F472494

General Info

Members Datasets Scaffolds Average Seq Length
650 331 587 390

Family's Representative Sequence

Representative Sequence 3300005289|Ga0065704_10071330|Ga0065704_100713302
Length 416
Sequence VVRSLAPTQPNAQRKAVPMETRAGDPGAFAHFDLSRVDSPAFVVDVQALRRNLSTLADIRDRAGIKVLAALKAFSMWQVAPVVGEYLDGVCTSGLWEAKLAAEHYQGEIATYCAAYKAEDLPEICALSDHVIFNSPFQIARFQPVLDAARAAGHAFDVGLRINPLHQEGEVPRYDPCAPHSRLGFPVDQLRPEHLEGVSGLHFHTLCEQDFEPLRRTWDSLAPRIAPFLGRLKWLNFGGGHHVTRADYQREDLIAFLRDVKAQTGCELYLEPGEAVALDAGILVGTVLDRHWNGMDIAITDISATCHMPDVIEAPYRPAMLGELPIDEYEDGEGDKPVRLGGPSCLAGDVIGDYRLPVAAEPGARFAFLDQAHYSMVKTTTFNGVPLPSIWLWDSNTDTLDLIRTFAYEDFRDRLS

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
4 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
5 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
6 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
7 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
8 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
9 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
10 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
11 2643221583 Caulobacter sp. Root655 Isolate Unclassified
12 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
13 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
14 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
17 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
18 2738541295 Bacillus sp. OK085 Isolate Unclassified
19 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
20 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
21 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
22 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
23 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
24 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
25 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
26 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
27 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
28 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
29 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
30 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
31 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
32 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
33 2849560528 Caulobacter zeae 410 Isolate Unclassified
34 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
35 2851153111 Caulobacter radicis 736 Isolate Unclassified
36 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
37 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
38 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
39 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
40 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
41 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
42 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
43 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
44 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
45 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
46 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
47 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
48 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
49 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
50 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
51 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
52 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
53 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
54 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
55 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
56 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
57 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
58 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
59 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
60 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
61 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
62 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
63 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
64 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
65 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
66 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
67 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
68 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
69 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
70 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
71 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
72 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
75 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
80 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
83 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
84 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
87 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
88 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
89 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
96 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
100 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
101 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
102 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
103 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
104 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
105 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
106 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
109 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
110 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
113 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
116 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
117 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
201 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
210 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
216 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
226 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
227 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
242 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
246 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
253 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
278 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
279 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
280 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
281 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
282 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
283 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
284 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
288 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
289 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
294 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
297 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
298 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
302 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
303 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
304 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
305 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
306 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
307 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
310 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
311 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
312 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
319 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
322 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
323 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
326 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
327 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
328 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
329 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
330 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified
331 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.85
Metatranscriptomes 4.46
Isolates 9.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.54
Nodule 0
Rhizoplane 3.54
Rhizosphere 60.15
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1604904 2162886007 Bacteria 1867
2 SwRhRL2b_contig_2199698 2162886007 Bacteria 2705
3 SwRhRL2b_contig_2586087 2162886007 Bacteria 50518
4 SwRhRL2b_contig_988 2162886007 Bacteria 6046
5 JGI24736J21556_1001407 3300001904 Bacteria 4403
6 JGI24741J21665_1000004 3300001915 Bacteria 51710
7 JGI24740J21852_10002677 3300001979 Bacteria 7993
8 JGI24739J22299_10002528 3300001989 Bacteria 7046
9 JGI24737J22298_10003083 3300001990 Bacteria 5904
10 JGI24735J21928_10004164 3300002067 Bacteria 4884
11 JGI24738J21930_10003221 3300002075 Bacteria 4163
12 JGI24751J29686_10000080 3300002459 Bacteria 54264
13 JGI24751J29686_10005837 3300002459 Bacteria 2512
14 JGI25151J46595_10008100 3300003187 Bacteria 5091
15 Ga0055536_1003479 3300003781 Bacteria 8441
16 Ga0055536_1007179 3300003781 Bacteria 5034
17 Ga0055536_1012462 3300003781 Bacteria 3153
18 Ga0055530_10000013 3300003791 Bacteria 153390
19 Ga0055531_10006519 3300003794 Bacteria 6618
20 Ga0055531_10011896 3300003794 Bacteria 4145
21 Ga0065704_10000191 3300005289 Bacteria 318191
22 Ga0065704_10003246 3300005289 Bacteria 6094
23 Ga0065704_10005515 3300005289 Bacteria 5443
24 Ga0065704_10071330 3300005289 Bacteria 11689
25 Ga0065704_10082800 3300005289 Bacteria 3548
26 Ga0065704_10109097 3300005289 Bacteria 2009
27 Ga0065707_10090532 3300005295 Bacteria 4123
28 Ga0070658_10000351 3300005327 Bacteria 39857
29 Ga0070658_10045637 3300005327 Bacteria 3543
30 Ga0070683_100117271 3300005329 Bacteria 2514
31 Ga0070670_100000344 3300005331 Bacteria 39044
32 Ga0070670_100088611 3300005331 Bacteria 2660
33 Ga0070670_100128704 3300005331 Bacteria 2185
