |
| 232 | 3300025229 | Ga0209147_101123 | Ga0209147_1011235 | 390 |
| 233 | 3300025291 | Ga0209675_1000025 | Ga0209675_100002558 | 390 |
| 234 | 3300025292 | Ga0209676_1000221 | Ga0209676_10002213 | 390 |
| 235 | 3300025292 | Ga0209676_1000228 | Ga0209676_1000228117 | 390 |
| 236 | 3300025292 | Ga0209676_1000276 | Ga0209676_100027632 | 390 |
| 237 | 3300025292 | Ga0209676_1019053 | Ga0209676_10190534 | 390 |
| 238 | 3300025294 | Ga0209025_1020711 | Ga0209025_10207113 | 390 |
| 239 | 3300025298 | Ga0209050_1000042 | Ga0209050_1000042384 | 390 |
| 240 | 3300025298 | Ga0209050_1004010 | Ga0209050_10040103 | 390 |
| 241 | 3300025298 | Ga0209050_1013953 | Ga0209050_10139533 | 390 |
| 242 | 3300025298 | Ga0209050_1026158 | Ga0209050_10261582 | 390 |
| 243 | 3300025304 | Ga0209257_1000135 | Ga0209257_10001353 | 390 |
| 244 | 3300025304 | Ga0209257_1000229 | Ga0209257_10002293 | 390 |
| 245 | 3300025304 | Ga0209257_1000695 | Ga0209257_100069519 | 390 |
| 246 | 3300025315 | Ga0207697_10003991 | Ga0207697_100039913 | 390 |
| 247 | 3300025900 | Ga0207710_10019206 | Ga0207710_100192063 | 390 |
| 248 | 3300025903 | Ga0207680_10000429 | Ga0207680_1000042914 | 390 |
| 249 | 3300025904 | Ga0207647_10011216 | Ga0207647_100112164 | 390 |
| 250 | 3300025913 | Ga0207695_10046288 | Ga0207695_100462883 | 390 |
| 251 | 3300025919 | Ga0207657_10033667 | Ga0207657_100336672 | 390 |
| 252 | 3300025923 | Ga0207681_10000008 | Ga0207681_1000000838 | 390 |
| 253 | 3300025923 | Ga0207681_10023588 | Ga0207681_100235883 | 390 |
| 254 | 3300025923 | Ga0207681_10056858 | Ga0207681_100568582 | 390 |
| 255 | 3300025925 | Ga0207650_10044248 | Ga0207650_100442483 | 390 |
| 256 | 3300025925 | Ga0207650_10077617 | Ga0207650_100776172 | 390 |
| 257 | 3300025925 | Ga0207650_10087141 | Ga0207650_100871412 | 390 |
| 258 | 3300025927 | Ga0207687_10051764 | Ga0207687_100517642 | 390 |
| 259 | 3300025931 | Ga0207644_10000006 | Ga0207644_1000000628 | 390 |
| 260 | 3300025941 | Ga0207711_10141679 | Ga0207711_101416792 | 390 |
| 261 | 3300025961 | Ga0207712_10009699 | Ga0207712_100096993 | 390 |
| 262 | 3300025972 | Ga0207668_10000195 | Ga0207668_1000019522 | 390 |
| 263 | 3300025972 | Ga0207668_10000731 | Ga0207668_100007319 | 390 |
| 264 | 3300025986 | Ga0207658_10000127 | Ga0207658_1000012755 | 390 |
| 265 | 3300025986 | Ga0207658_10001246 | Ga0207658_1000124615 | 390 |
| 266 | 3300026035 | Ga0207703_10025840 | Ga0207703_100258403 | 390 |
| 267 | 3300026041 | Ga0207639_10004275 | Ga0207639_100042754 | 390 |
| 268 | 3300026041 | Ga0207639_10004953 | Ga0207639_100049533 | 390 |
| 269 | 3300026041 | Ga0207639_10058042 | Ga0207639_100580422 | 390 |
| 270 | 3300026067 | Ga0207678_10000072 | Ga0207678_1000007232 | 390 |
| 271 | 3300026078 | Ga0207702_10377212 | Ga0207702_103772121 | 390 |
| 272 | 3300026088 | Ga0207641_10000079 | Ga0207641_1000007955 | 390 |
| 273 | 3300026088 | Ga0207641_10009520 | Ga0207641_100095204 | 390 |
| 274 | 3300026088 | Ga0207641_10019253 | Ga0207641_100192532 | 390 |
| 275 | 3300026095 | Ga0207676_10002410 | Ga0207676_100024109 | 390 |
| 276 | 3300026116 | Ga0207674_10005919 | Ga0207674_100059195 | 390 |
| 277 | 3300026116 | Ga0207674_10030787 | Ga0207674_100307873 | 390 |
| 278 | 3300026118 | Ga0207675_100006560 | Ga0207675_10000656010 | 390 |
| 279 | 3300026142 | Ga0207698_10024470 | Ga0207698_100244704 | 390 |
| 280 | 3300027866 | Ga0209813_10000267 | Ga0209813_100002676 | 390 |
| 281 | 3300027876 | Ga0209974_10014668 | Ga0209974_100146682 | 390 |
| 282 | 3300028379 | Ga0268266_10000118 | Ga0268266_1000011858 | 390 |
| 283 | 3300028380 | Ga0268265_10000392 | Ga0268265_1000039228 | 390 |
| 284 | 3300028381 | Ga0268264_10000310 | Ga0268264_1000031053 | 390 |
| 285 | 3300028381 | Ga0268264_10010868 | Ga0268264_100108684 | 390 |
| 286 | 3300028794 | Ga0307515_10029188 | Ga0307515_100291885 | 390 |
| 287 | 3300028794 | Ga0307515_10030159 | Ga0307515_100301596 | 390 |
| 288 | 3300031548 | Ga0307408_100058204 | Ga0307408_1000582041 | 390 |
| 289 | 3300031548 | Ga0307408_100282793 | Ga0307408_1002827931 | 390 |
| 290 | 3300031852 | Ga0307410_10003860 | Ga0307410_100038603 | 390 |