34 Ga0070677_10000516 3300005333 Bacteria 13259
35 Ga0070666_10000305 3300005335 Bacteria 31836
36 Ga0070660_100088429 3300005339 Bacteria 2440
37 Ga0070668_100000093 3300005347 Bacteria 56453
38 Ga0070669_100000013 3300005353 Bacteria 210577
39 Ga0070669_100000990 3300005353 Bacteria 20731
40 Ga0070669_100001337 3300005353 Bacteria 17776
41 Ga0070669_100003132 3300005353 Bacteria 11894
42 Ga0070669_100132467 3300005353 Bacteria 1914
43 Ga0070671_100000009 3300005355 Bacteria 206508
44 Ga0070671_100000050 3300005355 Bacteria 80843
45 Ga0070671_100015177 3300005355 Bacteria 6222
46 Ga0070671_100015289 3300005355 Bacteria 6198
47 Ga0070671_100095887 3300005355 Bacteria 2487
48 Ga0070671_100234006 3300005355 Bacteria 1559
49 Ga0070659_100046199 3300005366 Bacteria 3413
50 Ga0070667_100000162 3300005367 Bacteria 83150
51 Ga0070667_100000678 3300005367 Bacteria 33073
52 Ga0070667_100003157 3300005367 Bacteria 14136
53 Ga0070705_100079508 3300005440 Bacteria 2009
54 Ga0070708_100152401 3300005445 Bacteria 2150
55 Ga0070663_100009782 3300005455 Bacteria 5954
56 Ga0068853_100001399 3300005539 Bacteria 17408
57 Ga0068853_100040880 3300005539 Bacteria 3958
58 Ga0068853_100076322 3300005539 Bacteria 2926
59 Ga0070686_100000171 3300005544 Bacteria 45415
60 Ga0070665_100000038 3300005548 Bacteria 309230
61 Ga0070665_100064630 3300005548 Bacteria 3670
62 Ga0070665_100090119 3300005548 Bacteria 3072
63 Ga0070665_100151967 3300005548 Bacteria 2318
64 Ga0068855_100001903 3300005563 Bacteria 25898
65 Ga0068855_100041968 3300005563 Bacteria 5421
66 Ga0068855_100046889 3300005563 Bacteria 5107
67 Ga0068855_100131337 3300005563 Bacteria 2860
68 Ga0068857_100010124 3300005577 Bacteria 8192
69 Ga0068857_100143292 3300005577 Bacteria 2161
70 Ga0068857_100205444 3300005577 Bacteria 1796
71 Ga0068854_100002051 3300005578 Bacteria 12337
72 Ga0068856_100003768 3300005614 Bacteria 15196
73 Ga0068859_100000202 3300005617 Bacteria 58573
74 Ga0068859_100242352 3300005617 Bacteria 1892
75 Ga0068864_100006790 3300005618 Bacteria 9372
76 Ga0068864_100065917 3300005618 Bacteria 3142
77 Ga0068851_10074010 3300005834 Bacteria 1767
78 Ga0068863_100000047 3300005841 Bacteria 140249
79 Ga0068863_100001389 3300005841 Bacteria 24002
80 Ga0068863_100004204 3300005841 Bacteria 14218
81 Ga0068863_100017898 3300005841 Bacteria 6781
82 Ga0068863_100019188 3300005841 Bacteria 6545
83 Ga0068863_100042659 3300005841 Bacteria 4311
84 Ga0068863_100055440 3300005841 Bacteria 3753
85 Ga0068858_100012887 3300005842 Bacteria 7884
86 Ga0068858_100017658 3300005842 Bacteria 6688
87 Ga0068858_100032105 3300005842 Bacteria 4877
88 Ga0068858_100038491 3300005842 Bacteria 4436
89 Ga0068858_100274190 3300005842 Bacteria 1605
90 Ga0068860_100000007 3300005843 Bacteria 429329
91 Ga0068860_100032312 3300005843 Bacteria 5029
92 Ga0068860_100048688 3300005843 Bacteria 4039
93 Ga0068860_100112502 3300005843 Bacteria 2603
94 Ga0068860_100413288 3300005843 Bacteria 1336
95 Ga0068862_100005421 3300005844 Bacteria 10653
96 Ga0068862_100006147 3300005844 Bacteria 9993
97 Ga0075365_10171319 3300006038 Bacteria 1515
98 Ga0075368_10000180 3300006042 Bacteria 17240
99 Ga0075368_10001487 3300006042 Bacteria 7510
100 Ga0075363_100000064 3300006048 Bacteria 21836
101 Ga0075363_100002606 3300006048 Bacteria 7430
102 Ga0075364_10004077 3300006051 Bacteria 8383
103 Ga0075364_10093813 3300006051 Bacteria 1993
104 Ga0075362_10000093 3300006177 Bacteria 24981
105 Ga0075362_10004784 3300006177 Bacteria 4890
106 Ga0075362_10011866 3300006177 Bacteria 3443
107 Ga0075367_10000047 3300006178 Bacteria 28179
108 Ga0075367_10052589 3300006178 Bacteria 2411
109 Ga0075369_10003568 3300006186 Bacteria 5667
110 Ga0075369_10004395 3300006186 Bacteria 5205
111 Ga0075366_10000014 3300006195 Bacteria 66940
112 Ga0075366_10001540 3300006195 Bacteria 11534
113 Ga0075366_10031282 3300006195 Bacteria 3131
114 Ga0075370_10000056 3300006353 Bacteria 33386
115 Ga0075370_10014025 3300006353 Bacteria 4267
116 Ga0075370_10015522 3300006353 Bacteria 4079
117 Ga0075370_10068604 3300006353 Bacteria 2025
118 Ga0075434_100019793 3300006871 Bacteria 6515
119 Ga0097620_100000202 3300006931 Bacteria 58573
120 Ga0097620_100242356 3300006931 Bacteria 1892
121 Ga0105251_10002779 3300009011 Bacteria 13307
122 Ga0105251_10045041 3300009011 Bacteria 2128
123 Ga0105250_10028650 3300009092 Bacteria 2242
124 Ga0105240_10023774 3300009093 Bacteria 8095
125 Ga0105240_10188971 3300009093 Bacteria 2423
126 Ga0105240_10312200 3300009093 Bacteria 1795
127 Ga0105247_10000831 3300009101 Bacteria 23501
128 Ga0114129_10112701 3300009147 Bacteria 3751
129 Ga0105248_10096952 3300009177 Bacteria 3322
130 Ga0105248_10150915 3300009177 Bacteria 2621
131 Ga0105248_10199782 3300009177 Bacteria 2253
132 Ga0105248_10346510 3300009177 Bacteria 1672
133 Ga0105237_10195441 3300009545 Bacteria 2023
134 Ga0105238_10280126 3300009551 Bacteria 1649
135 Ga0105148_100098 3300009978 Bacteria 13718
136 Ga0105239_10033054 3300010375 Bacteria 5681
137 Ga0157371_10007213 3300013102 Bacteria 9030
138 Ga0157371_10017568 3300013102 Bacteria 5311
139 Ga0163162_10011771 3300013306 Bacteria 8534
140 Ga0163162_10031350 3300013306 Bacteria 5273
141 Ga0157380_10171278 3300014326 Bacteria 1897
142 Ga0163161_10001436 3300017792 Bacteria 17585
143 Ga0163161_10014729 3300017792 Bacteria 5446
144 Ga0163161_10215341 3300017792 Bacteria 1485
145 Ga0206356_11452870 3300020070 Bacteria 1879
146 Ga0209566_100115 3300025225 Bacteria 107765
147 Ga0209147_101123 3300025229 Bacteria 11047
148 Ga0209147_103046 3300025229 Bacteria 3543
149 Ga0209437_100249 3300025233 Bacteria 85649
150 Ga0209675_1000025 3300025291 Bacteria 294102
151 Ga0209676_1000221 3300025292 Bacteria 124715
152 Ga0209676_1000228 3300025292 Bacteria 123024
153 Ga0209676_1000276 3300025292 Bacteria 106867
154 Ga0209676_1018017 3300025292 Bacteria 2477
155 Ga0209676_1019053 3300025292 Bacteria 2372
156 Ga0209025_1020711 3300025294 Bacteria 3579
157 Ga0209025_1031191 3300025294 Bacteria 2528
158 Ga0209050_1000042 3300025298 Bacteria 402842
159 Ga0209050_1000265 3300025298 Bacteria 112618
160 Ga0209050_1004010 3300025298 Bacteria 10379
161 Ga0209050_1013953 3300025298 Bacteria 3515
162 Ga0209050_1026158 3300025298 Bacteria 1961
163 Ga0209257_1000135 3300025304 Bacteria 205668
164 Ga0209257_1000229 3300025304 Bacteria 133121
165 Ga0209257_1000695 3300025304 Bacteria 52248
166 Ga0207697_10003991 3300025315 Bacteria 7149
167 Ga0207682_10000712 3300025893 Bacteria 15424
168 Ga0207710_10019206 3300025900 Bacteria 2915
169 Ga0207680_10000429 3300025903 Bacteria 19832
170 Ga0207647_10011216 3300025904 Bacteria 6293
171 Ga0207647_10027822 3300025904 Bacteria 3682
172 Ga0207695_10002012 3300025913 Bacteria 31349
173 Ga0207695_10046288 3300025913 Bacteria 4612
174 Ga0207657_10033667 3300025919 Bacteria 4616
175 Ga0207681_10000008 3300025923 Bacteria 414329
176 Ga0207681_10000174 3300025923 Bacteria 52934
177 Ga0207681_10001207 3300025923 Bacteria 16625
178 Ga0207681_10002809 3300025923 Bacteria 11019
179 Ga0207681_10023588 3300025923 Bacteria 3938
180 Ga0207681_10056858 3300025923 Bacteria 2670
181 Ga0207650_10044248 3300025925 Bacteria 3271
182 Ga0207650_10077617 3300025925 Bacteria 2511
183 Ga0207650_10087141 3300025925 Bacteria 2379
184 Ga0207650_10130054 3300025925 Bacteria 1969
185 Ga0207687_10051764 3300025927 Bacteria 2863
186 Ga0207644_10000003 3300025931 Bacteria 585905
187 Ga0207644_10000006 3300025931 Bacteria 408793
188 Ga0207644_10004801 3300025931 Bacteria 8802
189 Ga0207644_10018358 3300025931 Bacteria 4731
190 Ga0207644_10059077 3300025931 Bacteria 2773
191 Ga0207711_10078860 3300025941 Bacteria 2874
192 Ga0207711_10092915 3300025941 Bacteria 2656
193 Ga0207711_10099603 3300025941 Bacteria 2569
194 Ga0207711_10141679 3300025941 Bacteria 2164
195 Ga0207711_10222963 3300025941 Bacteria 1725
196 Ga0207667_10006181 3300025949 Bacteria 14538
197 Ga0207667_10033487 3300025949 Bacteria 5523
198 Ga0207712_10009699 3300025961 Bacteria 6102
199 Ga0207668_10000195 3300025972 Bacteria 41701
200 Ga0207668_10000731 3300025972 Bacteria 20103
201 Ga0207668_10053922 3300025972 Bacteria 2789
202 Ga0207640_10000662 3300025981 Bacteria 20165
203 Ga0207640_10003032 3300025981 Bacteria 9041
204 Ga0207658_10000127 3300025986 Bacteria 83164
205 Ga0207658_10001246 3300025986 Bacteria 20116
206 Ga0207658_10002244 3300025986 Bacteria 14324
207 Ga0207658_10006257 3300025986 Bacteria 8132
208 Ga0207658_10010740 3300025986 Bacteria 6226
209 Ga0207703_10000733 3300026035 Bacteria 32263
210 Ga0207703_10025840 3300026035 Bacteria 4621
211 Ga0207703_10027104 3300026035 Bacteria 4513
212 Ga0207703_10135661 3300026035 Bacteria 2130
213 Ga0207639_10004275 3300026041 Bacteria 9629
214 Ga0207639_10004953 3300026041 Bacteria 8969
215 Ga0207639_10058042 3300026041 Bacteria 2975
216 Ga0207678_10000072 3300026067 Bacteria 81033
217 Ga0207702_10377212 3300026078 Bacteria 1363
218 Ga0207641_10000042 3300026088 Bacteria 186384
219 Ga0207641_10000079 3300026088 Bacteria 141110
220 Ga0207641_10005158 3300026088 Bacteria 11175
221 Ga0207641_10009520 3300026088 Bacteria 8008
222 Ga0207641_10013920 3300026088 Bacteria 6597
223 Ga0207641_10019253 3300026088 Bacteria 5601
224 Ga0207676_10002410 3300026095 Bacteria 13340
225 Ga0207676_10036956 3300026095 Bacteria 3718
226 Ga0207676_10149672 3300026095 Bacteria 2009
227 Ga0207674_10005919 3300026116 Bacteria 14465
228 Ga0207674_10030787 3300026116 Bacteria 5640
229 Ga0207674_10111626 3300026116 Bacteria 2708
230 Ga0207675_100006560 3300026118 Bacteria 11012
231 Ga0207698_10000005 3300026142 Bacteria 295687
232 Ga0207698_10024470 3300026142 Bacteria 4238
233 Ga0209813_10000118 3300027866 Bacteria 28637
234 Ga0209813_10000267 3300027866 Bacteria 14702