| 291 | 3300031911 | Ga0307412_10000348 | Ga0307412_1000034828 | 390 |
| 292 | 3300031911 | Ga0307412_10170937 | Ga0307412_101709372 | 390 |
| 293 | 3300031911 | Ga0307412_10189526 | Ga0307412_101895262 | 390 |
| 294 | 3300032002 | Ga0307416_100158467 | Ga0307416_1001584672 | 390 |
| 295 | 3300032004 | Ga0307414_10000105 | Ga0307414_1000010540 | 390 |
| 296 | 3300032004 | Ga0307414_10001344 | Ga0307414_100013449 | 390 |
| 297 | 3300032004 | Ga0307414_10001394 | Ga0307414_1000139411 | 390 |
| 298 | 3300032004 | Ga0307414_10004671 | Ga0307414_100046715 | 390 |
| 299 | 3300032004 | Ga0307414_10033431 | Ga0307414_100334312 | 390 |
| 300 | 3300038705 | Ga0237819_00788 | Ga0237819_00788_7075_8247 | 390 |
| 301 | 3300039437 | Ga0436365_0361176 | Ga0436365_0361176_13225_14397 | 390 |
| 302 | 3300039453 | Ga0436362_0795015 | Ga0436362_0795015_80_1252 | 390 |
| 303 | 3300045051 | Ga0451576_0000007 | Ga0451576_0000007_311141_312334 | 390 |
| 304 | 3300046452 | Ga0495617_030146 | Ga0495617_030146_172_1359 | 390 |
| 305 | 3300046453 | Ga0495627_000153 | Ga0495627_000153_25679_26851 | 390 |
| 306 | 3300046453 | Ga0495627_001065 | Ga0495627_001065_9552_10724 | 390 |
| 307 | 3300046453 | Ga0495627_006692 | Ga0495627_006692_613_1800 | 390 |
| 308 | 3300046457 | Ga0495590_0001563 | Ga0495590_0001563_517_1689 | 390 |
| 309 | 3300046460 | Ga0495638_0000249 | Ga0495638_0000249_22335_23522 | 390 |
| 310 | 3300046460 | Ga0495638_0000538 | Ga0495638_0000538_5144_6316 | 390 |
| 311 | 3300046460 | Ga0495638_0005278 | Ga0495638_0005278_6854_8026 | 390 |
| 312 | 3300046471 | Ga0495650_0001599 | Ga0495650_0001599_15384_16556 | 390 |
| 313 | 3300046471 | Ga0495650_0015489 | Ga0495650_0015489_2300_3472 | 390 |
| 314 | 3300046491 | Ga0495584_0025509 | Ga0495584_0025509_313_1500 | 390 |
| 315 | 3300046506 | Ga0495583_0000262 | Ga0495583_0000262_57414_58601 | 390 |
| 316 | 3300046507 | Ga0495606_0035299 | Ga0495606_0035299_1630_2802 | 390 |
| 317 | 3300046512 | Ga0495610_0000071 | Ga0495610_0000071_87204_88391 | 390 |
| 318 | 3300046512 | Ga0495610_0000157 | Ga0495610_0000157_62473_63645 | 390 |
| 319 | 3300046512 | Ga0495610_0002386 | Ga0495610_0002386_8689_9861 | 390 |
| 320 | 3300046513 | Ga0495616_0000521 | Ga0495616_0000521_7413_8585 | 390 |
| 321 | 3300046519 | Ga0495632_0000382 | Ga0495632_0000382_9410_10597 | 390 |
| 322 | 3300046519 | Ga0495632_0004994 | Ga0495632_0004994_1342_2529 | 390 |
| 323 | 3300046519 | Ga0495632_0045754 | Ga0495632_0045754_692_1864 | 390 |
| 324 | 3300046520 | Ga0495637_0013103 | Ga0495637_0013103_1309_2496 | 390 |
| 325 | 3300046520 | Ga0495637_0022716 | Ga0495637_0022716_893_2080 | 390 |
| 326 | 3300046522 | Ga0495643_0000053 | Ga0495643_0000053_192756_193943 | 390 |
| 327 | 3300046522 | Ga0495643_0003981 | Ga0495643_0003981_820_1992 | 390 |
| 328 | 3300046524 | Ga0495648_0000015 | Ga0495648_0000015_224409_225596 | 390 |
| 329 | 3300046524 | Ga0495648_0000509 | Ga0495648_0000509_21520_22692 | 390 |
| 330 | 3300046524 | Ga0495648_0020032 | Ga0495648_0020032_541_1713 | 390 |
| 331 | 3300046525 | Ga0495663_0000020 | Ga0495663_0000020_7933_9120 | 390 |
| 332 | 3300046542 | Ga0495597_0003545 | Ga0495597_0003545_4360_5532 | 390 |
| 333 | 3300046557 | Ga0495622_0012466 | Ga0495622_0012466_1433_2605 | 390 |
| 334 | 3300046557 | Ga0495622_0026398 | Ga0495622_0026398_849_2060 | 390 |
| 335 | 3300046558 | Ga0495633_0000400 | Ga0495633_0000400_26735_27913 | 390 |
| 336 | 3300046558 | Ga0495633_0002316 | Ga0495633_0002316_12066_13238 | 390 |
| 337 | 3300046558 | Ga0495633_0007042 | Ga0495633_0007042_265_1452 | 390 |
| 338 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_792674_793846 | 390 |
| 339 | 3300046616 | Ga0495668_0000105 | Ga0495668_0000105_14431_15603 | 390 |
| 340 | 3300046616 | Ga0495668_0006076 | Ga0495668_0006076_1096_2268 | 390 |
| 341 | 3300046616 | Ga0495668_0036879 | Ga0495668_0036879_968_2140 | 390 |
| 342 | 3300046616 | Ga0495668_0061898 | Ga0495668_0061898_789_1991 | 390 |
| 343 | 3300046660 | Ga0495625_0000198 | Ga0495625_0000198_45294_46481 | 390 |
| 344 | 3300046660 | Ga0495625_0005243 | Ga0495625_0005243_10113_11285 | 390 |
| 345 | 3300046660 | Ga0495625_0007331 | Ga0495625_0007331_5553_6755 | 390 |
| 346 | 3300046660 | Ga0495625_0023261 | Ga0495625_0023261_175_1347 | 390 |
| 347 | 3300046692 | Ga0495671_0000031 | Ga0495671_0000031_8089_9276 | 390 |
| 348 | 3300046692 | Ga0495671_0000084 | Ga0495671_0000084_57614_58801 | 390 |
| 349 | 3300046692 | Ga0495671_0005263 | Ga0495671_0005263_2670_3881 | 390 |
| 350 | 3300046694 | Ga0495649_0000684 | Ga0495649_0000684_6324_7535 | 390 |
| 351 | 3300046794 | Ga0495589_0010961 | Ga0495589_0010961_597_1769 | 390 |
| 352 | 3300047469 | Ga0495673_0000156 | Ga0495673_0000156_24979_26151 | 390 |
| 353 | 3300047469 | Ga0495673_0000206 | Ga0495673_0000206_29743_30930 | 390 |
| 354 | 3300047469 | Ga0495673_0001785 | Ga0495673_0001785_1387_2559 | 390 |
| 355 | 3300047469 | Ga0495673_0002305 | Ga0495673_0002305_232_1404 | 390 |
| 356 | 3300047470 | Ga0495681_0000008 | Ga0495681_0000008_55954_57141 | 390 |
| 357 | 3300047470 | Ga0495681_0009019 | Ga0495681_0009019_1443_2630 | 390 |
| 358 | 3300047472 | Ga0495686_0001010 | Ga0495686_0001010_6345_7517 | 390 |
| 359 | 3300047472 | Ga0495686_0059177 | Ga0495686_0059177_617_1804 | 390 |
| 360 | 3300047472 | Ga0495686_0080216 | Ga0495686_0080216_428_1615 | 390 |
| 361 | 3300047472 | Ga0495686_0129455 | Ga0495686_0129455_234_1406 | 390 |
| 362 | 3300048088 | Ga0495602_0109186 | Ga0495602_0109186_619_1791 | 390 |
| 363 | 3300048909 | Ga0496106_0046888 | Ga0496106_0046888_381_1553 | 390 |
| 364 | 3300048910 | Ga0496107_0000069 | Ga0496107_0000069_16493_17665 | 390 |
| 365 | 3300048911 | Ga0496108_0003383 | Ga0496108_0003383_8971_10143 | 390 |
| 366 | 3300048911 | Ga0496108_0257288 | Ga0496108_0257288_190_1362 | 390 |
| 367 | 3300048913 | Ga0496110_0006266 | Ga0496110_0006266_822_1994 | 390 |
| 368 | 3300048913 | Ga0496110_0145990 | Ga0496110_0145990_214_1386 | 390 |
| 369 | 3300048914 | Ga0496111_0067377 | Ga0496111_0067377_815_1987 | 390 |
| 370 | 3300048919 | Ga0496116_0036430 | Ga0496116_0036430_1385_2557 | 390 |
| 371 | 3300048919 | Ga0496116_0073181 | Ga0496116_0073181_214_1386 | 390 |
| 372 | 3300048920 | Ga0496117_0006257 | Ga0496117_0006257_3634_4806 | 390 |
| 373 | 3300048921 | Ga0496118_0052082 | Ga0496118_0052082_265_1437 | 390 |
| 374 | 3300048924 | Ga0496121_0001861 | Ga0496121_0001861_19915_21087 | 390 |
| 375 | 3300048924 | Ga0496121_0007980 | Ga0496121_0007980_6293_7465 | 390 |
| 376 | 3300048924 | Ga0496121_0054144 | Ga0496121_0054144_1405_2577 | 390 |
| 377 | 3300048925 | Ga0496122_0000934 | Ga0496122_0000934_38908_40095 | 390 |
| 378 | 3300048925 | Ga0496122_0016810 | Ga0496122_0016810_3024_4196 | 390 |
| 379 | 3300048926 | Ga0496123_0000740 | Ga0496123_0000740_12933_14120 | 390 |
| 380 | 3300048926 | Ga0496123_0000968 | Ga0496123_0000968_17592_18764 | 390 |
| 381 | 3300048927 | Ga0496124_0007646 | Ga0496124_0007646_1499_2671 | 390 |
| 382 | 3300048927 | Ga0496124_0078087 | Ga0496124_0078087_804_1976 | 390 |
| 383 | 3300048928 | Ga0496125_0000174 | Ga0496125_0000174_131750_132922 | 390 |
| 384 | 3300048928 | Ga0496125_0000335 | Ga0496125_0000335_26867_28039 | 390 |
| 385 | 3300048928 | Ga0496125_0032733 | Ga0496125_0032733_3377_4549 | 390 |
| 386 | 3300048928 | Ga0496125_0092389 | Ga0496125_0092389_132_1304 | 390 |
| 387 | 3300048929 | Ga0496126_0010711 | Ga0496126_0010711_7556_8728 | 390 |
| 388 | 3300049459 | Ga0495678_000680 | Ga0495678_000680_5367_6539 | 390 |
| 389 | 3300049551 | Ga0501335_000089 | Ga0501335_000089_1288_2460 | 390 |
| 390 | 3300049568 | Ga0501031_0129881 | Ga0501031_0129881_383_1555 | 390 |
| 391 | 3300049569 | Ga0501032_0020975 | Ga0501032_0020975_1335_2507 | 390 |
| 392 | 3300049571 | Ga0501034_0011101 | Ga0501034_0011101_1780_2952 | 390 |
| 393 | 3300049571 | Ga0501034_0041377 | Ga0501034_0041377_2318_3505 | 390 |
| 394 | 3300049572 | Ga0501036_0017409 | Ga0501036_0017409_3425_4597 | 390 |
| 395 | 3300049573 | Ga0501037_0038452 | Ga0501037_0038452_1660_2832 | 390 |
| 396 | 3300049574 | Ga0501038_0036373 | Ga0501038_0036373_995_2167 | 390 |
| 397 | 3300049575 | Ga0501039_0075322 | Ga0501039_0075322_476_1648 | 390 |