235 Ga0209974_10014668 3300027876 Bacteria 2605
236 Ga0268266_10000118 3300028379 Bacteria 163466
237 Ga0268266_10005550 3300028379 Bacteria 11742
238 Ga0268266_10017340 3300028379 Bacteria 6145
239 Ga0268266_10047584 3300028379 Bacteria 3675
240 Ga0268266_10099992 3300028379 Bacteria 2554
241 Ga0268266_10236322 3300028379 Bacteria 1685
242 Ga0268265_10000392 3300028380 Bacteria 46740
243 Ga0268265_10003351 3300028380 Bacteria 11569
244 Ga0268265_10116846 3300028380 Bacteria 2189
245 Ga0268264_10000134 3300028381 Bacteria 179475
246 Ga0268264_10000310 3300028381 Bacteria 78142
247 Ga0268264_10003810 3300028381 Bacteria 12938
248 Ga0268264_10010868 3300028381 Bacteria 7522
249 Ga0268264_10034608 3300028381 Bacteria 4156
250 Ga0307515_10029188 3300028794 Bacteria 9337
251 Ga0307515_10030159 3300028794 Bacteria 9125
252 Ga0307408_100058204 3300031548 Bacteria 2808
253 Ga0307408_100200177 3300031548 Bacteria 1616
254 Ga0307408_100282793 3300031548 Bacteria 1382
255 Ga0307508_10024853 3300031616 Bacteria 5435
256 Ga0307410_10003860 3300031852 Bacteria 7619
257 Ga0307407_10061646 3300031903 Bacteria 2193
258 Ga0307412_10000348 3300031911 Bacteria 28830
259 Ga0307412_10008388 3300031911 Bacteria 5895
260 Ga0307412_10170937 3300031911 Bacteria 1625
261 Ga0307412_10189526 3300031911 Bacteria 1553
262 Ga0307416_100158467 3300032002 Bacteria 2088
263 Ga0307414_10000105 3300032004 Bacteria 59546
264 Ga0307414_10001344 3300032004 Bacteria 12713
265 Ga0307414_10001394 3300032004 Bacteria 12521
266 Ga0307414_10004671 3300032004 Bacteria 7466
267 Ga0307414_10033431 3300032004 Bacteria 3399
268 Ga0307411_10096940 3300032005 Bacteria 2074
269 Ga0307415_100184941 3300032126 Bacteria 1639
270 Ga0316583_10011256 3300032133 Bacteria 3222
271 Ga0307510_10102461 3300033180 Bacteria 2645
272 Ga0316582_0096788 3300036647 Bacteria 1949
273 Ga0237819_00788 3300038705 Bacteria 10135
274 Ga0436365_0361176 3300039437 Bacteria 17748
275 Ga0436362_0795015 3300039453 Bacteria 1547
276 Ga0451843_1520595 3300041509 Bacteria 1795
277 Ga0439459_0020220 3300042438 Bacteria 1269
278 Ga0453684_0410421 3300044712 Bacteria 1515
279 Ga0451576_0000007 3300045051 Bacteria 782228
280 Ga0495617_030146 3300046452 Bacteria 1824
281 Ga0495627_000153 3300046453 Bacteria 80825
282 Ga0495627_001065 3300046453 Bacteria 18144
283 Ga0495627_006692 3300046453 Bacteria 4489
284 Ga0495627_012656 3300046453 Bacteria 2988
285 Ga0495627_039505 3300046453 Bacteria 1456
286 Ga0495590_0001563 3300046457 Bacteria 9806
287 Ga0495638_0000249 3300046460 Bacteria 73312
288 Ga0495638_0000301 3300046460 Bacteria 63603
289 Ga0495638_0000538 3300046460 Bacteria 43673
290 Ga0495638_0005278 3300046460 Bacteria 9656
291 Ga0495638_0037924 3300046460 Bacteria 3065
292 Ga0495650_0001599 3300046471 Bacteria 21190
293 Ga0495650_0015489 3300046471 Bacteria 3907
294 Ga0495605_0037360 3300046474 Bacteria 2444
295 Ga0495605_0043655 3300046474 Bacteria 2221
296 Ga0495584_0025509 3300046491 Bacteria 2997
297 Ga0495596_0000823 3300046500 Bacteria 18771
298 Ga0495596_0010361 3300046500 Bacteria 4061
299 Ga0495607_0016876 3300046501 Bacteria 4701
300 Ga0495583_0000001 3300046506 Bacteria 811973
301 Ga0495583_0000262 3300046506 Bacteria 86241
302 Ga0495583_0035032 3300046506 Bacteria 2400
303 Ga0495606_0035299 3300046507 Bacteria 3419
304 Ga0495610_0000044 3300046512 Bacteria 156847
305 Ga0495610_0000071 3300046512 Bacteria 121210
306 Ga0495610_0000157 3300046512 Bacteria 75701
307 Ga0495610_0001676 3300046512 Bacteria 19476
308 Ga0495610_0002386 3300046512 Bacteria 15820
309 Ga0495616_0000521 3300046513 Bacteria 29127
310 Ga0495620_0067975 3300046515 Bacteria 1464
311 Ga0495631_0006999 3300046518 Bacteria 5773
312 Ga0495632_0000382 3300046519 Bacteria 42287
313 Ga0495632_0004994 3300046519 Bacteria 8891
314 Ga0495632_0007134 3300046519 Bacteria 7067
315 Ga0495632_0045754 3300046519 Bacteria 2178
316 Ga0495637_0009782 3300046520 Bacteria 4665
317 Ga0495637_0013103 3300046520 Bacteria 3944
318 Ga0495637_0022716 3300046520 Bacteria 2858
319 Ga0495637_0086130 3300046520 Bacteria 1246
320 Ga0495643_0000007 3300046522 Bacteria 383435
321 Ga0495643_0000053 3300046522 Bacteria 202031
322 Ga0495643_0003981 3300046522 Bacteria 10561
323 Ga0495643_0033129 3300046522 Bacteria 2861
324 Ga0495648_0000015 3300046524 Bacteria 285838
325 Ga0495648_0000509 3300046524 Bacteria 41858
326 Ga0495648_0020032 3300046524 Bacteria 4679
327 Ga0495663_0000020 3300046525 Bacteria 124560
328 Ga0495609_0002808 3300046538 Bacteria 10464
329 Ga0495597_0003545 3300046542 Bacteria 9026
330 Ga0495622_0012466 3300046557 Bacteria 3936
331 Ga0495622_0026398 3300046557 Bacteria 2712
332 Ga0495633_0000400 3300046558 Bacteria 45378
333 Ga0495633_0002316 3300046558 Bacteria 13569
334 Ga0495633_0007042 3300046558 Bacteria 6549
335 Ga0495668_0000001 3300046616 Bacteria 1013420
336 Ga0495668_0000105 3300046616 Bacteria 133981
337 Ga0495668_0006076 3300046616 Bacteria 7996
338 Ga0495668_0036879 3300046616 Bacteria 2738
339 Ga0495668_0061898 3300046616 Bacteria 2063
340 Ga0495625_0000198 3300046660 Bacteria 95530
341 Ga0495625_0004423 3300046660 Bacteria 13289
342 Ga0495625_0005243 3300046660 Bacteria 11925
343 Ga0495625_0007331 3300046660 Bacteria 9630
344 Ga0495625_0023261 3300046660 Bacteria 4735
345 Ga0495625_0056483 3300046660 Bacteria 2794
346 Ga0495671_0000031 3300046692 Bacteria 202030
347 Ga0495671_0000084 3300046692 Bacteria 89406
348 Ga0495671_0005263 3300046692 Bacteria 7598
349 Ga0495671_0056849 3300046692 Bacteria 1937
350 Ga0495649_0000684 3300046694 Bacteria 27605
351 Ga0495589_0010961 3300046794 Bacteria 4706
352 Ga0495672_0004227 3300047320 Bacteria 11863
353 Ga0495673_0000156 3300047469 Bacteria 118831
354 Ga0495673_0000206 3300047469 Bacteria 89432
355 Ga0495673_0001785 3300047469 Bacteria 16335
356 Ga0495673_0002305 3300047469 Bacteria 13652
357 Ga0495681_0000008 3300047470 Bacteria 215295
358 Ga0495681_0000662 3300047470 Bacteria 26162
359 Ga0495681_0009019 3300047470 Bacteria 6189
360 Ga0495686_0001010 3300047472 Bacteria 34135
361 Ga0495686_0059177 3300047472 Bacteria 2386
362 Ga0495686_0080216 3300047472 Bacteria 1995
363 Ga0495686_0129455 3300047472 Bacteria 1497
364 Ga0495602_0109186 3300048088 Bacteria 2251
365 Ga0495626_0028652 3300048091 Bacteria 2698
366 Ga0496100_0034817 3300048903 Bacteria 3163
367 Ga0496101_0138813 3300048904 Bacteria 1851
368 Ga0496102_0000305 3300048905 Bacteria 62646
369 Ga0496102_0021718 3300048905 Bacteria 5679
370 Ga0496103_0000475 3300048906 Bacteria 33792
371 Ga0496103_0069361 3300048906 Bacteria 2204
372 Ga0496104_0000293 3300048907 Bacteria 44125
373 Ga0496104_0047635 3300048907 Bacteria 4040
374 Ga0496105_0003464 3300048908 Bacteria 11669
375 Ga0496106_0046888 3300048909 Bacteria 3250
376 Ga0496107_0000069 3300048910 Bacteria 51309
377 Ga0496107_0004656 3300048910 Bacteria 9309
378 Ga0496108_0003383 3300048911 Bacteria 12807
379 Ga0496108_0089226 3300048911 Bacteria 2620
380 Ga0496108_0257288 3300048911 Bacteria 1519
381 Ga0496109_0138646 3300048912 Bacteria 2274
382 Ga0496110_0006266 3300048913 Bacteria 9387
383 Ga0496110_0031488 3300048913 Bacteria 4577
384 Ga0496110_0145990 3300048913 Bacteria 2140
385 Ga0496111_0067377 3300048914 Bacteria 2601
386 Ga0496113_0000622 3300048916 Bacteria 17801
387 Ga0496113_0006350 3300048916 Bacteria 7478
388 Ga0496114_0052783 3300048917 Bacteria 3387
389 Ga0496116_0000017 3300048919 Bacteria 554463
390 Ga0496116_0004504 3300048919 Bacteria 13263
391 Ga0496116_0020967 3300048919 Bacteria 4942
392 Ga0496116_0036430 3300048919 Bacteria 3443
393 Ga0496116_0073181 3300048919 Bacteria 2162
394 Ga0496116_0098204 3300048919 Bacteria 1758
395 Ga0496116_0179149 3300048919 Bacteria 1137
396 Ga0496117_0000694 3300048920 Bacteria 53676
397 Ga0496117_0006257 3300048920 Bacteria 12135
398 Ga0496117_0014877 3300048920 Bacteria 6674
399 Ga0496118_0030554 3300048921 Bacteria 4493
400 Ga0496118_0035308 3300048921 Bacteria 4062
401 Ga0496118_0052082 3300048921 Bacteria 3126
402 Ga0496119_0000040 3300048922 Bacteria 208180
403 Ga0496120_0004492 3300048923 Bacteria 11674
404 Ga0496120_0053889 3300048923 Bacteria 2283
405 Ga0496121_0000070 3300048924 Bacteria 249187
406 Ga0496121_0000517 3300048924 Bacteria 73561
407 Ga0496121_0001861 3300048924 Bacteria 33858
408 Ga0496121_0005216 3300048924 Bacteria 16837
409 Ga0496121_0007980 3300048924 Bacteria 12640
410 Ga0496121_0013581 3300048924 Bacteria 8733
411 Ga0496121_0054144 3300048924 Bacteria 3356
412 Ga0496122_0000934 3300048925 Bacteria 53129
413 Ga0496122_0002119 3300048925 Bacteria 29307
414 Ga0496122_0003521 3300048925 Bacteria 20526
415 Ga0496122_0009363 3300048925 Bacteria 10340
416 Ga0496122_0016810 3300048925 Bacteria 6889
417 Ga0496122_0033047 3300048925 Bacteria 4263
418 Ga0496123_0000740 3300048926 Bacteria 52939
419 Ga0496123_0000968 3300048926 Bacteria 44375
420 Ga0496123_0000991 3300048926 Bacteria 43637
421 Ga0496123_0002006 3300048926 Bacteria 26286
422 Ga0496123_0007611 3300048926 Bacteria 10142
423 Ga0496124_0002517 3300048927 Bacteria 23808
424 Ga0496124_0007646 3300048927 Bacteria 11438
425 Ga0496124_0010873 3300048927 Bacteria 9159
426 Ga0496124_0015705 3300048927 Bacteria 7239
427 Ga0496124_0016533 3300048927 Bacteria 7006
428 Ga0496124_0078087 3300048927 Bacteria 2729
429 Ga0496124_0098406 3300048927 Bacteria 2373
430 Ga0496125_0000174 3300048928 Bacteria 144548
431 Ga0496125_0000335 3300048928 Bacteria 90043
432 Ga0496125_0001363 3300048928 Bacteria 35966
433 Ga0496125_0004626 3300048928 Bacteria 15732
434 Ga0496125_0030396 3300048928 Bacteria 4833
435 Ga0496125_0032733 3300048928 Bacteria 4614
436 Ga0496125_0065945 3300048928 Bacteria 2864