| 398 | 3300049581 | Ga0501047_0054028 | Ga0501047_0054028_1437_2609 | 390 |
| 399 | 3300049663 | Ga0501223_000043 | Ga0501223_000043_12691_13863 | 390 |
| 400 | 3300049663 | Ga0501223_000082 | Ga0501223_000082_5476_6648 | 390 |
| 401 | 3300049664 | Ga0501224_000019 | Ga0501224_000019_63886_65058 | 390 |
| 402 | 3300049669 | Ga0501235_009973 | Ga0501235_009973_590_1762 | 390 |
| 403 | 3300049705 | Ga0501225_0000059 | Ga0501225_0000059_11107_12279 | 390 |
| 404 | 3300049705 | Ga0501225_0000065 | Ga0501225_0000065_12581_13753 | 390 |
| 405 | 3300049707 | Ga0501234_003656 | Ga0501234_003656_60_1232 | 390 |
| 406 | 3300049822 | Ga0501035_0062642 | Ga0501035_0062642_1525_2697 | 390 |
| 407 | 3300049853 | Ga0501226_000080 | Ga0501226_000080_15385_16557 | 390 |
| 408 | 3300050494 | nmdc:mga06z11_7_c1 | nmdc:mga06z11_7_c1_23874_25082 | 390 |
| 409 | 3300050495 | nmdc:mga04h51_70_c1 | nmdc:mga04h51_70_c1_8659_9867 | 390 |
| 410 | 3300050512 | nmdc:mga0n895_23671_c1 | nmdc:mga0n895_23671_c1_193_1365 | 390 |
| 411 | 3300053080 | Ga0500635_0000049 | Ga0500635_0000049_76515_77687 | 390 |
| 412 | 3300053086 | Ga0500578_0000166 | Ga0500578_0000166_31789_32961 | 390 |
| 413 | 3300053087 | Ga0500643_000420 | Ga0500643_000420_27041_28213 | 390 |
| 414 | 3300053087 | Ga0500643_006102 | Ga0500643_006102_308_1510 | 390 |
| 415 | 3300053087 | Ga0500643_006176 | Ga0500643_006176_3808_4995 | 390 |
| 416 | 3300053088 | Ga0500644_0000913 | Ga0500644_0000913_37_1209 | 390 |
| 417 | 3300053088 | Ga0500644_0003579 | Ga0500644_0003579_1978_3150 | 390 |
| 418 | 3300053091 | Ga0500647_0063787 | Ga0500647_0063787_454_1626 | 390 |
| 419 | 3300053096 | Ga0500641_0000140 | Ga0500641_0000140_10657_11829 | 390 |
| 420 | 3300053096 | Ga0500641_0019886 | Ga0500641_0019886_1273_2445 | 390 |
| 421 | 3300053098 | Ga0500650_0059730 | Ga0500650_0059730_494_1696 | 390 |
| 422 | 3300053104 | Ga0500556_0000157 | Ga0500556_0000157_20091_21293 | 390 |
| 423 | 3300053104 | Ga0500556_0002655 | Ga0500556_0002655_1574_2746 | 390 |
| 424 | 3300053108 | Ga0500562_000906 | Ga0500562_000906_2712_3884 | 390 |
| 425 | 3300053108 | Ga0500562_004234 | Ga0500562_004234_1775_2947 | 390 |
| 426 | 3300053108 | Ga0500562_014413 | Ga0500562_014413_659_1861 | 390 |
| 427 | 3300053116 | Ga0500592_012266 | Ga0500592_012266_143_1330 | 390 |
| 428 | 3300053118 | Ga0500594_0000310 | Ga0500594_0000310_3511_4683 | 390 |
| 429 | 3300053118 | Ga0500594_0003550 | Ga0500594_0003550_1650_2861 | 390 |
| 430 | 3300053119 | Ga0500595_001328 | Ga0500595_001328_5935_7137 | 390 |
| 431 | 3300053119 | Ga0500595_004701 | Ga0500595_004701_468_1640 | 390 |
| 432 | 3300053122 | Ga0500608_000089 | Ga0500608_000089_3187_4359 | 390 |
| 433 | 3300053122 | Ga0500608_000443 | Ga0500608_000443_7681_8853 | 390 |
| 434 | 3300053125 | Ga0500618_000413 | Ga0500618_000413_19699_20871 | 390 |
| 435 | 3300053130 | Ga0500642_0000002 | Ga0500642_0000002_189760_190962 | 390 |
| 436 | 3300053136 | Ga0500559_0002480 | Ga0500559_0002480_4496_5668 | 390 |
| 437 | 3300053136 | Ga0500559_0004237 | Ga0500559_0004237_1929_3116 | 390 |
| 438 | 3300053138 | Ga0500564_028774 | Ga0500564_028774_40_1212 | 390 |
| 439 | 3300053139 | Ga0500568_0006701 | Ga0500568_0006701_3507_4679 | 390 |
| 440 | 3300053140 | Ga0500573_0000045 | Ga0500573_0000045_82743_83915 | 390 |
| 441 | 3300053142 | Ga0500577_0004110 | Ga0500577_0004110_2625_3797 | 390 |
| 442 | 3300053151 | Ga0500604_0025338 | Ga0500604_0025338_310_1482 | 390 |
| 443 | 3300053153 | Ga0500616_0004927 | Ga0500616_0004927_3525_4697 | 390 |
| 444 | 3300053156 | Ga0500622_0000784 | Ga0500622_0000784_25036_26208 | 390 |
| 445 | 3300053156 | Ga0500622_0001641 | Ga0500622_0001641_4105_5277 | 390 |
| 446 | 3300053156 | Ga0500622_0002715 | Ga0500622_0002715_3718_4890 | 390 |
| 447 | 3300053156 | Ga0500622_0011133 | Ga0500622_0011133_715_1887 | 390 |
| 448 | 3300053156 | Ga0500622_0045283 | Ga0500622_0045283_135_1337 | 390 |
| 449 | 3300053157 | Ga0500624_000007 | Ga0500624_000007_35654_36826 | 390 |
| 450 | 3300053157 | Ga0500624_000249 | Ga0500624_000249_9068_10255 | 390 |
| 451 | 3300053158 | Ga0500627_0000005 | Ga0500627_0000005_132180_133367 | 390 |
| 452 | 3300053158 | Ga0500627_0062286 | Ga0500627_0062286_290_1462 | 390 |
| 453 | 3300053177 | Ga0500636_0004345 | Ga0500636_0004345_1478_2665 | 390 |
| 454 | 3300053177 | Ga0500636_0036569 | Ga0500636_0036569_922_2094 | 390 |
| 455 | 3300053177 | Ga0500636_0072345 | Ga0500636_0072345_674_1846 | 390 |
| 456 | 3300053729 | Ga0500625_067245 | Ga0500625_067245_314_1486 | 390 |
| 457 | 3300053730 | Ga0500645_000262 | Ga0500645_000262_310_1482 | 390 |
| 458 | 3300053730 | Ga0500645_000313 | Ga0500645_000313_16306_17478 | 390 |
| 459 | 3300053730 | Ga0500645_000449 | Ga0500645_000449_24855_26057 | 390 |
| 460 | 3300053735 | Ga0500596_000147 | Ga0500596_000147_2581_3753 | 390 |
| 461 | 3300006353 | Ga0075370_10015522 | Ga0075370_100155224 | 391 |
| 462 | 3300042438 | Ga0439459_0020220 | Ga0439459_0020220_26_1201 | 391 |
| 463 | 3300049571 | Ga0501034_0113084 | Ga0501034_0113084_732_1910 | 391 |
| 464 | 3300050496 | nmdc:mga07m45_47739_c1 | nmdc:mga07m45_47739_c1_363_1538 | 391 |
| 465 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_981012_982190 | 391 |
| 466 | 3300053087 | Ga0500643_000905 | Ga0500643_000905_11519_12694 | 391 |
| 467 | 3300053108 | Ga0500562_000275 | Ga0500562_000275_5658_6836 | 391 |
| 468 | 3300053136 | Ga0500559_0007978 | Ga0500559_0007978_711_1886 | 391 |
| 469 | 3300055283 | Ga0500661_005870 | Ga0500661_005870_427_1602 | 391 |
| 470 | 3300025298 | Ga0209050_1000265 | Ga0209050_100026569 | 392 |
| 471 | 3300032005 | Ga0307411_10096940 | Ga0307411_100969402 | 392 |
| 472 | 3300032133 | Ga0316583_10011256 | Ga0316583_100112561 | 392 |
| 473 | 3300033180 | Ga0307510_10102461 | Ga0307510_101024612 | 392 |
| 474 | 3300036647 | Ga0316582_0096788 | Ga0316582_0096788_260_1438 | 392 |
| 475 | 3300046453 | Ga0495627_012656 | Ga0495627_012656_96_1274 | 392 |
| 476 | 3300046500 | Ga0495596_0000823 | Ga0495596_0000823_14252_15430 | 392 |
| 477 | 3300046506 | Ga0495583_0035032 | Ga0495583_0035032_767_1945 | 392 |
| 478 | 3300046512 | Ga0495610_0000044 | Ga0495610_0000044_128481_129659 | 392 |
| 479 | 3300046515 | Ga0495620_0067975 | Ga0495620_0067975_220_1398 | 392 |
| 480 | 3300046519 | Ga0495632_0007134 | Ga0495632_0007134_84_1262 | 392 |
| 481 | 3300046520 | Ga0495637_0009782 | Ga0495637_0009782_1239_2426 | 392 |
| 482 | 3300046660 | Ga0495625_0004423 | Ga0495625_0004423_2072_3259 | 392 |
| 483 | 3300047320 | Ga0495672_0004227 | Ga0495672_0004227_9011_10198 | 392 |
| 484 | 3300047470 | Ga0495681_0000662 | Ga0495681_0000662_24887_26065 | 392 |
| 485 | 3300048907 | Ga0496104_0047635 | Ga0496104_0047635_857_2035 | 392 |
| 486 | 3300048919 | Ga0496116_0000017 | Ga0496116_0000017_91968_93146 | 392 |
| 487 | 3300048921 | Ga0496118_0030554 | Ga0496118_0030554_420_1598 | 392 |
| 488 | 3300048924 | Ga0496121_0005216 | Ga0496121_0005216_13708_14886 | 392 |
| 489 | 3300048925 | Ga0496122_0002119 | Ga0496122_0002119_5714_6892 | 392 |
| 490 | 3300048926 | Ga0496123_0000991 | Ga0496123_0000991_34872_36050 | 392 |
| 491 | 3300048926 | Ga0496123_0002006 | Ga0496123_0002006_1801_2979 | 392 |
| 492 | 3300048927 | Ga0496124_0015705 | Ga0496124_0015705_3253_4431 | 392 |
| 493 | 3300048927 | Ga0496124_0016533 | Ga0496124_0016533_2038_3216 | 392 |
| 494 | 3300048928 | Ga0496125_0068607 | Ga0496125_0068607_738_1916 | 392 |
| 495 | 3300048929 | Ga0496126_0000359 | Ga0496126_0000359_68221_69399 | 392 |
| 496 | 3300053104 | Ga0500556_0001174 | Ga0500556_0001174_10067_11254 | 392 |
| 497 | 3300053121 | Ga0500607_002276 | Ga0500607_002276_4511_5689 | 392 |
| 498 | 3300053136 | Ga0500559_0000070 | Ga0500559_0000070_51033_52223 | 392 |
| 499 | 3300053148 | Ga0500590_000657 | Ga0500590_000657_5964_7142 | 392 |
| 500 | 3300053730 | Ga0500645_002606 | Ga0500645_002606_2800_3987 | 392 |
| 501 | 3300002459 | JGI24751J29686_10000080 | JGI24751J29686_1000008032 | 393 |
| 502 | 3300005353 | Ga0070669_100001337 | Ga0070669_1000013375 | 393 |
| 503 | 3300005355 | Ga0070671_100000050 | Ga0070671_10000005070 | 393 |
| 504 | 3300005563 | Ga0068855_100001903 | Ga0068855_10000190321 | 393 |
| 505 | 3300005563 | Ga0068855_100041968 | Ga0068855_1000419683 | 393 |