437 Ga0496125_0068607 3300048928 Bacteria 2788
438 Ga0496125_0092389 3300048928 Bacteria 2263
439 Ga0496125_0119155 3300048928 Bacteria 1888
440 Ga0496126_0000044 3300048929 Bacteria 335904
441 Ga0496126_0000359 3300048929 Bacteria 94946
442 Ga0496126_0003609 3300048929 Bacteria 19367
443 Ga0496126_0010711 3300048929 Bacteria 9579
444 Ga0501309_002561 3300049129 Bacteria 1973
445 Ga0501343_000212 3300049132 Bacteria 3048
446 Ga0501343_000430 3300049132 Bacteria 2426
447 Ga0501305_002511 3300049161 Bacteria 1989
448 Ga0501305_008446 3300049161 Bacteria 1332
449 Ga0495678_000680 3300049459 Bacteria 31270
450 Ga0501311_001435 3300049527 Bacteria 2068
451 Ga0501312_001623 3300049528 Bacteria 2257
452 Ga0501313_000634 3300049529 Bacteria 2540
453 Ga0501314_000504 3300049530 Bacteria 2449
454 Ga0501314_000883 3300049530 Bacteria 2015
455 Ga0501315_000133 3300049531 Bacteria 4114
456 Ga0501315_007230 3300049531 Bacteria 1261
457 Ga0501316_000527 3300049532 Bacteria 2690
458 Ga0501316_001980 3300049532 Bacteria 1837
459 Ga0501317_000344 3300049533 Bacteria 3096
460 Ga0501317_000700 3300049533 Bacteria 2522
461 Ga0501318_000537 3300049534 Bacteria 2476
462 Ga0501321_000477 3300049537 Bacteria 2574
463 Ga0501321_003152 3300049537 Bacteria 1491
464 Ga0501330_000108 3300049546 Bacteria 2621
465 Ga0501330_000615 3300049546 Bacteria 1596
466 Ga0501332_01136 3300049548 Bacteria 1345
467 Ga0501333_000078 3300049549 Bacteria 3089
468 Ga0501334_00586 3300049550 Bacteria 1739
469 Ga0501334_02067 3300049550 Bacteria 1166
470 Ga0501335_000089 3300049551 Bacteria 4077
471 Ga0501336_001879 3300049552 Bacteria 1305
472 Ga0501338_00172 3300049554 Bacteria 2450
473 Ga0501031_0129881 3300049568 Bacteria 1646
474 Ga0501032_0020975 3300049569 Bacteria 4545
475 Ga0501034_0011101 3300049571 Bacteria 9353
476 Ga0501034_0041377 3300049571 Bacteria 4662
477 Ga0501034_0113084 3300049571 Bacteria 2705
478 Ga0501034_0307683 3300049571 Bacteria 1520
479 Ga0501036_0017409 3300049572 Bacteria 6007
480 Ga0501037_0038452 3300049573 Bacteria 3525
481 Ga0501038_0036373 3300049574 Bacteria 4321
482 Ga0501039_0075322 3300049575 Bacteria 2623
483 Ga0501047_0054028 3300049581 Bacteria 3885
484 Ga0501198_007894 3300049649 Bacteria 1536
485 Ga0501208_000170 3300049655 Bacteria 4405
486 Ga0501217_005711 3300049661 Bacteria 2614
487 Ga0501223_000043 3300049663 Bacteria 44137
488 Ga0501223_000082 3300049663 Bacteria 28639
489 Ga0501224_000019 3300049664 Bacteria 78204
490 Ga0501235_009973 3300049669 Bacteria 2077
491 Ga0501225_0000059 3300049705 Bacteria 36394
492 Ga0501225_0000065 3300049705 Bacteria 34445
493 Ga0501234_003656 3300049707 Bacteria 2416
494 Ga0501035_0062642 3300049822 Bacteria 3309
495 Ga0501044_0000346 3300049823 Bacteria 58137
496 Ga0501226_000080 3300049853 Bacteria 29131
497 nmdc:mga03683_1450_c1 3300050489 Bacteria 4908
498 nmdc:mga03683_17009_c1 3300050489 Bacteria 2744
499 nmdc:mga03683_64_c1 3300050489 Bacteria 40516
500 nmdc:mga03683_744_c1 3300050489 Bacteria 9325
501 nmdc:mga03n38_1850_c1 3300050490 Bacteria 6311
502 nmdc:mga00v17_1913_c1 3300050491 Bacteria 10770
503 nmdc:mga0k408_38425_c1 3300050493 Bacteria 2747
504 nmdc:mga0k408_52349_c1 3300050493 Bacteria 1987
505 nmdc:mga0k408_7_c1 3300050493 Bacteria 164270
506 nmdc:mga06z11_7_c1 3300050494 Bacteria 121804
507 nmdc:mga04h51_582_c1 3300050495 Bacteria 8723
508 nmdc:mga04h51_70_c1 3300050495 Bacteria 32617
509 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
510 nmdc:mga07m45_43585_c1 3300050496 Bacteria 2516
511 nmdc:mga07m45_47739_c1 3300050496 Bacteria 2407
512 nmdc:mga0n895_23671_c1 3300050512 Bacteria 5776
513 nmdc:mga0sz30_2963_c1 3300050516 Bacteria 6088
514 nmdc:mga0sz30_55631_c1 3300050516 Bacteria 1684
515 Ga0500635_0000049 3300053080 Bacteria 80019
516 Ga0500578_0000166 3300053086 Bacteria 78688
517 Ga0500643_000001 3300053087 Bacteria 1440111
518 Ga0500643_000420 3300053087 Bacteria 32288
519 Ga0500643_000905 3300053087 Bacteria 18778
520 Ga0500643_000969 3300053087 Bacteria 17804
521 Ga0500643_006102 3300053087 Bacteria 5092
522 Ga0500643_006176 3300053087 Bacteria 5050
523 Ga0500643_006792 3300053087 Bacteria 4717
524 Ga0500644_0000913 3300053088 Bacteria 9408
525 Ga0500644_0003579 3300053088 Bacteria 3854
526 Ga0500647_0063787 3300053091 Bacteria 1772
527 Ga0500641_0000140 3300053096 Bacteria 26611
528 Ga0500641_0019886 3300053096 Bacteria 2543
529 Ga0500650_0059730 3300053098 Bacteria 1779
530 Ga0500556_0000157 3300053104 Bacteria 56425
531 Ga0500556_0001174 3300053104 Bacteria 12502
532 Ga0500556_0002655 3300053104 Bacteria 5577
533 Ga0500562_000275 3300053108 Bacteria 12696
534 Ga0500562_000906 3300053108 Bacteria 7191
535 Ga0500562_004234 3300053108 Bacteria 3628
536 Ga0500562_014413 3300053108 Bacteria 2024
537 Ga0500592_012266 3300053116 Bacteria 1370
538 Ga0500594_0000310 3300053118 Bacteria 10933
539 Ga0500594_0003550 3300053118 Bacteria 3433
540 Ga0500595_001328 3300053119 Bacteria 13404
541 Ga0500595_004701 3300053119 Bacteria 6063
542 Ga0500607_000443 3300053121 Bacteria 39768
543 Ga0500607_002276 3300053121 Bacteria 15819
544 Ga0500608_000089 3300053122 Bacteria 37325
545 Ga0500608_000443 3300053122 Bacteria 15591
546 Ga0500608_000512 3300053122 Bacteria 14520
547 Ga0500618_000413 3300053125 Bacteria 28853
548 Ga0500618_004254 3300053125 Bacteria 4638
549 Ga0500642_0000002 3300053130 Bacteria 795093
550 Ga0500559_0000070 3300053136 Bacteria 82088
551 Ga0500559_0002480 3300053136 Bacteria 9519
552 Ga0500559_0004237 3300053136 Bacteria 6863
553 Ga0500559_0007978 3300053136 Bacteria 4664
554 Ga0500559_0036444 3300053136 Bacteria 2127
555 Ga0500564_003263 3300053138 Bacteria 6259
556 Ga0500564_028774 3300053138 Bacteria 2557
557 Ga0500568_0006701 3300053139 Bacteria 5756
558 Ga0500568_0025081 3300053139 Bacteria 2520
559 Ga0500573_0000045 3300053140 Bacteria 98878
560 Ga0500577_0004110 3300053142 Bacteria 3819
561 Ga0500590_000657 3300053148 Bacteria 12371
562 Ga0500590_045171 3300053148 Bacteria 2256
563 Ga0500604_0025338 3300053151 Bacteria 1704
564 Ga0500604_0046330 3300053151 Bacteria 1330
565 Ga0500616_0004927 3300053153 Bacteria 9274
566 Ga0500622_0000491 3300053156 Bacteria 36964
567 Ga0500622_0000784 3300053156 Bacteria 27604
568 Ga0500622_0001641 3300053156 Bacteria 17525
569 Ga0500622_0002715 3300053156 Bacteria 12518
570 Ga0500622_0011133 3300053156 Bacteria 4911
571 Ga0500622_0045283 3300053156 Bacteria 2278
572 Ga0500624_000007 3300053157 Bacteria 184487
573 Ga0500624_000249 3300053157 Bacteria 18976
574 Ga0500627_0000005 3300053158 Bacteria 167950
575 Ga0500627_0062286 3300053158 Bacteria 1643
576 Ga0500636_0004345 3300053177 Bacteria 8017
577 Ga0500636_0036569 3300053177 Bacteria 2906
578 Ga0500636_0072345 3300053177 Bacteria 1998
579 Ga0500625_000010 3300053729 Bacteria 154401
580 Ga0500625_067245 3300053729 Bacteria 1607
581 Ga0500645_000262 3300053730 Bacteria 37926
582 Ga0500645_000313 3300053730 Bacteria 34585
583 Ga0500645_000449 3300053730 Bacteria 28159
584 Ga0500645_002606 3300053730 Bacteria 7913
585 Ga0500645_002637 3300053730 Bacteria 7844
586 Ga0500596_000147 3300053735 Bacteria 10735
587 Ga0500661_005870 3300055283 Bacteria 2287

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048919 Ga0496116_0098204 Ga0496116_0098204_78_986 296
2 iso_pu_bacteria 2563366752 2563928217 309
3 3300049550 Ga0501334_02067 Ga0501334_02067_123_1109 322
4 3300025294 Ga0209025_1031191 Ga0209025_10311913 324
5 iso_pu_bacteria 2885526491 2885531555 337
6 iso_pu_bacteria 2904162308 2904163911 337
7 3300026116 Ga0207674_10111626 Ga0207674_101116264 339
8 3300048919 Ga0496116_0179149 Ga0496116_0179149_75_1118 341
9 3300049649 Ga0501198_007894 Ga0501198_007894_21_1049 342
10 3300050493 nmdc:mga0k408_38425_c1 nmdc:mga0k408_38425_c1_14_1069 347
11 iso_pu_bacteria 2907202186 2907206913 360
12 3300048913 Ga0496110_0031488 Ga0496110_0031488_301_1473 364
13 iso_pu_bacteria 2524023129 2524189612 365
14 iso_pu_bacteria 2643221543 2643735668 365
15 iso_pu_bacteria 2738541295 2738817060 365
16 iso_pu_bacteria 2791355222 2793183869 365
17 iso_pu_bacteria 2821111986 2821112901 365
18 iso_pu_bacteria 2864733723 2864734810 365
19 iso_pu_bacteria 2889042446 2889045519 365
20 iso_pu_bacteria 2904490793 2904492391 365
21 iso_pu_bacteria 2919160200 2919161617 365
22 iso_pu_bacteria 2931384279 2931388952 365
23 iso_pu_bacteria 2939679117 2939681881 365
24 iso_pu_bacteria 2945991243 2945992471 365
25 iso_pu_bacteria 2946053406 2946055221 365
26 iso_pu_bacteria 3001892409 3001898405 365
27 iso_pu_bacteria 8057473075 8057476443 365
28 iso_pu_bacteria 8057977335 8057982258 365
29 3300046518 Ga0495631_0006999 Ga0495631_0006999_4637_5737 366
30 3300049532 Ga0501316_000527 Ga0501316_000527_1549_2667 366
31 3300053139 Ga0500568_0025081 Ga0500568_0025081_17_1132 366
32 3300053151 Ga0500604_0046330 Ga0500604_0046330_208_1314 367
33 3300003187 JGI25151J46595_10008100 JGI25151J46595_100081004 369
34 3300025225 Ga0209566_100115 Ga0209566_10011537 369
35 3300025229 Ga0209147_103046 Ga0209147_1030462 369
36 3300025233 Ga0209437_100249 Ga0209437_10024925 369
37 3300025292 Ga0209676_1018017 Ga0209676_10180172 369
38 3300031548 Ga0307408_100200177 Ga0307408_1002001771 369
39 3300046453 Ga0495627_039505 Ga0495627_039505_52_1179 369
40 3300046474 Ga0495605_0037360 Ga0495605_0037360_770_1897 369
41 3300046520 Ga0495637_0086130 Ga0495637_0086130_29_1156 369
42 3300048091 Ga0495626_0028652 Ga0495626_0028652_1244_2371 369
43 3300048919 Ga0496116_0004504 Ga0496116_0004504_9943_11070 369
44 3300048919 Ga0496116_0020967 Ga0496116_0020967_1720_2847 369
45 3300048925 Ga0496122_0009363 Ga0496122_0009363_6897_8024 369
46 3300048925 Ga0496122_0033047 Ga0496122_0033047_1121_2248 369