| 506 | 3300005842 | Ga0068858_100274190 | Ga0068858_1002741902 | 393 |
| 507 | 3300005843 | Ga0068860_100413288 | Ga0068860_1004132882 | 393 |
| 508 | 3300009093 | Ga0105240_10312200 | Ga0105240_103122002 | 393 |
| 509 | 3300025923 | Ga0207681_10000174 | Ga0207681_1000017413 | 393 |
| 510 | 3300025925 | Ga0207650_10130054 | Ga0207650_101300543 | 393 |
| 511 | 3300025931 | Ga0207644_10000003 | Ga0207644_1000000370 | 393 |
| 512 | 3300025941 | Ga0207711_10092915 | Ga0207711_100929152 | 393 |
| 513 | 3300025949 | Ga0207667_10033487 | Ga0207667_100334875 | 393 |
| 514 | 3300026035 | Ga0207703_10135661 | Ga0207703_101356612 | 393 |
| 515 | 3300026095 | Ga0207676_10149672 | Ga0207676_101496722 | 393 |
| 516 | 3300028379 | Ga0268266_10236322 | Ga0268266_102363221 | 393 |
| 517 | 3300048903 | Ga0496100_0034817 | Ga0496100_0034817_393_1574 | 393 |
| 518 | 3300048904 | Ga0496101_0138813 | Ga0496101_0138813_139_1320 | 393 |
| 519 | 3300048905 | Ga0496102_0021718 | Ga0496102_0021718_873_2054 | 393 |
| 520 | 3300048906 | Ga0496103_0069361 | Ga0496103_0069361_490_1671 | 393 |
| 521 | 3300048910 | Ga0496107_0004656 | Ga0496107_0004656_1599_2780 | 393 |
| 522 | 3300048911 | Ga0496108_0089226 | Ga0496108_0089226_256_1437 | 393 |
| 523 | 3300048916 | Ga0496113_0006350 | Ga0496113_0006350_3771_4952 | 393 |
| 524 | 3300053087 | Ga0500643_000969 | Ga0500643_000969_8050_9246 | 393 |
| 525 | iso_pu_bacteria | 2738541275 | 2738710003 | 393 |
| 526 | iso_pu_bacteria | 2738541301 | 2738848428 | 393 |
| 527 | iso_pu_bacteria | 2738541304 | 2738864157 | 393 |
| 528 | iso_pu_bacteria | 2738543022 | 2739296675 | 393 |
| 529 | iso_pu_bacteria | 2738543033 | 2739358353 | 393 |
| 530 | iso_pu_bacteria | 2739367664 | 2739649788 | 393 |
| 531 | iso_pu_bacteria | 2739367865 | 2740028261 | 393 |
| 532 | iso_pu_bacteria | 2928100450 | 2928101702 | 393 |
| 533 | iso_pu_bacteria | 2928959182 | 2928959792 | 393 |
| 534 | 3300048928 | Ga0496125_0119155 | Ga0496125_0119155_637_1836 | 394 |
| 535 | 3300006195 | Ga0075366_10001540 | Ga0075366_100015406 | 395 |
| 536 | 3300025972 | Ga0207668_10053922 | Ga0207668_100539223 | 396 |
| 537 | iso_pu_bacteria | 2510917021 | 2511127180 | 396 |
| 538 | 2162886007 | SwRhRL2b_contig_2199698 | SwRhRL2b_0330.00002730 | 397 |
| 539 | 3300005289 | Ga0065704_10071330 | Ga0065704_100713302 | 397 |
| 540 | 3300005353 | Ga0070669_100003132 | Ga0070669_1000031322 | 397 |
| 541 | 3300005355 | Ga0070671_100015177 | Ga0070671_1000151773 | 397 |
| 542 | 3300005367 | Ga0070667_100003157 | Ga0070667_1000031579 | 397 |
| 543 | 3300005548 | Ga0070665_100090119 | Ga0070665_1000901192 | 397 |
| 544 | 3300005841 | Ga0068863_100055440 | Ga0068863_1000554402 | 397 |
| 545 | 3300005842 | Ga0068858_100038491 | Ga0068858_1000384914 | 397 |
| 546 | 3300009092 | Ga0105250_10028650 | Ga0105250_100286502 | 397 |
| 547 | 3300009177 | Ga0105248_10346510 | Ga0105248_103465102 | 397 |
| 548 | 3300013306 | Ga0163162_10011771 | Ga0163162_100117715 | 397 |
| 549 | 3300013306 | Ga0163162_10031350 | Ga0163162_100313502 | 397 |
| 550 | 3300025923 | Ga0207681_10001207 | Ga0207681_100012072 | 397 |
| 551 | 3300025931 | Ga0207644_10018358 | Ga0207644_100183583 | 397 |
| 552 | 3300025941 | Ga0207711_10222963 | Ga0207711_102229631 | 397 |
| 553 | 3300025986 | Ga0207658_10002244 | Ga0207658_100022449 | 397 |
| 554 | 3300026035 | Ga0207703_10027104 | Ga0207703_100271043 | 397 |
| 555 | 3300028379 | Ga0268266_10005550 | Ga0268266_100055507 | 397 |
| 556 | 3300028379 | Ga0268266_10099992 | Ga0268266_100999922 | 397 |
| 557 | 3300028380 | Ga0268265_10116846 | Ga0268265_101168462 | 397 |
| 558 | 3300048905 | Ga0496102_0000305 | Ga0496102_0000305_9138_10334 | 397 |
| 559 | 3300048906 | Ga0496103_0000475 | Ga0496103_0000475_14174_15370 | 397 |
| 560 | 3300048907 | Ga0496104_0000293 | Ga0496104_0000293_33820_35016 | 397 |
| 561 | 3300048908 | Ga0496105_0003464 | Ga0496105_0003464_1364_2560 | 397 |
| 562 | 3300048916 | Ga0496113_0000622 | Ga0496113_0000622_1522_2718 | 397 |
| 563 | 3300048920 | Ga0496117_0000694 | Ga0496117_0000694_51872_53068 | 397 |
| 564 | 3300048922 | Ga0496119_0000040 | Ga0496119_0000040_182985_184181 | 397 |
| 565 | 3300048923 | Ga0496120_0004492 | Ga0496120_0004492_9172_10368 | 397 |
| 566 | 3300048925 | Ga0496122_0003521 | Ga0496122_0003521_5244_6440 | 397 |
| 567 | 3300048927 | Ga0496124_0010873 | Ga0496124_0010873_5271_6467 | 397 |
| 568 | 3300048929 | Ga0496126_0000044 | Ga0496126_0000044_144095_145291 | 397 |
| 569 | 3300053122 | Ga0500608_000512 | Ga0500608_000512_5147_6343 | 397 |
| 570 | 3300053138 | Ga0500564_003263 | Ga0500564_003263_3668_4864 | 397 |
| 571 | 3300053729 | Ga0500625_000010 | Ga0500625_000010_130061_131257 | 397 |
| 572 | 3300005289 | Ga0065704_10109097 | Ga0065704_101090973 | 398 |
| 573 | 3300005295 | Ga0065707_10090532 | Ga0065707_100905324 | 398 |
| 574 | 3300005843 | Ga0068860_100048688 | Ga0068860_1000486883 | 398 |
| 575 | 3300006353 | Ga0075370_10014025 | Ga0075370_100140252 | 398 |
| 576 | 3300028381 | Ga0268264_10034608 | Ga0268264_100346083 | 398 |
| 577 | 3300049571 | Ga0501034_0307683 | Ga0501034_0307683_82_1278 | 398 |
| 578 | 3300050496 | nmdc:mga07m45_43585_c1 | nmdc:mga07m45_43585_c1_641_1837 | 398 |
| 579 | 3300053087 | Ga0500643_006792 | Ga0500643_006792_2566_3762 | 398 |
| 580 | 3300053121 | Ga0500607_000443 | Ga0500607_000443_28713_29909 | 398 |
| 581 | 3300053136 | Ga0500559_0036444 | Ga0500559_0036444_241_1437 | 398 |
| 582 | 3300053148 | Ga0500590_045171 | Ga0500590_045171_866_2062 | 398 |
| 583 | 3300053156 | Ga0500622_0000491 | Ga0500622_0000491_15016_16212 | 398 |
| 584 | 3300053730 | Ga0500645_002637 | Ga0500645_002637_2976_4172 | 398 |
| 585 | 3300005289 | Ga0065704_10005515 | Ga0065704_100055152 | 399 |
| 586 | 3300006038 | Ga0075365_10171319 | Ga0075365_101713191 | 399 |
| 587 | 3300006042 | Ga0075368_10001487 | Ga0075368_100014877 | 399 |
| 588 | 3300006048 | Ga0075363_100000064 | Ga0075363_1000000643 | 399 |
| 589 | 3300006048 | Ga0075363_100002606 | Ga0075363_1000026063 | 399 |
| 590 | 3300006051 | Ga0075364_10093813 | Ga0075364_100938132 | 399 |
| 591 | 3300006177 | Ga0075362_10000093 | Ga0075362_1000009314 | 399 |
| 592 | 3300006177 | Ga0075362_10011866 | Ga0075362_100118663 | 399 |
| 593 | 3300006178 | Ga0075367_10052589 | Ga0075367_100525893 | 399 |
| 594 | 3300006186 | Ga0075369_10003568 | Ga0075369_100035682 | 399 |
| 595 | 3300006186 | Ga0075369_10004395 | Ga0075369_100043953 | 399 |
| 596 | 3300006195 | Ga0075366_10000014 | Ga0075366_100000146 | 399 |
| 597 | 3300006195 | Ga0075366_10031282 | Ga0075366_100312821 | 399 |
| 598 | 3300006353 | Ga0075370_10000056 | Ga0075370_1000005622 | 399 |
| 599 | 3300006353 | Ga0075370_10068604 | Ga0075370_100686043 | 399 |
| 600 | 3300017792 | Ga0163161_10001436 | Ga0163161_100014365 | 399 |
| 601 | 3300027866 | Ga0209813_10000118 | Ga0209813_1000011818 | 399 |
| 602 | 3300031616 | Ga0307508_10024853 | Ga0307508_100248535 | 399 |
| 603 | 3300044712 | Ga0453684_0410421 | Ga0453684_0410421_150_1349 | 399 |
| 604 | 3300049823 | Ga0501044_0000346 | Ga0501044_0000346_25740_26939 | 399 |
| 605 | 3300050489 | nmdc:mga03683_64_c1 | nmdc:mga03683_64_c1_15833_17032 | 399 |
| 606 | 3300050489 | nmdc:mga03683_744_c1 | nmdc:mga03683_744_c1_4238_5437 | 399 |
| 607 | 3300050490 | nmdc:mga03n38_1850_c1 | nmdc:mga03n38_1850_c1_3658_4857 | 399 |
| 608 | 3300050493 | nmdc:mga0k408_52349_c1 | nmdc:mga0k408_52349_c1_336_1535 | 399 |
| 609 | 3300050493 | nmdc:mga0k408_7_c1 | nmdc:mga0k408_7_c1_60447_61646 | 399 |
| 610 | 3300050495 | nmdc:mga04h51_582_c1 | nmdc:mga04h51_582_c1_827_2026 | 399 |
| 611 | 3300050496 | nmdc:mga07m45_3_c1 | nmdc:mga07m45_3_c1_139342_140541 | 399 |
| 612 | 3300050516 | nmdc:mga0sz30_2963_c1 | nmdc:mga0sz30_2963_c1_2015_3214 | 399 |
| 613 | 2162886007 | SwRhRL2b_contig_1604904 | SwRhRL2b_0308.00002520 | 400 |
| 614 | 2162886007 | SwRhRL2b_contig_2586087 | SwRhRL2b_0310.00004350 | 400 |
| 615 | 3300005289 | Ga0065704_10000191 | Ga0065704_10000191237 | 400 |
| 616 | 3300005289 | Ga0065704_10082800 | Ga0065704_100828001 | 400 |
| 617 | 3300005353 | Ga0070669_100000990 | Ga0070669_10000099015 | 400 |
| 618 | 3300005355 | Ga0070671_100015289 | Ga0070671_1000152894 | 400 |
| 619 | 3300005367 | Ga0070667_100000678 | Ga0070667_1000006783 | 400 |