47 3300048926 Ga0496123_0007611 Ga0496123_0007611_6561_7688 369
48 3300048927 Ga0496124_0002517 Ga0496124_0002517_7409_8536 369
49 3300048927 Ga0496124_0098406 Ga0496124_0098406_183_1310 369
50 3300048928 Ga0496125_0001363 Ga0496125_0001363_10788_11915 369
51 3300048928 Ga0496125_0004626 Ga0496125_0004626_10005_11132 369
52 3300049129 Ga0501309_002561 Ga0501309_002561_831_1958 369
53 3300049132 Ga0501343_000212 Ga0501343_000212_1835_2962 369
54 3300049132 Ga0501343_000430 Ga0501343_000430_94_1221 369
55 3300049161 Ga0501305_002511 Ga0501305_002511_849_1976 369
56 3300049161 Ga0501305_008446 Ga0501305_008446_121_1248 369
57 3300049527 Ga0501311_001435 Ga0501311_001435_855_1982 369
58 3300049528 Ga0501312_001623 Ga0501312_001623_824_1951 369
59 3300049529 Ga0501313_000634 Ga0501313_000634_1330_2457 369
60 3300049530 Ga0501314_000504 Ga0501314_000504_77_1204 369
61 3300049530 Ga0501314_000883 Ga0501314_000883_848_1975 369
62 3300049531 Ga0501315_000133 Ga0501315_000133_2903_4030 369
63 3300049531 Ga0501315_007230 Ga0501315_007230_76_1203 369
64 3300049532 Ga0501316_001980 Ga0501316_001980_84_1211 369
65 3300049533 Ga0501317_000344 Ga0501317_000344_410_1537 369
66 3300049533 Ga0501317_000700 Ga0501317_000700_1340_2467 369
67 3300049534 Ga0501318_000537 Ga0501318_000537_1334_2461 369
68 3300049537 Ga0501321_000477 Ga0501321_000477_77_1204 369
69 3300049537 Ga0501321_003152 Ga0501321_003152_210_1337 369
70 3300049546 Ga0501330_000108 Ga0501330_000108_1424_2551 369
71 3300049546 Ga0501330_000615 Ga0501330_000615_395_1522 369
72 3300049548 Ga0501332_01136 Ga0501332_01136_138_1265 369
73 3300049549 Ga0501333_000078 Ga0501333_000078_80_1207 369
74 3300049550 Ga0501334_00586 Ga0501334_00586_415_1542 369
75 3300049552 Ga0501336_001879 Ga0501336_001879_71_1198 369
76 3300049554 Ga0501338_00172 Ga0501338_00172_1247_2374 369
77 3300049655 Ga0501208_000170 Ga0501208_000170_1196_2323 369
78 3300049661 Ga0501217_005711 Ga0501217_005711_248_1375 369
79 3300005355 Ga0070671_100095887 Ga0070671_1000958871 373
80 3300025931 Ga0207644_10059077 Ga0207644_100590772 373
81 3300031911 Ga0307412_10008388 Ga0307412_100083884 375
82 3300046660 Ga0495625_0056483 Ga0495625_0056483_983_2125 375
83 3300048917 Ga0496114_0052783 Ga0496114_0052783_321_1493 379
84 3300048929 Ga0496126_0003609 Ga0496126_0003609_12175_13347 379
85 3300048921 Ga0496118_0035308 Ga0496118_0035308_2566_3744 380
86 3300048924 Ga0496121_0000517 Ga0496121_0000517_56151_57329 380
87 3300050489 nmdc:mga03683_17009_c1 nmdc:mga03683_17009_c1_534_1733 381
88 3300005617 Ga0068859_100242352 Ga0068859_1002423522 382
89 3300005842 Ga0068858_100017658 Ga0068858_1000176583 382
90 3300006931 Ga0097620_100242356 Ga0097620_1002423562 382
91 3300025981 Ga0207640_10000662 Ga0207640_100006621 382
92 3300026035 Ga0207703_10000733 Ga0207703_1000073322 382
93 3300048912 Ga0496109_0138646 Ga0496109_0138646_1038_2210 382
94 iso_pu_bacteria 2919138771 2919141650 382
95 3300005618 Ga0068864_100065917 Ga0068864_1000659172 384
96 3300005841 Ga0068863_100001389 Ga0068863_1000013897 384
97 3300005843 Ga0068860_100000007 Ga0068860_100000007240 384
98 3300006051 Ga0075364_10004077 Ga0075364_100040778 384
99 3300006177 Ga0075362_10004784 Ga0075362_100047843 384
100 3300009177 Ga0105248_10150915 Ga0105248_101509152 384
101 3300025941 Ga0207711_10099603 Ga0207711_100996032 384
102 3300025986 Ga0207658_10010740 Ga0207658_100107406 384
103 3300026088 Ga0207641_10000042 Ga0207641_10000042182 384
104 3300026095 Ga0207676_10036956 Ga0207676_100369564 384
105 3300028379 Ga0268266_10017340 Ga0268266_100173406 384
106 3300028381 Ga0268264_10000134 Ga0268264_10000134175 384
107 3300050489 nmdc:mga03683_1450_c1 nmdc:mga03683_1450_c1_1415_2614 384
108 3300050491 nmdc:mga00v17_1913_c1 nmdc:mga00v17_1913_c1_5870_7069 384
109 3300050516 nmdc:mga0sz30_55631_c1 nmdc:mga0sz30_55631_c1_65_1264 384
110 iso_pu_bacteria 2643221614 2644086306 384
111 iso_pu_bacteria 2643221661 2644344804 384
112 iso_pu_bacteria 2643221666 2644367547 384
113 3300005333 Ga0070677_10000516 Ga0070677_100005164 385
114 3300009093 Ga0105240_10023774 Ga0105240_100237748 385
115 3300025893 Ga0207682_10000712 Ga0207682_100007129 385
116 3300025904 Ga0207647_10027822 Ga0207647_100278222 385
117 3300025913 Ga0207695_10002012 Ga0207695_1000201210 385
118 3300025949 Ga0207667_10006181 Ga0207667_100061818 385
119 3300026142 Ga0207698_10000005 Ga0207698_10000005127 385
120 3300048924 Ga0496121_0000070 Ga0496121_0000070_198071_199246 386
121 3300053125 Ga0500618_004254 Ga0500618_004254_2490_3665 386
122 iso_pu_bacteria 2510917020 2511121172 386
123 iso_pu_bacteria 2512564014 2512643650 386
124 iso_pu_bacteria 2582581279 2585148206 386
125 iso_pu_bacteria 2643221560 2643821636 386
126 iso_pu_bacteria 2643221563 2643835791 386
127 iso_pu_bacteria 2643221583 2643923669 386
128 iso_pu_bacteria 2643221598 2644001625 386
129 iso_pu_bacteria 2643221608 2644056717 386
130 iso_pu_bacteria 2775507255 2778124081 386
131 iso_pu_bacteria 2808606401 2809063694 386
132 iso_pu_bacteria 2808606404 2809079688 386
133 iso_pu_bacteria 2808606405 2809084053 386
134 iso_pu_bacteria 2849560528 2849563533 386
135 iso_pu_bacteria 2849573788 2849578772 386
136 iso_pu_bacteria 2851153111 2851157919 386
137 iso_pu_bacteria 2852653556 2852655398 386
138 iso_pu_bacteria 2852680915 2852681756 386
139 iso_pu_bacteria 2857504554 2857506608 386
140 iso_pu_bacteria 2880518877 2880519376 386
141 iso_pu_bacteria 2882806704 2882807527 386
142 iso_pu_bacteria 2895880812 2895886010 386
143 iso_pu_bacteria 2928972540 2928973414 386
144 iso_pu_bacteria 2941485952 2941487416 386
145 iso_pu_bacteria 2977240413 2977240608 386
146 3300046506 Ga0495583_0000001 Ga0495583_0000001_487150_488322 387
147 iso_pu_bacteria 3000865235 3000865593 387
148 3300005327 Ga0070658_10000351 Ga0070658_100003514 388
149 iso_pu_bacteria 2818991438 2819550806 388
150 iso_pu_bacteria 2848297114 2848299965 388
151 iso_pu_bacteria 8054302542 8054302591 388
152 3300005577 Ga0068857_100143292 Ga0068857_1001432922 389
153 3300005578 Ga0068854_100002051 Ga0068854_1000020514 389
154 3300025981 Ga0207640_10003032 Ga0207640_100030324 389
155 3300031903 Ga0307407_10061646 Ga0307407_100616462 389
156 3300032126 Ga0307415_100184941 Ga0307415_1001849412 389
157 3300046460 Ga0495638_0000301 Ga0495638_0000301_42986_44161 389
158 iso_pu_bacteria 2919709256 2919710615 389
159 2162886007 SwRhRL2b_contig_988 SwRhRL2b_0623.00005810 390
160 3300001904 JGI24736J21556_1001407 JGI24736J21556_10014072 390
161 3300001915 JGI24741J21665_1000004 JGI24741J21665_100000416 390
162 3300001979 JGI24740J21852_10002677 JGI24740J21852_100026774 390
163 3300001989 JGI24739J22299_10002528 JGI24739J22299_100025285 390
164 3300001990 JGI24737J22298_10003083 JGI24737J22298_100030831 390
165 3300002067 JGI24735J21928_10004164 JGI24735J21928_100041645 390
166 3300002075 JGI24738J21930_10003221 JGI24738J21930_100032213 390
167 3300002459 JGI24751J29686_10005837 JGI24751J29686_100058372 390
168 3300003781 Ga0055536_1003479 Ga0055536_10034797 390
169 3300003781 Ga0055536_1007179 Ga0055536_10071793 390
170 3300003781 Ga0055536_1012462 Ga0055536_10124621 390
171 3300003791 Ga0055530_10000013 Ga0055530_100000133 390
172 3300003794 Ga0055531_10006519 Ga0055531_100065194 390
173 3300003794 Ga0055531_10011896 Ga0055531_100118962 390
174 3300005289 Ga0065704_10003246 Ga0065704_100032464 390
175 3300005327 Ga0070658_10045637 Ga0070658_100456373 390
176 3300005329 Ga0070683_100117271 Ga0070683_1001172712 390
177 3300005331 Ga0070670_100000344 Ga0070670_1000003447 390
178 3300005331 Ga0070670_100088611 Ga0070670_1000886112 390
179 3300005331 Ga0070670_100128704 Ga0070670_1001287042 390
180 3300005335 Ga0070666_10000305 Ga0070666_100003054 390
181 3300005339 Ga0070660_100088429 Ga0070660_1000884292 390
182 3300005347 Ga0070668_100000093 Ga0070668_10000009331 390
183 3300005353 Ga0070669_100000013 Ga0070669_100000013195 390
184 3300005353 Ga0070669_100132467 Ga0070669_1001324672 390
185 3300005355 Ga0070671_100000009 Ga0070671_10000000928 390
186 3300005355 Ga0070671_100234006 Ga0070671_1002340062 390
187 3300005366 Ga0070659_100046199 Ga0070659_1000461992 390
188 3300005367 Ga0070667_100000162 Ga0070667_10000016218 390
189 3300005440 Ga0070705_100079508 Ga0070705_1000795082 390
190 3300005445 Ga0070708_100152401 Ga0070708_1001524011 390
191 3300005455 Ga0070663_100009782 Ga0070663_1000097822 390
192 3300005539 Ga0068853_100001399 Ga0068853_1000013992 390
193 3300005539 Ga0068853_100040880 Ga0068853_1000408803 390
194 3300005539 Ga0068853_100076322 Ga0068853_1000763222 390
195 3300005544 Ga0070686_100000171 Ga0070686_10000017121 390
196 3300005548 Ga0070665_100000038 Ga0070665_100000038187 390
197 3300005548 Ga0070665_100151967 Ga0070665_1001519672 390
198 3300005563 Ga0068855_100046889 Ga0068855_1000468892 390
199 3300005563 Ga0068855_100131337 Ga0068855_1001313372 390
200 3300005577 Ga0068857_100010124 Ga0068857_1000101247 390
201 3300005577 Ga0068857_100205444 Ga0068857_1002054442 390
202 3300005614 Ga0068856_100003768 Ga0068856_10000376814 390
203 3300005617 Ga0068859_100000202 Ga0068859_10000020214 390
204 3300005618 Ga0068864_100006790 Ga0068864_1000067903 390
205 3300005834 Ga0068851_10074010 Ga0068851_100740102 390
206 3300005841 Ga0068863_100000047 Ga0068863_10000004756 390
207 3300005841 Ga0068863_100017898 Ga0068863_1000178985 390
208 3300005841 Ga0068863_100019188 Ga0068863_1000191885 390
209 3300005842 Ga0068858_100012887 Ga0068858_1000128877 390
210 3300005843 Ga0068860_100032312 Ga0068860_1000323122 390
211 3300005843 Ga0068860_100112502 Ga0068860_1001125022 390
212 3300005844 Ga0068862_100006147 Ga0068862_1000061475 390
213 3300006042 Ga0075368_10000180 Ga0075368_100001804 390
214 3300006178 Ga0075367_10000047 Ga0075367_1000004722 390
215 3300006871 Ga0075434_100019793 Ga0075434_1000197935 390
216 3300006931 Ga0097620_100000202 Ga0097620_10000020246 390
217 3300009011 Ga0105251_10045041 Ga0105251_100450412 390
218 3300009093 Ga0105240_10188971 Ga0105240_101889712 390
219 3300009101 Ga0105247_10000831 Ga0105247_100008313 390
220 3300009147 Ga0114129_10112701 Ga0114129_101127012 390
221 3300009177 Ga0105248_10199782 Ga0105248_101997822 390
222 3300009545 Ga0105237_10195441 Ga0105237_101954412 390
223 3300009551 Ga0105238_10280126 Ga0105238_102801262 390
224 3300009978 Ga0105148_100098 Ga0105148_1000986 390
225 3300010375 Ga0105239_10033054 Ga0105239_100330542 390
226 3300013102 Ga0157371_10007213 Ga0157371_100072133 390
227 3300013102 Ga0157371_10017568 Ga0157371_100175685 390
228 3300014326 Ga0157380_10171278 Ga0157380_101712782 390
229 3300017792 Ga0163161_10014729 Ga0163161_100147295 390
230 3300017792 Ga0163161_10215341 Ga0163161_102153411 390
231 3300020070 Ga0206356_11452870 Ga0206356_114528702 390
232 3300025229 Ga0209147_101123 Ga0209147_1011235 390
233 3300025291 Ga0209675_1000025 Ga0209675_100002558 390
234 3300025292 Ga0209676_1000221 Ga0209676_10002213 390
235 3300025292 Ga0209676_1000228 Ga0209676_1000228117 390
236 3300025292 Ga0209676_1000276 Ga0209676_100027632 390
237 3300025292 Ga0209676_1019053 Ga0209676_10190534 390
238 3300025294 Ga0209025_1020711 Ga0209025_10207113 390
239 3300025298 Ga0209050_1000042 Ga0209050_1000042384 390
240 3300025298 Ga0209050_1004010 Ga0209050_10040103 390
241 3300025298 Ga0209050_1013953 Ga0209050_10139533 390
242 3300025298 Ga0209050_1026158 Ga0209050_10261582 390
243 3300025304 Ga0209257_1000135 Ga0209257_10001353 390
244 3300025304 Ga0209257_1000229 Ga0209257_10002293 390
245 3300025304 Ga0209257_1000695 Ga0209257_100069519 390
246 3300025315 Ga0207697_10003991 Ga0207697_100039913 390
247 3300025900 Ga0207710_10019206 Ga0207710_100192063 390
248 3300025903 Ga0207680_10000429 Ga0207680_1000042914 390
249 3300025904 Ga0207647_10011216 Ga0207647_100112164 390
250 3300025913 Ga0207695_10046288 Ga0207695_100462883 390
251 3300025919 Ga0207657_10033667 Ga0207657_100336672 390
252 3300025923 Ga0207681_10000008 Ga0207681_1000000838 390
253 3300025923 Ga0207681_10023588 Ga0207681_100235883 390
254 3300025923 Ga0207681_10056858 Ga0207681_100568582 390
255 3300025925 Ga0207650_10044248 Ga0207650_100442483 390
256 3300025925 Ga0207650_10077617 Ga0207650_100776172 390
257 3300025925 Ga0207650_10087141 Ga0207650_100871412 390
258 3300025927 Ga0207687_10051764 Ga0207687_100517642 390
259 3300025931 Ga0207644_10000006 Ga0207644_1000000628 390
260 3300025941 Ga0207711_10141679 Ga0207711_101416792 390
261 3300025961 Ga0207712_10009699 Ga0207712_100096993 390
262 3300025972 Ga0207668_10000195 Ga0207668_1000019522 390
263 3300025972 Ga0207668_10000731 Ga0207668_100007319 390
264 3300025986 Ga0207658_10000127 Ga0207658_1000012755 390
265 3300025986 Ga0207658_10001246 Ga0207658_1000124615 390
266 3300026035 Ga0207703_10025840 Ga0207703_100258403 390
267 3300026041 Ga0207639_10004275 Ga0207639_100042754 390
268 3300026041 Ga0207639_10004953 Ga0207639_100049533 390
269 3300026041 Ga0207639_10058042 Ga0207639_100580422 390
270 3300026067 Ga0207678_10000072 Ga0207678_1000007232 390
271 3300026078 Ga0207702_10377212 Ga0207702_103772121 390
272 3300026088 Ga0207641_10000079 Ga0207641_1000007955 390
273 3300026088 Ga0207641_10009520 Ga0207641_100095204 390
274 3300026088 Ga0207641_10019253 Ga0207641_100192532 390
275 3300026095 Ga0207676_10002410 Ga0207676_100024109 390
276 3300026116 Ga0207674_10005919 Ga0207674_100059195 390
277 3300026116 Ga0207674_10030787 Ga0207674_100307873 390
278 3300026118 Ga0207675_100006560 Ga0207675_10000656010 390
279 3300026142 Ga0207698_10024470 Ga0207698_100244704 390
280 3300027866 Ga0209813_10000267 Ga0209813_100002676 390
281 3300027876 Ga0209974_10014668 Ga0209974_100146682 390
282 3300028379 Ga0268266_10000118 Ga0268266_1000011858 390
283 3300028380 Ga0268265_10000392 Ga0268265_1000039228 390
284 3300028381 Ga0268264_10000310 Ga0268264_1000031053 390
285 3300028381 Ga0268264_10010868 Ga0268264_100108684 390
286 3300028794 Ga0307515_10029188 Ga0307515_100291885 390
287 3300028794 Ga0307515_10030159 Ga0307515_100301596 390
288 3300031548 Ga0307408_100058204 Ga0307408_1000582041 390
289 3300031548 Ga0307408_100282793 Ga0307408_1002827931 390
290 3300031852 Ga0307410_10003860 Ga0307410_100038603 390
291 3300031911 Ga0307412_10000348 Ga0307412_1000034828 390
292 3300031911 Ga0307412_10170937 Ga0307412_101709372 390
293 3300031911 Ga0307412_10189526 Ga0307412_101895262 390
294 3300032002 Ga0307416_100158467 Ga0307416_1001584672 390
295 3300032004 Ga0307414_10000105 Ga0307414_1000010540 390
296 3300032004 Ga0307414_10001344 Ga0307414_100013449 390
297 3300032004 Ga0307414_10001394 Ga0307414_1000139411 390
298 3300032004 Ga0307414_10004671 Ga0307414_100046715 390
299 3300032004 Ga0307414_10033431 Ga0307414_100334312 390
300 3300038705 Ga0237819_00788 Ga0237819_00788_7075_8247 390
301 3300039437 Ga0436365_0361176 Ga0436365_0361176_13225_14397 390
302 3300039453 Ga0436362_0795015 Ga0436362_0795015_80_1252 390
303 3300045051 Ga0451576_0000007 Ga0451576_0000007_311141_312334 390
304 3300046452 Ga0495617_030146 Ga0495617_030146_172_1359 390
305 3300046453 Ga0495627_000153 Ga0495627_000153_25679_26851 390
306 3300046453 Ga0495627_001065 Ga0495627_001065_9552_10724 390
307 3300046453 Ga0495627_006692 Ga0495627_006692_613_1800 390
308 3300046457 Ga0495590_0001563 Ga0495590_0001563_517_1689 390
309 3300046460 Ga0495638_0000249 Ga0495638_0000249_22335_23522 390
310 3300046460 Ga0495638_0000538 Ga0495638_0000538_5144_6316 390
311 3300046460 Ga0495638_0005278 Ga0495638_0005278_6854_8026 390
312 3300046471 Ga0495650_0001599 Ga0495650_0001599_15384_16556 390
313 3300046471 Ga0495650_0015489 Ga0495650_0015489_2300_3472 390
314 3300046491 Ga0495584_0025509 Ga0495584_0025509_313_1500 390
315 3300046506 Ga0495583_0000262 Ga0495583_0000262_57414_58601 390
316 3300046507 Ga0495606_0035299 Ga0495606_0035299_1630_2802 390
317 3300046512 Ga0495610_0000071 Ga0495610_0000071_87204_88391 390
318 3300046512 Ga0495610_0000157 Ga0495610_0000157_62473_63645 390
319 3300046512 Ga0495610_0002386 Ga0495610_0002386_8689_9861 390
320 3300046513 Ga0495616_0000521 Ga0495616_0000521_7413_8585 390
321 3300046519 Ga0495632_0000382 Ga0495632_0000382_9410_10597 390
322 3300046519 Ga0495632_0004994 Ga0495632_0004994_1342_2529 390
323 3300046519 Ga0495632_0045754 Ga0495632_0045754_692_1864 390
324 3300046520 Ga0495637_0013103 Ga0495637_0013103_1309_2496 390
325 3300046520 Ga0495637_0022716 Ga0495637_0022716_893_2080 390
326 3300046522 Ga0495643_0000053 Ga0495643_0000053_192756_193943 390
327 3300046522 Ga0495643_0003981 Ga0495643_0003981_820_1992 390
328 3300046524 Ga0495648_0000015 Ga0495648_0000015_224409_225596 390
329 3300046524 Ga0495648_0000509 Ga0495648_0000509_21520_22692 390
330 3300046524 Ga0495648_0020032 Ga0495648_0020032_541_1713 390
331 3300046525 Ga0495663_0000020 Ga0495663_0000020_7933_9120 390
332 3300046542 Ga0495597_0003545 Ga0495597_0003545_4360_5532 390
333 3300046557 Ga0495622_0012466 Ga0495622_0012466_1433_2605 390
334 3300046557 Ga0495622_0026398 Ga0495622_0026398_849_2060 390
335 3300046558 Ga0495633_0000400 Ga0495633_0000400_26735_27913 390
336 3300046558 Ga0495633_0002316 Ga0495633_0002316_12066_13238 390
337 3300046558 Ga0495633_0007042 Ga0495633_0007042_265_1452 390
338 3300046616 Ga0495668_0000001 Ga0495668_0000001_792674_793846 390
339 3300046616 Ga0495668_0000105 Ga0495668_0000105_14431_15603 390
340 3300046616 Ga0495668_0006076 Ga0495668_0006076_1096_2268 390
341 3300046616 Ga0495668_0036879 Ga0495668_0036879_968_2140 390
342 3300046616 Ga0495668_0061898 Ga0495668_0061898_789_1991 390
343 3300046660 Ga0495625_0000198 Ga0495625_0000198_45294_46481 390
344 3300046660 Ga0495625_0005243 Ga0495625_0005243_10113_11285 390
345 3300046660 Ga0495625_0007331 Ga0495625_0007331_5553_6755 390
346 3300046660 Ga0495625_0023261 Ga0495625_0023261_175_1347 390
347 3300046692 Ga0495671_0000031 Ga0495671_0000031_8089_9276 390
348 3300046692 Ga0495671_0000084 Ga0495671_0000084_57614_58801 390
349 3300046692 Ga0495671_0005263 Ga0495671_0005263_2670_3881 390
350 3300046694 Ga0495649_0000684 Ga0495649_0000684_6324_7535 390
351 3300046794 Ga0495589_0010961 Ga0495589_0010961_597_1769 390
352 3300047469 Ga0495673_0000156 Ga0495673_0000156_24979_26151 390
353 3300047469 Ga0495673_0000206 Ga0495673_0000206_29743_30930 390
354 3300047469 Ga0495673_0001785 Ga0495673_0001785_1387_2559 390
355 3300047469 Ga0495673_0002305 Ga0495673_0002305_232_1404 390
356 3300047470 Ga0495681_0000008 Ga0495681_0000008_55954_57141 390
357 3300047470 Ga0495681_0009019 Ga0495681_0009019_1443_2630 390
358 3300047472 Ga0495686_0001010 Ga0495686_0001010_6345_7517 390
359 3300047472 Ga0495686_0059177 Ga0495686_0059177_617_1804 390
360 3300047472 Ga0495686_0080216 Ga0495686_0080216_428_1615 390
361 3300047472 Ga0495686_0129455 Ga0495686_0129455_234_1406 390
362 3300048088 Ga0495602_0109186 Ga0495602_0109186_619_1791 390
363 3300048909 Ga0496106_0046888 Ga0496106_0046888_381_1553 390
364 3300048910 Ga0496107_0000069 Ga0496107_0000069_16493_17665 390
365 3300048911 Ga0496108_0003383 Ga0496108_0003383_8971_10143 390
366 3300048911 Ga0496108_0257288 Ga0496108_0257288_190_1362 390
367 3300048913 Ga0496110_0006266 Ga0496110_0006266_822_1994 390
368 3300048913 Ga0496110_0145990 Ga0496110_0145990_214_1386 390
369 3300048914 Ga0496111_0067377 Ga0496111_0067377_815_1987 390
370 3300048919 Ga0496116_0036430 Ga0496116_0036430_1385_2557 390
371 3300048919 Ga0496116_0073181 Ga0496116_0073181_214_1386 390
372 3300048920 Ga0496117_0006257 Ga0496117_0006257_3634_4806 390
373 3300048921 Ga0496118_0052082 Ga0496118_0052082_265_1437 390
374 3300048924 Ga0496121_0001861 Ga0496121_0001861_19915_21087 390
375 3300048924 Ga0496121_0007980 Ga0496121_0007980_6293_7465 390
376 3300048924 Ga0496121_0054144 Ga0496121_0054144_1405_2577 390
377 3300048925 Ga0496122_0000934 Ga0496122_0000934_38908_40095 390
378 3300048925 Ga0496122_0016810 Ga0496122_0016810_3024_4196 390
379 3300048926 Ga0496123_0000740 Ga0496123_0000740_12933_14120 390
380 3300048926 Ga0496123_0000968 Ga0496123_0000968_17592_18764 390
381 3300048927 Ga0496124_0007646 Ga0496124_0007646_1499_2671 390
382 3300048927 Ga0496124_0078087 Ga0496124_0078087_804_1976 390
383 3300048928 Ga0496125_0000174 Ga0496125_0000174_131750_132922 390
384 3300048928 Ga0496125_0000335 Ga0496125_0000335_26867_28039 390
385 3300048928 Ga0496125_0032733 Ga0496125_0032733_3377_4549 390
386 3300048928 Ga0496125_0092389 Ga0496125_0092389_132_1304 390
387 3300048929 Ga0496126_0010711 Ga0496126_0010711_7556_8728 390
388 3300049459 Ga0495678_000680 Ga0495678_000680_5367_6539 390
389 3300049551 Ga0501335_000089 Ga0501335_000089_1288_2460 390
390 3300049568 Ga0501031_0129881 Ga0501031_0129881_383_1555 390
391 3300049569 Ga0501032_0020975 Ga0501032_0020975_1335_2507 390
392 3300049571 Ga0501034_0011101 Ga0501034_0011101_1780_2952 390
393 3300049571 Ga0501034_0041377 Ga0501034_0041377_2318_3505 390
394 3300049572 Ga0501036_0017409 Ga0501036_0017409_3425_4597 390
395 3300049573 Ga0501037_0038452 Ga0501037_0038452_1660_2832 390
396 3300049574 Ga0501038_0036373 Ga0501038_0036373_995_2167 390
397 3300049575 Ga0501039_0075322 Ga0501039_0075322_476_1648 390
398 3300049581 Ga0501047_0054028 Ga0501047_0054028_1437_2609 390
399 3300049663 Ga0501223_000043 Ga0501223_000043_12691_13863 390
400 3300049663 Ga0501223_000082 Ga0501223_000082_5476_6648 390
401 3300049664 Ga0501224_000019 Ga0501224_000019_63886_65058 390
402 3300049669 Ga0501235_009973 Ga0501235_009973_590_1762 390
403 3300049705 Ga0501225_0000059 Ga0501225_0000059_11107_12279 390
404 3300049705 Ga0501225_0000065 Ga0501225_0000065_12581_13753 390
405 3300049707 Ga0501234_003656 Ga0501234_003656_60_1232 390
406 3300049822 Ga0501035_0062642 Ga0501035_0062642_1525_2697 390
407 3300049853 Ga0501226_000080 Ga0501226_000080_15385_16557 390
408 3300050494 nmdc:mga06z11_7_c1 nmdc:mga06z11_7_c1_23874_25082 390
409 3300050495 nmdc:mga04h51_70_c1 nmdc:mga04h51_70_c1_8659_9867 390
410 3300050512 nmdc:mga0n895_23671_c1 nmdc:mga0n895_23671_c1_193_1365 390
411 3300053080 Ga0500635_0000049 Ga0500635_0000049_76515_77687 390
412 3300053086 Ga0500578_0000166 Ga0500578_0000166_31789_32961 390
413 3300053087 Ga0500643_000420 Ga0500643_000420_27041_28213 390
414 3300053087 Ga0500643_006102 Ga0500643_006102_308_1510 390
415 3300053087 Ga0500643_006176 Ga0500643_006176_3808_4995 390
416 3300053088 Ga0500644_0000913 Ga0500644_0000913_37_1209 390
417 3300053088 Ga0500644_0003579 Ga0500644_0003579_1978_3150 390
418 3300053091 Ga0500647_0063787 Ga0500647_0063787_454_1626 390
419 3300053096 Ga0500641_0000140 Ga0500641_0000140_10657_11829 390
420 3300053096 Ga0500641_0019886 Ga0500641_0019886_1273_2445 390
421 3300053098 Ga0500650_0059730 Ga0500650_0059730_494_1696 390
422 3300053104 Ga0500556_0000157 Ga0500556_0000157_20091_21293 390
423 3300053104 Ga0500556_0002655 Ga0500556_0002655_1574_2746 390
424 3300053108 Ga0500562_000906 Ga0500562_000906_2712_3884 390
425 3300053108 Ga0500562_004234 Ga0500562_004234_1775_2947 390
426 3300053108 Ga0500562_014413 Ga0500562_014413_659_1861 390
427 3300053116 Ga0500592_012266 Ga0500592_012266_143_1330 390
428 3300053118 Ga0500594_0000310 Ga0500594_0000310_3511_4683 390
429 3300053118 Ga0500594_0003550 Ga0500594_0003550_1650_2861 390
430 3300053119 Ga0500595_001328 Ga0500595_001328_5935_7137 390
431 3300053119 Ga0500595_004701 Ga0500595_004701_468_1640 390
432 3300053122 Ga0500608_000089 Ga0500608_000089_3187_4359 390
433 3300053122 Ga0500608_000443 Ga0500608_000443_7681_8853 390
434 3300053125 Ga0500618_000413 Ga0500618_000413_19699_20871 390
435 3300053130 Ga0500642_0000002 Ga0500642_0000002_189760_190962 390
436 3300053136 Ga0500559_0002480 Ga0500559_0002480_4496_5668 390
437 3300053136 Ga0500559_0004237 Ga0500559_0004237_1929_3116 390
438 3300053138 Ga0500564_028774 Ga0500564_028774_40_1212 390
439 3300053139 Ga0500568_0006701 Ga0500568_0006701_3507_4679 390
440 3300053140 Ga0500573_0000045 Ga0500573_0000045_82743_83915 390
441 3300053142 Ga0500577_0004110 Ga0500577_0004110_2625_3797 390
442 3300053151 Ga0500604_0025338 Ga0500604_0025338_310_1482 390
443 3300053153 Ga0500616_0004927 Ga0500616_0004927_3525_4697 390
444 3300053156 Ga0500622_0000784 Ga0500622_0000784_25036_26208 390
445 3300053156 Ga0500622_0001641 Ga0500622_0001641_4105_5277 390
446 3300053156 Ga0500622_0002715 Ga0500622_0002715_3718_4890 390
447 3300053156 Ga0500622_0011133 Ga0500622_0011133_715_1887 390
448 3300053156 Ga0500622_0045283 Ga0500622_0045283_135_1337 390
449 3300053157 Ga0500624_000007 Ga0500624_000007_35654_36826 390
450 3300053157 Ga0500624_000249 Ga0500624_000249_9068_10255 390
451 3300053158 Ga0500627_0000005 Ga0500627_0000005_132180_133367 390
452 3300053158 Ga0500627_0062286 Ga0500627_0062286_290_1462 390
453 3300053177 Ga0500636_0004345 Ga0500636_0004345_1478_2665 390
454 3300053177 Ga0500636_0036569 Ga0500636_0036569_922_2094 390
455 3300053177 Ga0500636_0072345 Ga0500636_0072345_674_1846 390
456 3300053729 Ga0500625_067245 Ga0500625_067245_314_1486 390
457 3300053730 Ga0500645_000262 Ga0500645_000262_310_1482 390
458 3300053730 Ga0500645_000313 Ga0500645_000313_16306_17478 390
459 3300053730 Ga0500645_000449 Ga0500645_000449_24855_26057 390
460 3300053735 Ga0500596_000147 Ga0500596_000147_2581_3753 390
461 3300006353 Ga0075370_10015522 Ga0075370_100155224 391
462 3300042438 Ga0439459_0020220 Ga0439459_0020220_26_1201 391
463 3300049571 Ga0501034_0113084 Ga0501034_0113084_732_1910 391
464 3300050496 nmdc:mga07m45_47739_c1 nmdc:mga07m45_47739_c1_363_1538 391
465 3300053087 Ga0500643_000001 Ga0500643_000001_981012_982190 391
466 3300053087 Ga0500643_000905 Ga0500643_000905_11519_12694 391
467 3300053108 Ga0500562_000275 Ga0500562_000275_5658_6836 391
468 3300053136 Ga0500559_0007978 Ga0500559_0007978_711_1886 391
469 3300055283 Ga0500661_005870 Ga0500661_005870_427_1602 391
470 3300025298 Ga0209050_1000265 Ga0209050_100026569 392
471 3300032005 Ga0307411_10096940 Ga0307411_100969402 392
472 3300032133 Ga0316583_10011256 Ga0316583_100112561 392
473 3300033180 Ga0307510_10102461 Ga0307510_101024612 392
474 3300036647 Ga0316582_0096788 Ga0316582_0096788_260_1438 392
475 3300046453 Ga0495627_012656 Ga0495627_012656_96_1274 392
476 3300046500 Ga0495596_0000823 Ga0495596_0000823_14252_15430 392
477 3300046506 Ga0495583_0035032 Ga0495583_0035032_767_1945 392
478 3300046512 Ga0495610_0000044 Ga0495610_0000044_128481_129659 392
479 3300046515 Ga0495620_0067975 Ga0495620_0067975_220_1398 392
480 3300046519 Ga0495632_0007134 Ga0495632_0007134_84_1262 392
481 3300046520 Ga0495637_0009782 Ga0495637_0009782_1239_2426 392
482 3300046660 Ga0495625_0004423 Ga0495625_0004423_2072_3259 392
483 3300047320 Ga0495672_0004227 Ga0495672_0004227_9011_10198 392
484 3300047470 Ga0495681_0000662 Ga0495681_0000662_24887_26065 392
485 3300048907 Ga0496104_0047635 Ga0496104_0047635_857_2035 392
486 3300048919 Ga0496116_0000017 Ga0496116_0000017_91968_93146 392
487 3300048921 Ga0496118_0030554 Ga0496118_0030554_420_1598 392
488 3300048924 Ga0496121_0005216 Ga0496121_0005216_13708_14886 392
489 3300048925 Ga0496122_0002119 Ga0496122_0002119_5714_6892 392
490 3300048926 Ga0496123_0000991 Ga0496123_0000991_34872_36050 392
491 3300048926 Ga0496123_0002006 Ga0496123_0002006_1801_2979 392
492 3300048927 Ga0496124_0015705 Ga0496124_0015705_3253_4431 392
493 3300048927 Ga0496124_0016533 Ga0496124_0016533_2038_3216 392
494 3300048928 Ga0496125_0068607 Ga0496125_0068607_738_1916 392
495 3300048929 Ga0496126_0000359 Ga0496126_0000359_68221_69399 392
496 3300053104 Ga0500556_0001174 Ga0500556_0001174_10067_11254 392
497 3300053121 Ga0500607_002276 Ga0500607_002276_4511_5689 392
498 3300053136 Ga0500559_0000070 Ga0500559_0000070_51033_52223 392
499 3300053148 Ga0500590_000657 Ga0500590_000657_5964_7142 392
500 3300053730 Ga0500645_002606 Ga0500645_002606_2800_3987 392
501 3300002459 JGI24751J29686_10000080 JGI24751J29686_1000008032 393
502 3300005353 Ga0070669_100001337 Ga0070669_1000013375 393
503 3300005355 Ga0070671_100000050 Ga0070671_10000005070 393
504 3300005563 Ga0068855_100001903 Ga0068855_10000190321 393
505 3300005563 Ga0068855_100041968 Ga0068855_1000419683 393
506 3300005842 Ga0068858_100274190 Ga0068858_1002741902 393
507 3300005843 Ga0068860_100413288 Ga0068860_1004132882 393
508 3300009093 Ga0105240_10312200 Ga0105240_103122002 393
509 3300025923 Ga0207681_10000174 Ga0207681_1000017413 393
510 3300025925 Ga0207650_10130054 Ga0207650_101300543 393
511 3300025931 Ga0207644_10000003 Ga0207644_1000000370 393
512 3300025941 Ga0207711_10092915 Ga0207711_100929152 393
513 3300025949 Ga0207667_10033487 Ga0207667_100334875 393
514 3300026035 Ga0207703_10135661 Ga0207703_101356612 393
515 3300026095 Ga0207676_10149672 Ga0207676_101496722 393
516 3300028379 Ga0268266_10236322 Ga0268266_102363221 393
517 3300048903 Ga0496100_0034817 Ga0496100_0034817_393_1574 393
518 3300048904 Ga0496101_0138813 Ga0496101_0138813_139_1320 393
519 3300048905 Ga0496102_0021718 Ga0496102_0021718_873_2054 393
520 3300048906 Ga0496103_0069361 Ga0496103_0069361_490_1671 393
521 3300048910 Ga0496107_0004656 Ga0496107_0004656_1599_2780 393
522 3300048911 Ga0496108_0089226 Ga0496108_0089226_256_1437 393
523 3300048916 Ga0496113_0006350 Ga0496113_0006350_3771_4952 393
524 3300053087 Ga0500643_000969 Ga0500643_000969_8050_9246 393
525 iso_pu_bacteria 2738541275 2738710003 393
526 iso_pu_bacteria 2738541301 2738848428 393
527 iso_pu_bacteria 2738541304 2738864157 393
528 iso_pu_bacteria 2738543022 2739296675 393
529 iso_pu_bacteria 2738543033 2739358353 393
530 iso_pu_bacteria 2739367664 2739649788 393
531 iso_pu_bacteria 2739367865 2740028261 393
532 iso_pu_bacteria 2928100450 2928101702 393
533 iso_pu_bacteria 2928959182 2928959792 393
534 3300048928 Ga0496125_0119155 Ga0496125_0119155_637_1836 394
535 3300006195 Ga0075366_10001540 Ga0075366_100015406 395
536 3300025972 Ga0207668_10053922 Ga0207668_100539223 396
537 iso_pu_bacteria 2510917021 2511127180 396
538 2162886007 SwRhRL2b_contig_2199698 SwRhRL2b_0330.00002730 397
539 3300005289 Ga0065704_10071330 Ga0065704_100713302 397
540 3300005353 Ga0070669_100003132 Ga0070669_1000031322 397
541 3300005355 Ga0070671_100015177 Ga0070671_1000151773 397
542 3300005367 Ga0070667_100003157 Ga0070667_1000031579 397
543 3300005548 Ga0070665_100090119 Ga0070665_1000901192 397
544 3300005841 Ga0068863_100055440 Ga0068863_1000554402 397
545 3300005842 Ga0068858_100038491 Ga0068858_1000384914 397
546 3300009092 Ga0105250_10028650 Ga0105250_100286502 397
547 3300009177 Ga0105248_10346510 Ga0105248_103465102 397
548 3300013306 Ga0163162_10011771 Ga0163162_100117715 397
549 3300013306 Ga0163162_10031350 Ga0163162_100313502 397
550 3300025923 Ga0207681_10001207 Ga0207681_100012072 397
551 3300025931 Ga0207644_10018358 Ga0207644_100183583 397
552 3300025941 Ga0207711_10222963 Ga0207711_102229631 397
553 3300025986 Ga0207658_10002244 Ga0207658_100022449 397
554 3300026035 Ga0207703_10027104 Ga0207703_100271043 397
555 3300028379 Ga0268266_10005550 Ga0268266_100055507 397
556 3300028379 Ga0268266_10099992 Ga0268266_100999922 397
557 3300028380 Ga0268265_10116846 Ga0268265_101168462 397
558 3300048905 Ga0496102_0000305 Ga0496102_0000305_9138_10334 397
559 3300048906 Ga0496103_0000475 Ga0496103_0000475_14174_15370 397
560 3300048907 Ga0496104_0000293 Ga0496104_0000293_33820_35016 397
561 3300048908 Ga0496105_0003464 Ga0496105_0003464_1364_2560 397
562 3300048916 Ga0496113_0000622 Ga0496113_0000622_1522_2718 397
563 3300048920 Ga0496117_0000694 Ga0496117_0000694_51872_53068 397
564 3300048922 Ga0496119_0000040 Ga0496119_0000040_182985_184181 397
565 3300048923 Ga0496120_0004492 Ga0496120_0004492_9172_10368 397
566 3300048925 Ga0496122_0003521 Ga0496122_0003521_5244_6440 397
567 3300048927 Ga0496124_0010873 Ga0496124_0010873_5271_6467 397
568 3300048929 Ga0496126_0000044 Ga0496126_0000044_144095_145291 397
569 3300053122 Ga0500608_000512 Ga0500608_000512_5147_6343 397
570 3300053138 Ga0500564_003263 Ga0500564_003263_3668_4864 397
571 3300053729 Ga0500625_000010 Ga0500625_000010_130061_131257 397
572 3300005289 Ga0065704_10109097 Ga0065704_101090973 398
573 3300005295 Ga0065707_10090532 Ga0065707_100905324 398
574 3300005843 Ga0068860_100048688 Ga0068860_1000486883 398
575 3300006353 Ga0075370_10014025 Ga0075370_100140252 398
576 3300028381 Ga0268264_10034608 Ga0268264_100346083 398
577 3300049571 Ga0501034_0307683 Ga0501034_0307683_82_1278 398
578 3300050496 nmdc:mga07m45_43585_c1 nmdc:mga07m45_43585_c1_641_1837 398
579 3300053087 Ga0500643_006792 Ga0500643_006792_2566_3762 398
580 3300053121 Ga0500607_000443 Ga0500607_000443_28713_29909 398
581 3300053136 Ga0500559_0036444 Ga0500559_0036444_241_1437 398
582 3300053148 Ga0500590_045171 Ga0500590_045171_866_2062 398
583 3300053156 Ga0500622_0000491 Ga0500622_0000491_15016_16212 398
584 3300053730 Ga0500645_002637 Ga0500645_002637_2976_4172 398
585 3300005289 Ga0065704_10005515 Ga0065704_100055152 399
586 3300006038 Ga0075365_10171319 Ga0075365_101713191 399
587 3300006042 Ga0075368_10001487 Ga0075368_100014877 399
588 3300006048 Ga0075363_100000064 Ga0075363_1000000643 399
589 3300006048 Ga0075363_100002606 Ga0075363_1000026063 399
590 3300006051 Ga0075364_10093813 Ga0075364_100938132 399
591 3300006177 Ga0075362_10000093 Ga0075362_1000009314 399
592 3300006177 Ga0075362_10011866 Ga0075362_100118663 399
593 3300006178 Ga0075367_10052589 Ga0075367_100525893 399
594 3300006186 Ga0075369_10003568 Ga0075369_100035682 399
595 3300006186 Ga0075369_10004395 Ga0075369_100043953 399
596 3300006195 Ga0075366_10000014 Ga0075366_100000146 399
597 3300006195 Ga0075366_10031282 Ga0075366_100312821 399
598 3300006353 Ga0075370_10000056 Ga0075370_1000005622 399
599 3300006353 Ga0075370_10068604 Ga0075370_100686043 399
600 3300017792 Ga0163161_10001436 Ga0163161_100014365 399
601 3300027866 Ga0209813_10000118 Ga0209813_1000011818 399
602 3300031616 Ga0307508_10024853 Ga0307508_100248535 399
603 3300044712 Ga0453684_0410421 Ga0453684_0410421_150_1349 399
604 3300049823 Ga0501044_0000346 Ga0501044_0000346_25740_26939 399
605 3300050489 nmdc:mga03683_64_c1 nmdc:mga03683_64_c1_15833_17032 399
606 3300050489 nmdc:mga03683_744_c1 nmdc:mga03683_744_c1_4238_5437 399
607 3300050490 nmdc:mga03n38_1850_c1 nmdc:mga03n38_1850_c1_3658_4857 399
608 3300050493 nmdc:mga0k408_52349_c1 nmdc:mga0k408_52349_c1_336_1535 399
609 3300050493 nmdc:mga0k408_7_c1 nmdc:mga0k408_7_c1_60447_61646 399
610 3300050495 nmdc:mga04h51_582_c1 nmdc:mga04h51_582_c1_827_2026 399
611 3300050496 nmdc:mga07m45_3_c1 nmdc:mga07m45_3_c1_139342_140541 399
612 3300050516 nmdc:mga0sz30_2963_c1 nmdc:mga0sz30_2963_c1_2015_3214 399
613 2162886007 SwRhRL2b_contig_1604904 SwRhRL2b_0308.00002520 400
614 2162886007 SwRhRL2b_contig_2586087 SwRhRL2b_0310.00004350 400
615 3300005289 Ga0065704_10000191 Ga0065704_10000191237 400
616 3300005289 Ga0065704_10082800 Ga0065704_100828001 400
617 3300005353 Ga0070669_100000990 Ga0070669_10000099015 400
618 3300005355 Ga0070671_100015289 Ga0070671_1000152894 400
619 3300005367 Ga0070667_100000678 Ga0070667_1000006783 400
620 3300005548 Ga0070665_100064630 Ga0070665_1000646302 400
621 3300005841 Ga0068863_100004204 Ga0068863_1000042048 400
622 3300005841 Ga0068863_100042659 Ga0068863_1000426594 400
623 3300005842 Ga0068858_100032105 Ga0068858_1000321053 400
624 3300005844 Ga0068862_100005421 Ga0068862_1000054218 400
625 3300009011 Ga0105251_10002779 Ga0105251_1000277912 400
626 3300009177 Ga0105248_10096952 Ga0105248_100969524 400
627 3300025923 Ga0207681_10002809 Ga0207681_100028092 400
628 3300025931 Ga0207644_10004801 Ga0207644_100048013 400
629 3300025941 Ga0207711_10078860 Ga0207711_100788604 400
630 3300025986 Ga0207658_10006257 Ga0207658_100062573 400
631 3300026088 Ga0207641_10005158 Ga0207641_100051587 400
632 3300026088 Ga0207641_10013920 Ga0207641_100139203 400
633 3300028379 Ga0268266_10047584 Ga0268266_100475844 400
634 3300028380 Ga0268265_10003351 Ga0268265_100033514 400
635 3300028381 Ga0268264_10003810 Ga0268264_100038109 400
636 3300041509 Ga0451843_1520595 Ga0451843_1520595_32_1249 400
637 3300046460 Ga0495638_0037924 Ga0495638_0037924_1622_2824 400
638 3300046474 Ga0495605_0043655 Ga0495605_0043655_784_1986 400
639 3300046500 Ga0495596_0010361 Ga0495596_0010361_1774_2976 400
640 3300046501 Ga0495607_0016876 Ga0495607_0016876_2709_3911 400
641 3300046512 Ga0495610_0001676 Ga0495610_0001676_13041_14243 400
642 3300046522 Ga0495643_0000007 Ga0495643_0000007_59023_60225 400
643 3300046522 Ga0495643_0033129 Ga0495643_0033129_1152_2354 400
644 3300046538 Ga0495609_0002808 Ga0495609_0002808_7652_8854 400
645 3300046692 Ga0495671_0056849 Ga0495671_0056849_668_1870 400
646 3300048920 Ga0496117_0014877 Ga0496117_0014877_2521_3723 400
647 3300048923 Ga0496120_0053889 Ga0496120_0053889_1000_2202 400
648 3300048924 Ga0496121_0013581 Ga0496121_0013581_4300_5502 400
649 3300048928 Ga0496125_0030396 Ga0496125_0030396_2440_3642 400
650 3300048928 Ga0496125_0065945 Ga0496125_0065945_579_1781 400

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00278

Orn_DAP_Arg_deC

Pyridoxal-dependent decarboxylase, C-terminal sheet domain

41

372

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mt1-assembly1.cif.gz_A crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti 0.9089 19 400
3mt1-assembly1.cif.gz_A crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti 0.9064 19 400
3n29-assembly1.cif.gz_B crystal structure of carboxynorspermidine decarboxylase complexed with norspermidine from campylobacter jejuni 0.9048 19 398
3n29-assembly1.cif.gz_B crystal structure of carboxynorspermidine decarboxylase complexed with norspermidine from campylobacter jejuni 0.9001 19 398
3mt1-assembly1.cif.gz_B crystal structure of putative carboxynorspermidine decarboxylase protein from sinorhizobium meliloti 0.8596 19 400
ID Description Score Start End Superfamily
3n29B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.945 29 258 3.20.20.10
3n29B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9281 29 258 3.20.20.10
3mt1A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8925 29 258 3.20.20.10
3mt1A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8756 29 258 3.20.20.10
af_Q75JL7_37_281_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8074 27 247 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A2D3VS20-F1-model_v4 Carboxynorspermidine decarboxylase 0.988 16 106
AF-A0A1B6NU86-F1-model_v4 Carboxynorspermidine decarboxylase 0.9745 52 123
AF-A0A2D8FR00-F1-model_v4 Carboxynorspermidine decarboxylase 0.9723 1 242 GO:0008836
GO:0009089
AF-A0A847C191-F1-model_v4 Carboxynorspermidine decarboxylase 0.9696 17 129
AF-A0A4Q3Z9F9-F1-model_v4 Carboxynorspermidine decarboxylase 0.9686 1 207 GO:0008836
GO:0009089

Feature Viewer

pLDDT pTM Quality
88.87 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map