| 620 | 3300005548 | Ga0070665_100064630 | Ga0070665_1000646302 | 400 |
| 621 | 3300005841 | Ga0068863_100004204 | Ga0068863_1000042048 | 400 |
| 622 | 3300005841 | Ga0068863_100042659 | Ga0068863_1000426594 | 400 |
| 623 | 3300005842 | Ga0068858_100032105 | Ga0068858_1000321053 | 400 |
| 624 | 3300005844 | Ga0068862_100005421 | Ga0068862_1000054218 | 400 |
| 625 | 3300009011 | Ga0105251_10002779 | Ga0105251_1000277912 | 400 |
| 626 | 3300009177 | Ga0105248_10096952 | Ga0105248_100969524 | 400 |
| 627 | 3300025923 | Ga0207681_10002809 | Ga0207681_100028092 | 400 |
| 628 | 3300025931 | Ga0207644_10004801 | Ga0207644_100048013 | 400 |
| 629 | 3300025941 | Ga0207711_10078860 | Ga0207711_100788604 | 400 |
| 630 | 3300025986 | Ga0207658_10006257 | Ga0207658_100062573 | 400 |
| 631 | 3300026088 | Ga0207641_10005158 | Ga0207641_100051587 | 400 |
| 632 | 3300026088 | Ga0207641_10013920 | Ga0207641_100139203 | 400 |
| 633 | 3300028379 | Ga0268266_10047584 | Ga0268266_100475844 | 400 |
| 634 | 3300028380 | Ga0268265_10003351 | Ga0268265_100033514 | 400 |
| 635 | 3300028381 | Ga0268264_10003810 | Ga0268264_100038109 | 400 |
| 636 | 3300041509 | Ga0451843_1520595 | Ga0451843_1520595_32_1249 | 400 |
| 637 | 3300046460 | Ga0495638_0037924 | Ga0495638_0037924_1622_2824 | 400 |
| 638 | 3300046474 | Ga0495605_0043655 | Ga0495605_0043655_784_1986 | 400 |
| 639 | 3300046500 | Ga0495596_0010361 | Ga0495596_0010361_1774_2976 | 400 |
| 640 | 3300046501 | Ga0495607_0016876 | Ga0495607_0016876_2709_3911 | 400 |
| 641 | 3300046512 | Ga0495610_0001676 | Ga0495610_0001676_13041_14243 | 400 |
| 642 | 3300046522 | Ga0495643_0000007 | Ga0495643_0000007_59023_60225 | 400 |
| 643 | 3300046522 | Ga0495643_0033129 | Ga0495643_0033129_1152_2354 | 400 |
| 644 | 3300046538 | Ga0495609_0002808 | Ga0495609_0002808_7652_8854 | 400 |
| 645 | 3300046692 | Ga0495671_0056849 | Ga0495671_0056849_668_1870 | 400 |
| 646 | 3300048920 | Ga0496117_0014877 | Ga0496117_0014877_2521_3723 | 400 |
| 647 | 3300048923 | Ga0496120_0053889 | Ga0496120_0053889_1000_2202 | 400 |
| 648 | 3300048924 | Ga0496121_0013581 | Ga0496121_0013581_4300_5502 | 400 |
| 649 | 3300048928 | Ga0496125_0030396 | Ga0496125_0030396_2440_3642 | 400 |
| 650 | 3300048928 | Ga0496125_0065945 | Ga0496125_0065945_579_1781 | 400 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mt1-assembly1.cif.gz_A | crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti | 0.9089 | 19 | 400 |
| 3mt1-assembly1.cif.gz_A | crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti | 0.9064 | 19 | 400 |
| 3n29-assembly1.cif.gz_B | crystal structure of carboxynorspermidine decarboxylase complexed with norspermidine from campylobacter jejuni | 0.9048 | 19 | 398 |
| 3n29-assembly1.cif.gz_B | crystal structure of carboxynorspermidine decarboxylase complexed with norspermidine from campylobacter jejuni | 0.9001 | 19 | 398 |
| 3mt1-assembly1.cif.gz_B | crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti | 0.8596 | 19 | 400 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n29B02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.945 | 29 | 258 | 3.20.20.10 |
| 3n29B02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9281 | 29 | 258 | 3.20.20.10 |
| 3mt1A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.8925 | 29 | 258 | 3.20.20.10 |
| 3mt1A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.8756 | 29 | 258 | 3.20.20.10 |
| af_Q75JL7_37_281_3.20.20.10 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.8074 | 27 | 247 | 3.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D3VS20-F1-model_v4 | Carboxynorspermidine decarboxylase | 0.988 | 16 | 106 |
|
| AF-A0A1B6NU86-F1-model_v4 | Carboxynorspermidine decarboxylase | 0.9745 | 52 | 123 |
|
| AF-A0A2D8FR00-F1-model_v4 | Carboxynorspermidine decarboxylase | 0.9723 | 1 | 242 |
GO:0008836
GO:0009089 |
| AF-A0A847C191-F1-model_v4 | Carboxynorspermidine decarboxylase | 0.9696 | 17 | 129 |
|
| AF-A0A4Q3Z9F9-F1-model_v4 | Carboxynorspermidine decarboxylase | 0.9686 | 1 | 207 |
GO:0008836
GO:0009089 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar