F471669
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 640 | 335 | 640 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100768724|Ga0070699_1007687242 |
| Length | 180 |
| Sequence | VVCSCAELCSKESRKLHNAMSTLRPTADLCDEYGSDAQVITPGLIDFGGQCAFGGPITTLHLYEDNALVRVVLTDPGEGRVLVVDGGASLRCALVGGNLAKLAERNQWSGIVVWGAVRDVSELRQCRIGMRALAANPRKSEKSGRGQRDVPVVIGGVVVHPGYWLAADADGIIVCARQLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 8 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 13 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 18 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 57 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 59 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 60 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 61 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 62 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 76 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 79 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 83 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 105 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 106 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 107 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 108 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 109 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 110 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 111 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 112 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 113 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 114 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 115 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 116 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 117 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 118 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 119 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 122 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 123 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 124 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 125 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 126 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 127 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 128 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 129 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 130 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 131 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 132 | 3300044650 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E | Metagenome | Unclassified |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 135 | 3300044671 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E | Metagenome | Unclassified |
| 136 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 137 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 138 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 141 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 147 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 148 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 249 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 250 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 251 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 252 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 255 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 256 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 257 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 258 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 259 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 263 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 264 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 266 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 267 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 270 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 271 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 273 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 274 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 275 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 276 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 277 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 278 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 279 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 280 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 282 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 283 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 284 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 285 | 3300053106 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere | Metagenome | Endosphere |
| 286 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 287 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 288 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053112 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere | Metagenome | Endosphere |
| 290 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 291 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 292 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 293 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 294 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 295 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 296 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 297 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 298 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 299 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 300 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 301 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 302 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 303 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 304 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 306 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 307 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 309 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 310 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 311 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 312 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 313 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 314 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 315 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 317 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 318 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 319 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 320 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 322 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 324 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 325 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 326 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 327 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 329 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 330 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 331 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 332 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 333 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 334 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 335 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 22.97 |
| Nodule | 0 |
| Rhizoplane | 5.62 |
| Rhizosphere | 64.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.34 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000336 | 3300001915 | Bacteria | 14055 |
| 2 | JGI24740J21852_10000987 | 3300001979 | Bacteria | 12709 |
| 3 | JGI24740J21852_10001604 | 3300001979 | Bacteria | 10392 |
| 4 | JGI25156J39149_1003822 | 3300002705 | Bacteria | 4789 |
| 5 | JGI25156J39149_1025430 | 3300002705 | Bacteria | 952 |
| 6 | JGI25158J39367_1000340 | 3300002739 | Bacteria | 10305 |
| 7 | JGI25158J39367_1000538 | 3300002739 | Bacteria | 7643 |
| 8 | JGI25150J39212_1000541 | 3300002774 | Bacteria | 15335 |
| 9 | JGI25159J45721_1001185 | 3300002987 | Bacteria | 11135 |
| 10 | JGI25165J46597_1000122 | 3300003214 | Bacteria | 132559 |
| 11 | JGI25153J46596_10011326 | 3300003215 | Bacteria | 3950 |
| 12 | rootH1_10195554 | 3300003316 | Bacteria | 1304 |
| 13 | rootL2_10004113 | 3300003322 | Bacteria | 2019 |
| 14 | rootL2_10103840 | 3300003322 | Bacteria | 4113 |
| 15 | rootL2_10162097 | 3300003322 | Bacteria | 1678 |
| 16 | JGI25160J50197_1000102 | 3300003354 | Bacteria | 82464 |
| 17 | JGI25161J50226_1000788 | 3300003374 | Bacteria | 11955 |
| 18 | JGI25161J50226_1006104 | 3300003374 | Bacteria | 2227 |
| 19 | Ga0007409J51694_1084677 | 3300003575 | Unclassified | 1090 |
| 20 | Ga0032354_1094307 | 3300003693 | Unclassified | 842 |
| 21 | Ga0055538_1000048 | 3300003751 | Bacteria | 132559 |
| 22 | Ga0055539_1000070 | 3300003752 | Bacteria | 132559 |
| 23 | Ga0055539_1000123 | 3300003752 | Bacteria | 83036 |
| 24 | Ga0055533_1000078 | 3300003756 | Bacteria | 132559 |
| 25 | Ga0055533_1004483 | 3300003756 | Bacteria | 2491 |
| 26 | Ga0055532_1000029 | 3300003758 | Bacteria | 232900 |
| 27 | Ga0055525_1000106 | 3300003759 | Bacteria | 132559 |
| 28 | Ga0055525_1000794 | 3300003759 | Bacteria | 9973 |
| 29 | Ga0055529_1000376 | 3300003763 | Bacteria | 48166 |
| 30 | Ga0055526_1041454 | 3300003771 | Bacteria | 1147 |
| 31 | Ga0055537_1004000 | 3300003773 | Bacteria | 4342 |
| 32 | Ga0055524_1002098 | 3300003775 | Bacteria | 10542 |
| 33 | Ga0055524_1005941 | 3300003775 | Bacteria | 5372 |
| 34 | Ga0055534_1014825 | 3300003784 | Bacteria | 1448 |
| 35 | Ga0055528_1007400 | 3300003790 | Bacteria | 4858 |
| 36 | Ga0055531_10006854 | 3300003794 | Bacteria | 6350 |
| 37 | Ga0055541_1000050 | 3300003841 | Bacteria | 132559 |
| 38 | Ga0055543_1000916 | 3300004625 | Bacteria | 13766 |
| 39 | Ga0065165_1000787 | 3300005262 | Bacteria | 42471 |
| 40 | Ga0065165_1002791 | 3300005262 | Bacteria | 13766 |
| 41 | Ga0065165_1051609 | 3300005262 | Bacteria | 1165 |
| 42 | Ga0070670_100467594 | 3300005331 | Bacteria | 1119 |
| 43 | Ga0070682_100510419 | 3300005337 | Bacteria | 933 |
| 44 | Ga0070660_100000687 | 3300005339 | Bacteria | 22380 |
| 45 | Ga0070661_100000057 | 3300005344 | Bacteria | 87637 |
| 46 | Ga0070661_100005128 | 3300005344 | Bacteria | 9024 |
| 47 | Ga0070659_100001495 | 3300005366 | Bacteria | 16845 |
| 48 | Ga0070659_100009975 | 3300005366 | Bacteria | 6987 |
| 49 | Ga0070663_100000011 | 3300005455 | Bacteria | 146097 |
| 50 | Ga0070699_100768724 | 3300005518 | Bacteria | 881 |
| 51 | Ga0070664_100000008 | 3300005564 | Bacteria | 173734 |
| 52 | Ga0070664_100081826 | 3300005564 | Bacteria | 2783 |
| 53 | Ga0068857_100073874 | 3300005577 | Bacteria | 3038 |
| 54 | Ga0068854_100000072 | 3300005578 | Bacteria | 72718 |
| 55 | Ga0068854_100015327 | 3300005578 | Bacteria | 5075 |
| 56 | Ga0068856_100000009 | 3300005614 | Bacteria | 181448 |
| 57 | Ga0068852_100145780 | 3300005616 | Bacteria | 2196 |
| 58 | Ga0070712_100330783 | 3300006175 | Bacteria | 1241 |
| 59 | Ga0105244_10015596 | 3300009036 | Bacteria | 4354 |
| 60 | Ga0105240_10043193 | 3300009093 | Bacteria | 5738 |
| 61 | Ga0105240_11181744 | 3300009093 | Bacteria | 811 |
| 62 | Ga0105237_10020612 | 3300009545 | Bacteria | 6793 |
| 63 | Ga0105238_10000356 | 3300009551 | Bacteria | 49238 |
| 64 | Ga0105239_10091537 | 3300010375 | Bacteria | 3356 |
| 65 | Ga0157373_10002213 | 3300013100 | Bacteria | 14720 |
| 66 | Ga0157371_10000068 | 3300013102 | Bacteria | 168110 |
| 67 | Ga0157370_10000200 | 3300013104 | Bacteria | 75469 |
| 68 | Ga0157369_10019027 | 3300013105 | Bacteria | 7690 |
| 69 | Ga0157374_10633192 | 3300013296 | Bacteria | 1081 |
| 70 | Ga0157372_10002606 | 3300013307 | Bacteria | 19510 |
| 71 | Ga0182008_10050334 | 3300014497 | Bacteria | 2068 |
| 72 | Ga0157376_10596527 | 3300014969 | Bacteria | 1099 |
| 73 | Ga0182006_1001681 | 3300015261 | Bacteria | 12972 |
| 74 | Ga0182006_1010262 | 3300015261 | Bacteria | 4170 |
| 75 | Ga0182007_10001513 | 3300015262 | Bacteria | 12411 |
| 76 | Ga0182007_10005716 | 3300015262 | Bacteria | 5421 |
| 77 | Ga0182007_10023032 | 3300015262 | Bacteria | 2194 |
| 78 | Ga0182005_1000637 | 3300015265 | Bacteria | 16681 |
| 79 | Ga0183361_10006 | 3300016635 | Bacteria | 368532 |
| 80 | Ga0154015_1131725 | 3300020610 | Bacteria | 12806 |
| 81 | Ga0213872_10006910 | 3300021361 | Bacteria | 5647 |
| 82 | Ga0213872_10023990 | 3300021361 | Bacteria | 2805 |
| 83 | Ga0213872_10174509 | 3300021361 | Bacteria | 930 |
| 84 | Ga0209760_101327 | 3300025207 | Bacteria | 2674 |
| 85 | Ga0209436_100109 | 3300025208 | Bacteria | 41259 |
| 86 | Ga0209784_100003 | 3300025224 | Bacteria | 1379451 |
| 87 | Ga0209784_100062 | 3300025224 | Bacteria | 162240 |
| 88 | Ga0209784_101002 | 3300025224 | Bacteria | 5161 |
| 89 | Ga0209566_100002 | 3300025225 | Bacteria | 2614868 |
| 90 | Ga0209566_100023 | 3300025225 | Bacteria | 396571 |
| 91 | Ga0209674_100008 | 3300025226 | Bacteria | 1076909 |
| 92 | Ga0209674_100040 | 3300025226 | Bacteria | 396571 |
| 93 | Ga0209147_100002 | 3300025229 | Bacteria | 2158988 |
| 94 | Ga0209563_100004 | 3300025230 | Bacteria | 1814108 |
| 95 | Ga0209563_100096 | 3300025230 | Bacteria | 162240 |
| 96 | Ga0207427_100948 | 3300025231 | Bacteria | 12347 |
| 97 | Ga0209437_100146 | 3300025233 | Bacteria | 162240 |
| 98 | Ga0209258_100002 | 3300025242 | Bacteria | 2158988 |
| 99 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 100 | Ga0207425_1000304 | 3300025245 | Bacteria | 35899 |
| 101 | Ga0209677_100009 | 3300025253 | Bacteria | 749530 |
| 102 | Ga0209677_100058 | 3300025253 | Bacteria | 162240 |
| 103 | Ga0209148_1002765 | 3300025254 | Bacteria | 5528 |
| 104 | Ga0209759_1000030 | 3300025256 | Bacteria | 285649 |
| 105 | Ga0209759_1001579 | 3300025256 | Bacteria | 12396 |
| 106 | Ga0209759_1009803 | 3300025256 | Bacteria | 2866 |
| 107 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 108 | Ga0209129_1001453 | 3300025258 | Bacteria | 13213 |
| 109 | Ga0209233_1000159 | 3300025261 | Bacteria | 162240 |
| 110 | Ga0209233_1026630 | 3300025261 | Bacteria | 1410 |
| 111 | Ga0209565_1000902 | 3300025263 | Bacteria | 16045 |
| 112 | Ga0209565_1001159 | 3300025263 | Bacteria | 12725 |
| 113 | Ga0209565_1002038 | 3300025263 | Bacteria | 7780 |
| 114 | Ga0209565_1004668 | 3300025263 | Bacteria | 4122 |
| 115 | Ga0209455_1000021 | 3300025272 | Bacteria | 699993 |
| 116 | Ga0209130_1000507 | 3300025284 | Bacteria | 39512 |
| 117 | Ga0209130_1001852 | 3300025284 | Bacteria | 12138 |
| 118 | Ga0209675_1000769 | 3300025291 | Bacteria | 21492 |
| 119 | Ga0209675_1001368 | 3300025291 | Bacteria | 14271 |
| 120 | Ga0209564_1001707 | 3300025295 | Bacteria | 20758 |
| 121 | Ga0209564_1005199 | 3300025295 | Bacteria | 7536 |
| 122 | Ga0209564_1007977 | 3300025295 | Bacteria | 5326 |
| 123 | Ga0209758_1000073 | 3300025297 | Bacteria | 276262 |
| 124 | Ga0209050_1000046 | 3300025298 | Bacteria | 386466 |
| 125 | Ga0209256_1000467 | 3300025299 | Bacteria | 60978 |
| 126 | Ga0209256_1002001 | 3300025299 | Bacteria | 18236 |
| 127 | Ga0207426_1000125 | 3300025302 | Bacteria | 217504 |
| 128 | Ga0207426_1001239 | 3300025302 | Bacteria | 22460 |
| 129 | Ga0207426_1065226 | 3300025302 | Bacteria | 1033 |
| 130 | Ga0209051_1018958 | 3300025303 | Bacteria | 3023 |
| 131 | Ga0209257_1000068 | 3300025304 | Bacteria | 341291 |
| 132 | Ga0207647_10179766 | 3300025904 | Bacteria | 1229 |
| 133 | Ga0207695_10000729 | 3300025913 | Bacteria | 63923 |
| 134 | Ga0207695_10016554 | 3300025913 | Bacteria | 8620 |
| 135 | Ga0207695_10510095 | 3300025913 | Bacteria | 1084 |
| 136 | Ga0207671_10301878 | 3300025914 | Bacteria | 1265 |
| 137 | Ga0207693_10261622 | 3300025915 | Bacteria | 1356 |
| 138 | Ga0207657_10002005 | 3300025919 | Bacteria | 22014 |
| 139 | Ga0207649_10000334 | 3300025920 | Bacteria | 35813 |
| 140 | Ga0207649_10008188 | 3300025920 | Bacteria | 5692 |
| 141 | Ga0207694_10000474 | 3300025924 | Bacteria | 36659 |
| 142 | Ga0207650_10227865 | 3300025925 | Bacteria | 1502 |
| 143 | Ga0207690_10001327 | 3300025932 | Bacteria | 15557 |
| 144 | Ga0207690_10055385 | 3300025932 | Bacteria | 2671 |
| 145 | Ga0207679_10000001 | 3300025945 | Bacteria | 777444 |
| 146 | Ga0207679_10015374 | 3300025945 | Bacteria | 5056 |
| 147 | Ga0207679_10215439 | 3300025945 | Bacteria | 1613 |
| 148 | Ga0207667_10104965 | 3300025949 | Bacteria | 2915 |
| 149 | Ga0207640_10000088 | 3300025981 | Bacteria | 72802 |
| 150 | Ga0207640_10069543 | 3300025981 | Bacteria | 2364 |
| 151 | Ga0207678_10000001 | 3300026067 | Bacteria | 433184 |
| 152 | Ga0207702_10000024 | 3300026078 | Bacteria | 187719 |
| 153 | Ga0207674_10012499 | 3300026116 | Bacteria | 9486 |
| 154 | Ga0207674_10149413 | 3300026116 | Bacteria | 2294 |
| 155 | Ga0307517_10002949 | 3300028786 | Eukaryota | 26903 |
| 156 | Ga0307515_10006247 | 3300028794 | Eukaryota | 23908 |
| 157 | Ga0307511_10004324 | 3300030521 | Eukaryota | 14501 |
| 158 | Ga0307512_10131488 | 3300030522 | Eukaryota | 1567 |
| 159 | Ga0316177_1045075 | 3300030731 | Bacteria | 5699 |
| 160 | Ga0316177_1061609 | 3300030731 | Bacteria | 2027 |
| 161 | Ga0316180_1180291 | 3300030736 | Bacteria | 1553 |
| 162 | Ga0316181_1266052 | 3300030744 | Bacteria | 1074 |
| 163 | Ga0316182_1006372 | 3300030745 | Bacteria | 7098 |
| 164 | Ga0316182_1229639 | 3300030745 | Bacteria | 744 |
| 165 | Ga0307513_10044260 | 3300031456 | Eukaryota | 4877 |
| 166 | Ga0307509_10055843 | 3300031507 | Eukaryota | 4193 |
| 167 | Ga0307408_100000471 | 3300031548 | Bacteria | 35204 |
| 168 | Ga0307408_100010708 | 3300031548 | Bacteria | 6049 |
| 169 | Ga0307408_100148318 | 3300031548 | Bacteria | 1849 |
| 170 | Ga0307508_10017445 | 3300031616 | Eukaryota | 6527 |
| 171 | Ga0307514_10003612 | 3300031649 | Eukaryota | 14713 |
| 172 | Ga0307516_10021295 | 3300031730 | Eukaryota | 6676 |
| 173 | Ga0307518_10036168 | 3300031838 | Bacteria | 3588 |
| 174 | Ga0307518_10051590 | 3300031838 | Eukaryota | 2989 |
| 175 | Ga0307412_10424486 | 3300031911 | Bacteria | 1088 |
| 176 | Ga0307416_100260964 | 3300032002 | Bacteria | 1693 |
| 177 | Ga0307416_100615349 | 3300032002 | Bacteria | 1167 |
| 178 | Ga0307414_10254560 | 3300032004 | Bacteria | 1461 |
| 179 | Ga0307507_10010750 | 3300033179 | Eukaryota | 11728 |
| 180 | Ga0307510_10001287 | 3300033180 | Eukaryota | 27361 |
| 181 | Ga0395899_0000473 | 3300037312 | Bacteria | 45449 |
| 182 | Ga0395899_0001163 | 3300037312 | Bacteria | 23230 |
| 183 | Ga0395899_0033403 | 3300037312 | Bacteria | 3863 |
| 184 | Ga0395900_0023490 | 3300037418 | Bacteria | 6310 |
| 185 | Ga0395900_0080789 | 3300037418 | Bacteria | 3341 |
| 186 | Ga0395900_1156177 | 3300037418 | Bacteria | 690 |
| 187 | Ga0395898_0430966 | 3300037466 | Bacteria | 1256 |
| 188 | Ga0395905_0000459 | 3300037471 | Bacteria | 57003 |
| 189 | Ga0395905_0002580 | 3300037471 | Bacteria | 19948 |
| 190 | Ga0395905_0189921 | 3300037471 | Bacteria | 1927 |
| 191 | Ga0395905_0256423 | 3300037471 | Bacteria | 1633 |
| 192 | Ga0395905_0300589 | 3300037471 | Bacteria | 1492 |
| 193 | Ga0395905_0462153 | 3300037471 | Bacteria | 1168 |
| 194 | Ga0395905_0881997 | 3300037471 | Bacteria | 798 |
| 195 | Ga0395901_0000533 | 3300038443 | Bacteria | 43906 |
| 196 | Ga0395901_0043187 | 3300038443 | Bacteria | 4676 |
| 197 | Ga0395901_0058917 | 3300038443 | Bacteria | 3995 |
| 198 | Ga0395901_0847825 | 3300038443 | Bacteria | 899 |
| 199 | Ga0436361_0080172 | 3300039447 | Bacteria | 39325 |
| 200 | Ga0436361_0185793 | 3300039447 | Bacteria | 6828 |
| 201 | Ga0436361_0222234 | 3300039447 | Bacteria | 19124 |
| 202 | Ga0436361_0458107 | 3300039447 | Bacteria | 5669 |
| 203 | Ga0436361_1082846 | 3300039447 | Bacteria | 3657 |
| 204 | Ga0439436_0058881 | 3300041404 | Bacteria | 1077 |
| 205 | Ga0450920_048174 | 3300042122 | Bacteria | 853 |
| 206 | Ga0466986_0474690 | 3300044650 | Bacteria | 708 |
| 207 | Ga0466969_0141975 | 3300044656 | Bacteria | 1109 |
| 208 | Ga0466972_0042176 | 3300044658 | Bacteria | 2220 |
| 209 | Ga0466972_0077899 | 3300044658 | Bacteria | 1578 |
| 210 | Ga0466978_0091367 | 3300044671 | Bacteria | 1896 |
| 211 | Ga0466965_0021997 | 3300044683 | Bacteria | 3073 |
| 212 | Ga0466966_0080591 | 3300044684 | Bacteria | 2027 |
| 213 | Ga0466966_0098595 | 3300044684 | Bacteria | 1809 |
| 214 | Ga0466961_0001383 | 3300044693 | Bacteria | 14990 |
| 215 | Ga0466964_0028264 | 3300044706 | Bacteria | 2208 |
| 216 | Ga0453684_0322630 | 3300044712 | Bacteria | 1748 |
| 217 | Ga0466968_0045163 | 3300044735 | Bacteria | 1868 |
| 218 | Ga0466970_0019885 | 3300044765 | Bacteria | 3484 |
| 219 | Ga0466970_0065027 | 3300044765 | Bacteria | 1956 |
| 220 | Ga0466970_0068583 | 3300044765 | Bacteria | 1905 |
| 221 | Ga0466970_0074379 | 3300044765 | Bacteria | 1829 |
| 222 | Ga0466957_0038958 | 3300044842 | Bacteria | 2866 |
| 223 | Ga0466959_0011953 | 3300045049 | Bacteria | 6259 |
| 224 | Ga0466959_0031492 | 3300045049 | Bacteria | 3923 |
| 225 | Ga0451576_0128031 | 3300045051 | Bacteria | 2646 |
| 226 | Ga0466958_0111661 | 3300045836 | Bacteria | 1707 |
| 227 | Ga0466967_0414218 | 3300045976 | Bacteria | 1312 |
| 228 | Ga0495617_031580 | 3300046452 | Bacteria | 1778 |
| 229 | Ga0495592_0006504 | 3300046454 | Bacteria | 8704 |
| 230 | Ga0495592_0100002 | 3300046454 | Bacteria | 2068 |
| 231 | Ga0495603_0013539 | 3300046455 | Bacteria | 4934 |
| 232 | Ga0495590_0000001 | 3300046457 | Bacteria | 762984 |
| 233 | Ga0495590_0010453 | 3300046457 | Bacteria | 3488 |
| 234 | Ga0495590_0082514 | 3300046457 | Bacteria | 1133 |
| 235 | Ga0495591_006093 | 3300046458 | Bacteria | 5416 |
| 236 | Ga0495629_0027438 | 3300046459 | Bacteria | 4041 |
| 237 | Ga0495638_0000086 | 3300046460 | Bacteria | 152781 |
| 238 | Ga0495638_0019285 | 3300046460 | Bacteria | 4512 |
| 239 | Ga0495638_0045046 | 3300046460 | Bacteria | 2777 |
| 240 | Ga0495638_0121834 | 3300046460 | Bacteria | 1540 |
| 241 | Ga0495638_0126705 | 3300046460 | Bacteria | 1504 |
| 242 | Ga0495638_0212249 | 3300046460 | Bacteria | 1086 |
| 243 | Ga0495638_0361046 | 3300046460 | Bacteria | 764 |
| 244 | Ga0495651_0011219 | 3300046462 | Bacteria | 6886 |
| 245 | Ga0495651_0053629 | 3300046462 | Bacteria | 3103 |
| 246 | Ga0495651_0188061 | 3300046462 | Bacteria | 1455 |
| 247 | Ga0495651_0199440 | 3300046462 | Bacteria | 1401 |
| 248 | Ga0495653_0032369 | 3300046463 | Bacteria | 4152 |
| 249 | Ga0495653_0040273 | 3300046463 | Bacteria | 3652 |
| 250 | Ga0495653_0061002 | 3300046463 | Bacteria | 2854 |
| 251 | Ga0495653_0084113 | 3300046463 | Bacteria | 2344 |
| 252 | Ga0495653_0541791 | 3300046463 | Bacteria | 721 |
| 253 | Ga0495653_0659655 | 3300046463 | Bacteria | 638 |
| 254 | Ga0495650_0000156 | 3300046471 | Bacteria | 155338 |
| 255 | Ga0495650_0000837 | 3300046471 | Bacteria | 37114 |
| 256 | Ga0495650_0007154 | 3300046471 | Bacteria | 6766 |
| 257 | Ga0495650_0047573 | 3300046471 | Bacteria | 1793 |
| 258 | Ga0495580_0027408 | 3300046472 | Bacteria | 4145 |
| 259 | Ga0495580_0028061 | 3300046472 | Bacteria | 4093 |
| 260 | Ga0495580_0057301 | 3300046472 | Bacteria | 2742 |
| 261 | Ga0495580_0063439 | 3300046472 | Bacteria | 2591 |
| 262 | Ga0495580_0256385 | 3300046472 | Bacteria | 1196 |
| 263 | Ga0495582_0030048 | 3300046473 | Bacteria | 2982 |
| 264 | Ga0495582_0074603 | 3300046473 | Bacteria | 1878 |
| 265 | Ga0495605_0000168 | 3300046474 | Bacteria | 82889 |
| 266 | Ga0495605_0049845 | 3300046474 | Bacteria | 2044 |
| 267 | Ga0495639_0095302 | 3300046475 | Bacteria | 1400 |
| 268 | Ga0495664_0035119 | 3300046477 | Bacteria | 2951 |
| 269 | Ga0495664_0683716 | 3300046477 | Bacteria | 607 |
| 270 | Ga0495584_0001459 | 3300046491 | Bacteria | 14208 |
| 271 | Ga0495584_0029037 | 3300046491 | Bacteria | 2803 |
| 272 | Ga0495584_0420607 | 3300046491 | Bacteria | 679 |
| 273 | Ga0495585_0003521 | 3300046492 | Bacteria | 10552 |
| 274 | Ga0495585_0016695 | 3300046492 | Bacteria | 4253 |
| 275 | Ga0495585_0185972 | 3300046492 | Bacteria | 1065 |
| 276 | Ga0495585_0243107 | 3300046492 | Bacteria | 900 |
| 277 | Ga0495596_0012787 | 3300046500 | Bacteria | 3580 |
| 278 | Ga0495596_0166023 | 3300046500 | Bacteria | 858 |
| 279 | Ga0495607_0010595 | 3300046501 | Bacteria | 6187 |
| 280 | Ga0495607_0047035 | 3300046501 | Bacteria | 2529 |
| 281 | Ga0495607_0064211 | 3300046501 | Bacteria | 2074 |
| 282 | Ga0495583_0000177 | 3300046506 | Bacteria | 108704 |
| 283 | Ga0495583_0000532 | 3300046506 | Bacteria | 53953 |
| 284 | Ga0495583_0001113 | 3300046506 | Bacteria | 29722 |
| 285 | Ga0495583_0001849 | 3300046506 | Bacteria | 19724 |
| 286 | Ga0495583_0013697 | 3300046506 | Bacteria | 4506 |
| 287 | Ga0495606_0000864 | 3300046507 | Bacteria | 45347 |
| 288 | Ga0495606_0007630 | 3300046507 | Bacteria | 9611 |
| 289 | Ga0495606_0008551 | 3300046507 | Bacteria | 8860 |
| 290 | Ga0495606_0018168 | 3300046507 | Bacteria | 5285 |
| 291 | Ga0495606_0032639 | 3300046507 | Bacteria | 3603 |
| 292 | Ga0495606_0053426 | 3300046507 | Bacteria | 2621 |
| 293 | Ga0495606_0132346 | 3300046507 | Bacteria | 1481 |
| 294 | Ga0495608_0000977 | 3300046511 | Bacteria | 20193 |
| 295 | Ga0495608_0054657 | 3300046511 | Bacteria | 2639 |
| 296 | Ga0495608_0096319 | 3300046511 | Bacteria | 1911 |
| 297 | Ga0495610_0000003 | 3300046512 | Bacteria | 1203910 |
| 298 | Ga0495610_0002840 | 3300046512 | Bacteria | 14090 |
| 299 | Ga0495610_0010041 | 3300046512 | Bacteria | 5914 |
| 300 | Ga0495616_0028164 | 3300046513 | Bacteria | 2975 |
| 301 | Ga0495616_0045970 | 3300046513 | Bacteria | 2206 |
| 302 | Ga0495618_0006045 | 3300046514 | Bacteria | 7350 |
| 303 | Ga0495618_0006680 | 3300046514 | Bacteria | 6992 |
| 304 | Ga0495618_0260017 | 3300046514 | Bacteria | 1087 |
| 305 | Ga0495620_0042075 | 3300046515 | Bacteria | 1998 |
| 306 | Ga0495628_0000612 | 3300046516 | Bacteria | 32753 |
| 307 | Ga0495628_0001590 | 3300046516 | Bacteria | 20832 |
| 308 | Ga0495628_0038220 | 3300046516 | Bacteria | 3843 |
| 309 | Ga0495628_0049377 | 3300046516 | Bacteria | 3332 |
| 310 | Ga0495628_0080657 | 3300046516 | Bacteria | 2528 |
| 311 | Ga0495630_0037486 | 3300046517 | Bacteria | 3625 |
| 312 | Ga0495630_0113181 | 3300046517 | Bacteria | 2055 |
| 313 | Ga0495630_0167459 | 3300046517 | Bacteria | 1673 |
| 314 | Ga0495637_0033494 | 3300046520 | Bacteria | 2256 |
| 315 | Ga0495643_0000123 | 3300046522 | Bacteria | 124936 |
| 316 | Ga0495643_0006019 | 3300046522 | Bacteria | 8091 |
| 317 | Ga0495643_0012364 | 3300046522 | Bacteria | 5152 |
| 318 | Ga0495644_0000892 | 3300046523 | Bacteria | 12360 |
| 319 | Ga0495644_0001552 | 3300046523 | Bacteria | 9368 |
| 320 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 321 | Ga0495648_0000565 | 3300046524 | Bacteria | 39546 |
| 322 | Ga0495648_0001518 | 3300046524 | Bacteria | 22730 |
| 323 | Ga0495648_0011102 | 3300046524 | Bacteria | 6817 |
| 324 | Ga0495648_0016985 | 3300046524 | Bacteria | 5222 |
| 325 | Ga0495648_0046851 | 3300046524 | Bacteria | 2677 |
| 326 | Ga0495648_0063600 | 3300046524 | Bacteria | 2177 |
| 327 | Ga0495648_0087636 | 3300046524 | Bacteria | 1752 |
| 328 | Ga0495648_0111419 | 3300046524 | Bacteria | 1488 |
| 329 | Ga0495666_0001182 | 3300046526 | Bacteria | 12563 |
| 330 | Ga0495666_0053327 | 3300046526 | Bacteria | 1941 |
| 331 | Ga0495642_0002613 | 3300046528 | Bacteria | 7263 |
| 332 | Ga0495642_0041788 | 3300046528 | Bacteria | 1865 |
| 333 | Ga0495642_0049764 | 3300046528 | Bacteria | 1722 |
| 334 | Ga0495652_0002873 | 3300046529 | Bacteria | 17371 |
| 335 | Ga0495652_0003510 | 3300046529 | Bacteria | 15428 |
| 336 | Ga0495652_0135377 | 3300046529 | Bacteria | 1944 |
| 337 | Ga0495654_0003818 | 3300046530 | Bacteria | 9115 |
| 338 | Ga0495654_0096448 | 3300046530 | Bacteria | 1366 |
| 339 | Ga0495665_0110481 | 3300046531 | Bacteria | 1442 |
| 340 | Ga0495665_0163969 | 3300046531 | Bacteria | 1158 |
| 341 | Ga0495640_0504360 | 3300046533 | Bacteria | 736 |
| 342 | Ga0495586_0122935 | 3300046535 | Bacteria | 1450 |
| 343 | Ga0495587_0062522 | 3300046536 | Bacteria | 2179 |
| 344 | Ga0495587_0436074 | 3300046536 | Bacteria | 726 |
| 345 | Ga0495609_0000479 | 3300046538 | Bacteria | 32080 |
| 346 | Ga0495609_0018085 | 3300046538 | Bacteria | 3269 |
| 347 | Ga0495609_0022768 | 3300046538 | Bacteria | 2886 |
| 348 | Ga0495609_0028476 | 3300046538 | Bacteria | 2549 |
| 349 | Ga0495609_0103380 | 3300046538 | Bacteria | 1233 |
| 350 | Ga0495621_0256799 | 3300046539 | Bacteria | 715 |
| 351 | Ga0495597_0000208 | 3300046542 | Bacteria | 53439 |
| 352 | Ga0495597_0002211 | 3300046542 | Bacteria | 12758 |
| 353 | Ga0495597_0004990 | 3300046542 | Bacteria | 7122 |
| 354 | Ga0495597_0005042 | 3300046542 | Bacteria | 7068 |
| 355 | Ga0495597_0030327 | 3300046542 | Bacteria | 2465 |
| 356 | Ga0495597_0051227 | 3300046542 | Bacteria | 1821 |
| 357 | Ga0495597_0082665 | 3300046542 | Bacteria | 1372 |
| 358 | Ga0495645_0113089 | 3300046543 | Bacteria | 1919 |
| 359 | Ga0495645_0295426 | 3300046543 | Bacteria | 1060 |
| 360 | Ga0495645_0316595 | 3300046543 | Bacteria | 1014 |
| 361 | Ga0495622_0000028 | 3300046557 | Bacteria | 133197 |
| 362 | Ga0495622_0002020 | 3300046557 | Bacteria | 9917 |
| 363 | Ga0495622_0002846 | 3300046557 | Bacteria | 8255 |
| 364 | Ga0495622_0121546 | 3300046557 | Bacteria | 1192 |
| 365 | Ga0495622_0202054 | 3300046557 | Bacteria | 885 |
| 366 | Ga0495633_0000272 | 3300046558 | Bacteria | 60512 |
| 367 | Ga0495633_0002822 | 3300046558 | Bacteria | 11996 |
| 368 | Ga0495633_0008566 | 3300046558 | Bacteria | 5747 |
| 369 | Ga0495633_0021198 | 3300046558 | Bacteria | 3253 |
| 370 | Ga0495633_0106362 | 3300046558 | Bacteria | 1301 |
| 371 | Ga0495633_0319728 | 3300046558 | Bacteria | 704 |
| 372 | Ga0495656_0009086 | 3300046615 | Bacteria | 3567 |
| 373 | Ga0495656_0049841 | 3300046615 | Bacteria | 1785 |
| 374 | Ga0495668_0000151 | 3300046616 | Bacteria | 105466 |
| 375 | Ga0495668_0001575 | 3300046616 | Bacteria | 21547 |
| 376 | Ga0495668_0275234 | 3300046616 | Bacteria | 922 |
| 377 | Ga0495634_0009348 | 3300046642 | Bacteria | 7232 |
| 378 | Ga0495611_0001352 | 3300046648 | Bacteria | 12401 |
| 379 | Ga0495611_0008148 | 3300046648 | Bacteria | 4445 |
| 380 | Ga0495611_0270815 | 3300046648 | Bacteria | 785 |
| 381 | Ga0495625_0000480 | 3300046660 | Bacteria | 59788 |
| 382 | Ga0495625_0003732 | 3300046660 | Bacteria | 14830 |
| 383 | Ga0495625_0015020 | 3300046660 | Bacteria | 6152 |
| 384 | Ga0495625_0052830 | 3300046660 | Bacteria | 2908 |
| 385 | Ga0495625_0137311 | 3300046660 | Bacteria | 1652 |
| 386 | Ga0495635_0020613 | 3300046663 | Bacteria | 4591 |
| 387 | Ga0495635_0031650 | 3300046663 | Bacteria | 3671 |
| 388 | Ga0495659_0000971 | 3300046664 | Bacteria | 10089 |
| 389 | Ga0495659_0029997 | 3300046664 | Bacteria | 1890 |
| 390 | Ga0495661_0026684 | 3300046665 | Bacteria | 3718 |
| 391 | Ga0495661_0030990 | 3300046665 | Bacteria | 3400 |
| 392 | Ga0495661_0041411 | 3300046665 | Bacteria | 2850 |
| 393 | Ga0495661_0077657 | 3300046665 | Bacteria | 1923 |
| 394 | Ga0495661_0248376 | 3300046665 | Bacteria | 909 |
| 395 | Ga0495657_0071118 | 3300046675 | Bacteria | 2272 |
| 396 | Ga0495657_0114487 | 3300046675 | Bacteria | 1705 |
| 397 | Ga0495599_0004330 | 3300046678 | Bacteria | 8398 |
| 398 | Ga0495599_0031959 | 3300046678 | Bacteria | 3303 |
| 399 | Ga0495599_0099824 | 3300046678 | Bacteria | 1809 |
| 400 | Ga0495623_0002700 | 3300046679 | Bacteria | 11722 |
| 401 | Ga0495623_0021047 | 3300046679 | Bacteria | 4213 |
| 402 | Ga0495623_0045220 | 3300046679 | Bacteria | 2797 |
| 403 | Ga0495623_0129793 | 3300046679 | Bacteria | 1510 |
| 404 | Ga0495646_0001994 | 3300046680 | Bacteria | 12336 |
| 405 | Ga0495646_0012009 | 3300046680 | Bacteria | 5510 |
| 406 | Ga0495646_0053438 | 3300046680 | Bacteria | 2435 |
| 407 | Ga0495646_0095592 | 3300046680 | Bacteria | 1709 |
| 408 | Ga0495646_0103192 | 3300046680 | Bacteria | 1632 |
| 409 | Ga0495613_0093199 | 3300046689 | Bacteria | 2180 |
| 410 | Ga0495613_0268721 | 3300046689 | Bacteria | 1187 |
| 411 | Ga0495624_0008366 | 3300046690 | Bacteria | 7221 |
| 412 | Ga0495624_0011605 | 3300046690 | Bacteria | 6052 |
| 413 | Ga0495624_0013694 | 3300046690 | Bacteria | 5522 |
| 414 | Ga0495624_0020813 | 3300046690 | Bacteria | 4358 |
| 415 | Ga0495624_0080019 | 3300046690 | Bacteria | 2025 |
| 416 | Ga0495670_0000597 | 3300046691 | Bacteria | 17240 |
| 417 | Ga0495670_0013613 | 3300046691 | Bacteria | 3999 |
| 418 | Ga0495670_0282728 | 3300046691 | Bacteria | 887 |
| 419 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 420 | Ga0495671_0000108 | 3300046692 | Bacteria | 74169 |
| 421 | Ga0495671_0010859 | 3300046692 | Bacteria | 5033 |
| 422 | Ga0495671_0029988 | 3300046692 | Bacteria | 2788 |
| 423 | Ga0495671_0055844 | 3300046692 | Bacteria | 1956 |
| 424 | Ga0495671_0091672 | 3300046692 | Bacteria | 1487 |
| 425 | Ga0495671_0102623 | 3300046692 | Bacteria | 1397 |
| 426 | Ga0495649_0085067 | 3300046694 | Bacteria | 1688 |
| 427 | Ga0495649_0106694 | 3300046694 | Bacteria | 1486 |
| 428 | Ga0495649_0205872 | 3300046694 | Bacteria | 1021 |
| 429 | Ga0495649_0349414 | 3300046694 | Bacteria | 747 |
| 430 | Ga0495649_0385938 | 3300046694 | Bacteria | 704 |
| 431 | Ga0495589_0014007 | 3300046794 | Bacteria | 4135 |
| 432 | Ga0495589_0125073 | 3300046794 | Bacteria | 1236 |
| 433 | Ga0495600_0000837 | 3300046809 | Bacteria | 16388 |
| 434 | Ga0495600_0013225 | 3300046809 | Bacteria | 5180 |
| 435 | Ga0495600_0175892 | 3300046809 | Bacteria | 1380 |
| 436 | Ga0495660_0000705 | 3300046810 | Bacteria | 25643 |
| 437 | Ga0495660_0013800 | 3300046810 | Bacteria | 4682 |
| 438 | Ga0495660_0021450 | 3300046810 | Bacteria | 3699 |
| 439 | Ga0495660_0063135 | 3300046810 | Bacteria | 1984 |
| 440 | Ga0495581_0087207 | 3300047315 | Bacteria | 1809 |
| 441 | Ga0495604_0001208 | 3300047317 | Bacteria | 21323 |
| 442 | Ga0495604_0014180 | 3300047317 | Bacteria | 6353 |
| 443 | Ga0495604_0019556 | 3300047317 | Bacteria | 5420 |
| 444 | Ga0495604_0032570 | 3300047317 | Bacteria | 4130 |
| 445 | Ga0495636_0005094 | 3300047318 | Bacteria | 5162 |
| 446 | Ga0495636_0013359 | 3300047318 | Bacteria | 3258 |
| 447 | Ga0495636_0076626 | 3300047318 | Bacteria | 1434 |
| 448 | Ga0495674_0042230 | 3300047319 | Bacteria | 4068 |
| 449 | Ga0495674_0064381 | 3300047319 | Bacteria | 3187 |
| 450 | Ga0495674_0064980 | 3300047319 | Bacteria | 3170 |
| 451 | Ga0495674_0082969 | 3300047319 | Bacteria | 2748 |
| 452 | Ga0495672_0000181 | 3300047320 | Bacteria | 91278 |
| 453 | Ga0495672_0008922 | 3300047320 | Bacteria | 7321 |
| 454 | Ga0495672_0012839 | 3300047320 | Bacteria | 5815 |
| 455 | Ga0495672_0087997 | 3300047320 | Bacteria | 1713 |
| 456 | Ga0495676_0048758 | 3300047321 | Bacteria | 3411 |
| 457 | Ga0495676_0063298 | 3300047321 | Bacteria | 2884 |
| 458 | Ga0495680_0073946 | 3300047322 | Bacteria | 2589 |
| 459 | Ga0495680_0077519 | 3300047322 | Bacteria | 2517 |
| 460 | Ga0495683_0008902 | 3300047323 | Bacteria | 5356 |
| 461 | Ga0495683_0013406 | 3300047323 | Bacteria | 4287 |
| 462 | Ga0495683_0146551 | 3300047323 | Bacteria | 1102 |
| 463 | Ga0495683_0198685 | 3300047323 | Bacteria | 905 |
| 464 | Ga0495687_004715 | 3300047443 | Bacteria | 9036 |
| 465 | Ga0495687_006929 | 3300047443 | Bacteria | 6817 |
| 466 | Ga0495687_023617 | 3300047443 | Bacteria | 2934 |
| 467 | Ga0495687_043516 | 3300047443 | Bacteria | 1955 |
| 468 | Ga0495687_100726 | 3300047443 | Bacteria | 1084 |
| 469 | Ga0495675_0004214 | 3300047444 | Bacteria | 8700 |
| 470 | Ga0495675_0035036 | 3300047444 | Bacteria | 3206 |
| 471 | Ga0495675_0121177 | 3300047444 | Bacteria | 1629 |
| 472 | Ga0495677_0108530 | 3300047445 | Bacteria | 1054 |
| 473 | Ga0495679_000214 | 3300047446 | Bacteria | 49621 |
| 474 | Ga0495679_003040 | 3300047446 | Bacteria | 8245 |
| 475 | Ga0495679_017601 | 3300047446 | Bacteria | 2555 |
| 476 | Ga0495685_000012 | 3300047447 | Bacteria | 80496 |
| 477 | Ga0495673_0000016 | 3300047469 | Bacteria | 580643 |
| 478 | Ga0495673_0000188 | 3300047469 | Bacteria | 99425 |
| 479 | Ga0495673_0018203 | 3300047469 | Bacteria | 3548 |
| 480 | Ga0495673_0040705 | 3300047469 | Bacteria | 2096 |
| 481 | Ga0495673_0065863 | 3300047469 | Bacteria | 1537 |
| 482 | Ga0495684_0104358 | 3300047471 | Bacteria | 2142 |
| 483 | Ga0495686_0000380 | 3300047472 | Bacteria | 71038 |
| 484 | Ga0495686_0003712 | 3300047472 | Bacteria | 13033 |
| 485 | Ga0495686_0522322 | 3300047472 | Bacteria | 623 |
| 486 | Ga0495593_0005003 | 3300047673 | Bacteria | 7845 |
| 487 | Ga0495593_0104595 | 3300047673 | Bacteria | 1449 |
| 488 | Ga0495602_0019692 | 3300048088 | Bacteria | 6688 |
| 489 | Ga0495602_0029641 | 3300048088 | Bacteria | 5204 |
| 490 | Ga0495602_0057703 | 3300048088 | Bacteria | 3403 |
| 491 | Ga0495602_0059801 | 3300048088 | Bacteria | 3324 |
| 492 | Ga0495602_0167345 | 3300048088 | Bacteria | 1709 |
| 493 | Ga0495614_0020543 | 3300048089 | Bacteria | 2854 |
| 494 | Ga0496100_0010876 | 3300048903 | Bacteria | 5164 |
| 495 | Ga0496100_0381858 | 3300048903 | Bacteria | 1070 |
| 496 | Ga0496101_0001460 | 3300048904 | Bacteria | 14113 |
| 497 | Ga0496102_0000707 | 3300048905 | Bacteria | 33079 |
| 498 | Ga0496102_0004487 | 3300048905 | Bacteria | 11784 |
| 499 | Ga0496102_0018558 | 3300048905 | Bacteria | 6115 |
| 500 | Ga0496102_0066325 | 3300048905 | Bacteria | 3308 |
| 501 | Ga0496102_0111602 | 3300048905 | Bacteria | 2549 |
| 502 | Ga0496102_0394789 | 3300048905 | Bacteria | 1301 |
| 503 | Ga0496102_1102843 | 3300048905 | Bacteria | 713 |
| 504 | Ga0496103_0004588 | 3300048906 | Bacteria | 8365 |
| 505 | Ga0496103_0020700 | 3300048906 | Bacteria | 3954 |
| 506 | Ga0496103_0086791 | 3300048906 | Bacteria | 1972 |
| 507 | Ga0496103_0177532 | 3300048906 | Unclassified | 1368 |
| 508 | Ga0496104_0065700 | 3300048907 | Bacteria | 3443 |
| 509 | Ga0496105_0026370 | 3300048908 | Bacteria | 4740 |
| 510 | Ga0496105_0170970 | 3300048908 | Bacteria | 1781 |
| 511 | Ga0496105_0766991 | 3300048908 | Bacteria | 735 |
| 512 | Ga0496106_0286407 | 3300048909 | Bacteria | 1320 |
| 513 | Ga0496106_0629474 | 3300048909 | Bacteria | 858 |
| 514 | Ga0496106_1250164 | 3300048909 | Bacteria | 578 |
| 515 | Ga0496107_0351864 | 3300048910 | Bacteria | 1096 |
| 516 | Ga0496107_0553788 | 3300048910 | Bacteria | 852 |
| 517 | Ga0496109_0155046 | 3300048912 | Bacteria | 2145 |
| 518 | Ga0496109_0266866 | 3300048912 | Bacteria | 1613 |
| 519 | Ga0496109_0319202 | 3300048912 | Bacteria | 1466 |
| 520 | Ga0496110_0073716 | 3300048913 | Bacteria | 3029 |
| 521 | Ga0496110_0151202 | 3300048913 | Bacteria | 2102 |
| 522 | Ga0496111_0216067 | 3300048914 | Bacteria | 1424 |
| 523 | Ga0496112_0048110 | 3300048915 | Bacteria | 4182 |
| 524 | Ga0496113_0009991 | 3300048916 | Bacteria | 6256 |
| 525 | Ga0496113_0858731 | 3300048916 | Bacteria | 719 |
| 526 | Ga0496114_0170251 | 3300048917 | Bacteria | 1898 |
| 527 | Ga0496114_0725604 | 3300048917 | Bacteria | 870 |
| 528 | Ga0496114_1306630 | 3300048917 | Bacteria | 612 |
| 529 | Ga0496115_0300638 | 3300048918 | Bacteria | 1315 |
| 530 | Ga0496116_0184601 | 3300048919 | Bacteria | 1112 |
| 531 | Ga0496116_0216141 | 3300048919 | Bacteria | 988 |
| 532 | Ga0496117_0000589 | 3300048920 | Bacteria | 59852 |
| 533 | Ga0496117_0057428 | 3300048920 | Bacteria | 2703 |
| 534 | Ga0496117_0145304 | 3300048920 | Bacteria | 1413 |
| 535 | Ga0496118_0001182 | 3300048921 | Bacteria | 40316 |
| 536 | Ga0496118_0040248 | 3300048921 | Bacteria | 3718 |
| 537 | Ga0496119_0082875 | 3300048922 | Bacteria | 1843 |
| 538 | Ga0496120_0059718 | 3300048923 | Bacteria | 2136 |
| 539 | Ga0496120_0257976 | 3300048923 | Bacteria | 815 |
| 540 | Ga0496121_0003626 | 3300048924 | Bacteria | 21747 |
| 541 | Ga0496121_0119168 | 3300048924 | Bacteria | 1996 |
| 542 | Ga0496122_0071160 | 3300048925 | Bacteria | 2480 |
| 543 | Ga0496122_0080743 | 3300048925 | Bacteria | 2266 |
| 544 | Ga0496122_0148499 | 3300048925 | Bacteria | 1452 |
| 545 | Ga0496123_0003912 | 3300048926 | Bacteria | 16190 |
| 546 | Ga0496123_0403841 | 3300048926 | Bacteria | 621 |
| 547 | Ga0496124_0111582 | 3300048927 | Bacteria | 2200 |
| 548 | Ga0496124_0159647 | 3300048927 | Bacteria | 1759 |
| 549 | Ga0496124_0368154 | 3300048927 | Bacteria | 1010 |
| 550 | Ga0496125_0023589 | 3300048928 | Bacteria | 5675 |
| 551 | Ga0496126_0952676 | 3300048929 | Bacteria | 647 |
| 552 | Ga0496126_0966263 | 3300048929 | Bacteria | 641 |
| 553 | Ga0495678_000313 | 3300049459 | Bacteria | 51964 |
| 554 | Ga0495678_016878 | 3300049459 | Bacteria | 3322 |
| 555 | Ga0495678_028632 | 3300049459 | Bacteria | 2348 |
| 556 | Ga0495678_114124 | 3300049459 | Bacteria | 917 |
| 557 | Ga0495678_116120 | 3300049459 | Bacteria | 905 |
| 558 | Ga0495682_0000879 | 3300049460 | Bacteria | 18626 |
| 559 | Ga0495682_0020496 | 3300049460 | Bacteria | 2482 |
| 560 | Ga0495682_0138233 | 3300049460 | Bacteria | 870 |
| 561 | Ga0501034_0190716 | 3300049571 | Bacteria | 2012 |
| 562 | Ga0501227_043109 | 3300049665 | Bacteria | 1120 |
| 563 | Ga0501233_044232 | 3300049668 | Bacteria | 1058 |
| 564 | Ga0501269_000223 | 3300049766 | Bacteria | 16628 |
| 565 | Ga0501279_001408 | 3300049775 | Bacteria | 3143 |
| 566 | nmdc:mga03683_45233_c1 | 3300050489 | Bacteria | 1821 |
| 567 | nmdc:mga03n38_23196_c1 | 3300050490 | Bacteria | 2521 |
| 568 | Ga0495601_0014286 | 3300053077 | Bacteria | 4783 |
| 569 | Ga0500610_0009979 | 3300053079 | Eukaryota | 4247 |
| 570 | Ga0500578_0016611 | 3300053086 | Eukaryota | 4728 |
| 571 | Ga0500644_0085750 | 3300053088 | Eukaryota | 1168 |
| 572 | Ga0500581_003822 | 3300053089 | Eukaryota | 6819 |
| 573 | Ga0500647_0002520 | 3300053091 | Eukaryota | 6857 |
| 574 | Ga0500583_0032061 | 3300053092 | Eukaryota | 2316 |
| 575 | Ga0500583_0171453 | 3300053092 | Bacteria | 1081 |
| 576 | Ga0500651_0000973 | 3300053093 | Eukaryota | 14089 |
| 577 | Ga0500566_0117908 | 3300053094 | Eukaryota | 1434 |
| 578 | Ga0500640_003358 | 3300053095 | Eukaryota | 5570 |
| 579 | Ga0500648_073316 | 3300053097 | Eukaryota | 1933 |
| 580 | Ga0500650_0002451 | 3300053098 | Eukaryota | 6112 |
| 581 | Ga0500654_003531 | 3300053099 | Eukaryota | 11137 |
| 582 | Ga0500660_001827 | 3300053100 | Eukaryota | 10533 |
| 583 | Ga0500553_000074 | 3300053101 | Eukaryota | 24889 |
| 584 | Ga0500556_0037853 | 3300053104 | Eukaryota | 1680 |
| 585 | Ga0500557_026577 | 3300053105 | Eukaryota | 1714 |
| 586 | Ga0500558_000689 | 3300053106 | Eukaryota | 8300 |
| 587 | Ga0500569_012791 | 3300053109 | Eukaryota | 2038 |
| 588 | Ga0500571_003220 | 3300053110 | Eukaryota | 8339 |
| 589 | Ga0500572_129445 | 3300053111 | Bacteria | 819 |
| 590 | Ga0500575_000537 | 3300053112 | Eukaryota | 6814 |
| 591 | Ga0500580_020038 | 3300053113 | Eukaryota | 2785 |
| 592 | Ga0500591_000140 | 3300053115 | Eukaryota | 17278 |
| 593 | Ga0500593_005593 | 3300053117 | Eukaryota | 4971 |
| 594 | Ga0500594_0038473 | 3300053118 | Bacteria | 1296 |
| 595 | Ga0500595_001034 | 3300053119 | Bacteria | 15528 |
| 596 | Ga0500597_010458 | 3300053120 | Eukaryota | 3314 |
| 597 | Ga0500608_010157 | 3300053122 | Eukaryota | 4031 |
| 598 | Ga0500614_026292 | 3300053123 | Eukaryota | 1391 |
| 599 | Ga0500617_011362 | 3300053124 | Eukaryota | 3715 |
| 600 | Ga0500621_001981 | 3300053126 | Eukaryota | 5162 |
| 601 | Ga0500623_027327 | 3300053127 | Eukaryota | 2958 |
| 602 | Ga0500626_003298 | 3300053128 | Eukaryota | 5865 |
| 603 | Ga0500628_082209 | 3300053129 | Eukaryota | 826 |
| 604 | Ga0500652_002535 | 3300053131 | Eukaryota | 5507 |
| 605 | Ga0500658_0186005 | 3300053134 | Eukaryota | 947 |
| 606 | Ga0500659_0009475 | 3300053135 | Eukaryota | 5350 |
| 607 | Ga0500559_0412869 | 3300053136 | Bacteria | 627 |
| 608 | Ga0500564_000460 | 3300053138 | Eukaryota | 11876 |
| 609 | Ga0500573_0004519 | 3300053140 | Eukaryota | 7350 |
| 610 | Ga0500574_000414 | 3300053141 | Bacteria | 5389 |
| 611 | Ga0500579_005172 | 3300053143 | Eukaryota | 7993 |
| 612 | Ga0500585_000271 | 3300053144 | Eukaryota | 6307 |
| 613 | Ga0500586_000675 | 3300053145 | Bacteria | 6982 |
| 614 | Ga0500586_005090 | 3300053145 | Bacteria | 3298 |
| 615 | Ga0500586_122489 | 3300053145 | Eukaryota | 904 |
| 616 | Ga0500588_0013584 | 3300053146 | Eukaryota | 2046 |
| 617 | Ga0500589_013853 | 3300053147 | Eukaryota | 3564 |
| 618 | Ga0500590_001873 | 3300053148 | Eukaryota | 8952 |
| 619 | Ga0500600_0014131 | 3300053149 | Eukaryota | 4856 |
| 620 | Ga0500619_001380 | 3300053154 | Bacteria | 4270 |
| 621 | Ga0500619_010793 | 3300053154 | Eukaryota | 2326 |
| 622 | Ga0500620_108518 | 3300053155 | Eukaryota | 972 |
| 623 | Ga0500622_0052661 | 3300053156 | Eukaryota | 2092 |
| 624 | Ga0500627_0021916 | 3300053158 | Eukaryota | 2584 |
| 625 | Ga0500630_000154 | 3300053159 | Eukaryota | 24903 |
| 626 | Ga0500633_0032782 | 3300053160 | Eukaryota | 1690 |
| 627 | Ga0500634_0003669 | 3300053161 | Eukaryota | 6908 |
| 628 | Ga0500639_052102 | 3300053163 | Eukaryota | 2130 |
| 629 | Ga0500636_0047670 | 3300053177 | Eukaryota | 2523 |
| 630 | Ga0500637_0249207 | 3300053178 | Eukaryota | 991 |
| 631 | Ga0500649_077055 | 3300053722 | Eukaryota | 1364 |
| 632 | Ga0500567_006289 | 3300053723 | Eukaryota | 5539 |
| 633 | Ga0500570_004269 | 3300053724 | Eukaryota | 7493 |
| 634 | Ga0500576_001310 | 3300053725 | Eukaryota | 8209 |
| 635 | Ga0500584_038898 | 3300053726 | Eukaryota | 2187 |
| 636 | Ga0500657_000766 | 3300053728 | Eukaryota | 10977 |
| 637 | Ga0500625_000446 | 3300053729 | Eukaryota | 11030 |
| 638 | Ga0500565_030602 | 3300053734 | Eukaryota | 706 |
| 639 | Ga0466962_0088242 | 3300061719 | Bacteria | 1485 |
| 640 | Ga0466962_0149709 | 3300061719 | Bacteria | 1132 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005518 | Ga0070699_100768724 | Ga0070699_1007687242 | 160 |
| 2 | 3300005578 | Ga0068854_100015327 | Ga0068854_1000153272 | 163 |
| 3 | 3300009093 | Ga0105240_10043193 | Ga0105240_100431935 | 163 |
| 4 | 3300009093 | Ga0105240_11181744 | Ga0105240_111817442 | 163 |
| 5 | 3300009545 | Ga0105237_10020612 | Ga0105237_100206123 | 163 |
| 6 | 3300009551 | Ga0105238_10000356 | Ga0105238_1000035624 | 163 |
| 7 | 3300010375 | Ga0105239_10091537 | Ga0105239_100915372 | 163 |
| 8 | 3300015261 | Ga0182006_1010262 | Ga0182006_10102622 | 163 |
| 9 | 3300025913 | Ga0207695_10016554 | Ga0207695_100165542 | 163 |
| 10 | 3300025913 | Ga0207695_10510095 | Ga0207695_105100952 | 163 |
| 11 | 3300025914 | Ga0207671_10301878 | Ga0207671_103018782 | 163 |
| 12 | 3300025924 | Ga0207694_10000474 | Ga0207694_1000047423 | 163 |
| 13 | 3300025949 | Ga0207667_10104965 | Ga0207667_101049652 | 163 |
| 14 | 3300025981 | Ga0207640_10069543 | Ga0207640_100695432 | 163 |
| 15 | 3300026116 | Ga0207674_10149413 | Ga0207674_101494132 | 163 |
| 16 | 3300048927 | Ga0496124_0368154 | Ga0496124_0368154_389_889 | 163 |
| 17 | 3300002739 | JGI25158J39367_1000340 | JGI25158J39367_10003405 | 164 |
| 18 | 3300002739 | JGI25158J39367_1000538 | JGI25158J39367_10005386 | 164 |
| 19 | 3300002774 | JGI25150J39212_1000541 | JGI25150J39212_10005416 | 164 |
| 20 | 3300002987 | JGI25159J45721_1001185 | JGI25159J45721_10011856 | 164 |
| 21 | 3300003214 | JGI25165J46597_1000122 | JGI25165J46597_100012220 | 164 |
| 22 | 3300003215 | JGI25153J46596_10011326 | JGI25153J46596_100113264 | 164 |
| 23 | 3300003316 | rootH1_10195554 | rootH1_101955542 | 164 |
| 24 | 3300003322 | rootL2_10004113 | rootL2_100041132 | 164 |
| 25 | 3300003322 | rootL2_10103840 | rootL2_101038404 | 164 |
| 26 | 3300003322 | rootL2_10162097 | rootL2_101620973 | 164 |
| 27 | 3300003354 | JGI25160J50197_1000102 | JGI25160J50197_100010237 | 164 |
| 28 | 3300003374 | JGI25161J50226_1000788 | JGI25161J50226_10007887 | 164 |
| 29 | 3300003374 | JGI25161J50226_1006104 | JGI25161J50226_10061042 | 164 |
| 30 | 3300003575 | Ga0007409J51694_1084677 | Ga0007409J51694_10846771 | 164 |
| 31 | 3300003693 | Ga0032354_1094307 | Ga0032354_10943071 | 164 |
| 32 | 3300003751 | Ga0055538_1000048 | Ga0055538_100004820 | 164 |
| 33 | 3300003752 | Ga0055539_1000070 | Ga0055539_100007080 | 164 |
| 34 | 3300003756 | Ga0055533_1000078 | Ga0055533_100007820 | 164 |
| 35 | 3300003759 | Ga0055525_1000106 | Ga0055525_100010620 | 164 |
| 36 | 3300003771 | Ga0055526_1041454 | Ga0055526_10414541 | 164 |
| 37 | 3300003773 | Ga0055537_1004000 | Ga0055537_10040003 | 164 |
| 38 | 3300003775 | Ga0055524_1002098 | Ga0055524_10020986 | 164 |
| 39 | 3300003775 | Ga0055524_1005941 | Ga0055524_10059413 | 164 |
| 40 | 3300003784 | Ga0055534_1014825 | Ga0055534_10148252 | 164 |
| 41 | 3300003790 | Ga0055528_1007400 | Ga0055528_10074006 | 164 |
| 42 | 3300003794 | Ga0055531_10006854 | Ga0055531_100068542 | 164 |
| 43 | 3300003841 | Ga0055541_1000050 | Ga0055541_100005020 | 164 |
| 44 | 3300004625 | Ga0055543_1000916 | Ga0055543_10009168 | 164 |
| 45 | 3300005262 | Ga0065165_1000787 | Ga0065165_10007871 | 164 |
| 46 | 3300005262 | Ga0065165_1002791 | Ga0065165_10027918 | 164 |
| 47 | 3300005262 | Ga0065165_1051609 | Ga0065165_10516092 | 164 |
| 48 | 3300005331 | Ga0070670_100467594 | Ga0070670_1004675942 | 164 |
| 49 | 3300005339 | Ga0070660_100000687 | Ga0070660_1000006878 | 164 |
| 50 | 3300005344 | Ga0070661_100005128 | Ga0070661_1000051289 | 164 |
| 51 | 3300005366 | Ga0070659_100009975 | Ga0070659_1000099752 | 164 |
| 52 | 3300005564 | Ga0070664_100081826 | Ga0070664_1000818263 | 164 |
| 53 | 3300006175 | Ga0070712_100330783 | Ga0070712_1003307832 | 164 |
| 54 | 3300009036 | Ga0105244_10015596 | Ga0105244_100155962 | 164 |
| 55 | 3300014969 | Ga0157376_10596527 | Ga0157376_105965272 | 164 |
| 56 | 3300015262 | Ga0182007_10001513 | Ga0182007_1000151313 | 164 |
| 57 | 3300015262 | Ga0182007_10005716 | Ga0182007_100057163 | 164 |
| 58 | 3300015265 | Ga0182005_1000637 | Ga0182005_100063716 | 164 |
| 59 | 3300016635 | Ga0183361_10006 | Ga0183361_10006202 | 164 |
| 60 | 3300021361 | Ga0213872_10006910 | Ga0213872_100069105 | 164 |
| 61 | 3300021361 | Ga0213872_10023990 | Ga0213872_100239902 | 164 |
| 62 | 3300021361 | Ga0213872_10174509 | Ga0213872_101745092 | 164 |
| 63 | 3300025207 | Ga0209760_101327 | Ga0209760_1013272 | 164 |
| 64 | 3300025208 | Ga0209436_100109 | Ga0209436_10010911 | 164 |
| 65 | 3300025224 | Ga0209784_100062 | Ga0209784_10006220 | 164 |
| 66 | 3300025225 | Ga0209566_100023 | Ga0209566_100023241 | 164 |
| 67 | 3300025226 | Ga0209674_100040 | Ga0209674_100040241 | 164 |
| 68 | 3300025230 | Ga0209563_100096 | Ga0209563_10009620 | 164 |
| 69 | 3300025231 | Ga0207427_100948 | Ga0207427_1009483 | 164 |
| 70 | 3300025233 | Ga0209437_100146 | Ga0209437_10014620 | 164 |
| 71 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011299 | 164 |
| 72 | 3300025245 | Ga0207425_1000304 | Ga0207425_100030425 | 164 |
| 73 | 3300025253 | Ga0209677_100058 | Ga0209677_10005820 | 164 |
| 74 | 3300025256 | Ga0209759_1000030 | Ga0209759_100003046 | 164 |
| 75 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001476 | 164 |
| 76 | 3300025258 | Ga0209129_1001453 | Ga0209129_10014534 | 164 |
| 77 | 3300025261 | Ga0209233_1000159 | Ga0209233_100015920 | 164 |
| 78 | 3300025261 | Ga0209233_1026630 | Ga0209233_10266302 | 164 |
| 79 | 3300025263 | Ga0209565_1000902 | Ga0209565_10009026 | 164 |
| 80 | 3300025263 | Ga0209565_1001159 | Ga0209565_100115913 | 164 |
| 81 | 3300025263 | Ga0209565_1002038 | Ga0209565_10020382 | 164 |
| 82 | 3300025263 | Ga0209565_1004668 | Ga0209565_10046684 | 164 |
| 83 | 3300025284 | Ga0209130_1000507 | Ga0209130_100050725 | 164 |
| 84 | 3300025284 | Ga0209130_1001852 | Ga0209130_10018523 | 164 |
| 85 | 3300025291 | Ga0209675_1000769 | Ga0209675_100076916 | 164 |
| 86 | 3300025291 | Ga0209675_1001368 | Ga0209675_10013686 | 164 |
| 87 | 3300025295 | Ga0209564_1001707 | Ga0209564_10017074 | 164 |
| 88 | 3300025295 | Ga0209564_1005199 | Ga0209564_10051994 | 164 |
| 89 | 3300025295 | Ga0209564_1007977 | Ga0209564_10079774 | 164 |
| 90 | 3300025297 | Ga0209758_1000073 | Ga0209758_100007325 | 164 |
| 91 | 3300025298 | Ga0209050_1000046 | Ga0209050_1000046117 | 164 |
| 92 | 3300025299 | Ga0209256_1000467 | Ga0209256_100046759 | 164 |
| 93 | 3300025299 | Ga0209256_1002001 | Ga0209256_100200114 | 164 |
| 94 | 3300025302 | Ga0207426_1000125 | Ga0207426_1000125161 | 164 |
| 95 | 3300025302 | Ga0207426_1001239 | Ga0207426_100123912 | 164 |
| 96 | 3300025302 | Ga0207426_1065226 | Ga0207426_10652262 | 164 |
| 97 | 3300025303 | Ga0209051_1018958 | Ga0209051_10189582 | 164 |
| 98 | 3300025304 | Ga0209257_1000068 | Ga0209257_1000068213 | 164 |
| 99 | 3300025915 | Ga0207693_10261622 | Ga0207693_102616222 | 164 |
| 100 | 3300025919 | Ga0207657_10002005 | Ga0207657_1000200517 | 164 |
| 101 | 3300025920 | Ga0207649_10008188 | Ga0207649_100081883 | 164 |
| 102 | 3300025925 | Ga0207650_10227865 | Ga0207650_102278653 | 164 |
| 103 | 3300025932 | Ga0207690_10055385 | Ga0207690_100553852 | 164 |
| 104 | 3300025945 | Ga0207679_10015374 | Ga0207679_100153745 | 164 |
| 105 | 3300025945 | Ga0207679_10215439 | Ga0207679_102154393 | 164 |
| 106 | 3300030731 | Ga0316177_1045075 | Ga0316177_10450755 | 164 |
| 107 | 3300030731 | Ga0316177_1061609 | Ga0316177_10616093 | 164 |
| 108 | 3300030736 | Ga0316180_1180291 | Ga0316180_11802912 | 164 |
| 109 | 3300030744 | Ga0316181_1266052 | Ga0316181_12660521 | 164 |
| 110 | 3300030745 | Ga0316182_1006372 | Ga0316182_10063724 | 164 |
| 111 | 3300030745 | Ga0316182_1229639 | Ga0316182_12296391 | 164 |
| 112 | 3300031548 | Ga0307408_100000471 | Ga0307408_1000004715 | 164 |
| 113 | 3300031548 | Ga0307408_100010708 | Ga0307408_1000107083 | 164 |
| 114 | 3300031548 | Ga0307408_100148318 | Ga0307408_1001483181 | 164 |
| 115 | 3300031911 | Ga0307412_10424486 | Ga0307412_104244862 | 164 |
| 116 | 3300032002 | Ga0307416_100260964 | Ga0307416_1002609642 | 164 |
| 117 | 3300032002 | Ga0307416_100615349 | Ga0307416_1006153491 | 164 |
| 118 | 3300032004 | Ga0307414_10254560 | Ga0307414_102545602 | 164 |
| 119 | 3300037312 | Ga0395899_0000473 | Ga0395899_0000473_8548_9102 | 164 |
| 120 | 3300037312 | Ga0395899_0001163 | Ga0395899_0001163_18040_18534 | 164 |
| 121 | 3300037312 | Ga0395899_0033403 | Ga0395899_0033403_2557_3051 | 164 |
| 122 | 3300037418 | Ga0395900_0080789 | Ga0395900_0080789_1626_2120 | 164 |
| 123 | 3300037418 | Ga0395900_1156177 | Ga0395900_1156177_182_676 | 164 |
| 124 | 3300037466 | Ga0395898_0430966 | Ga0395898_0430966_324_818 | 164 |
| 125 | 3300037471 | Ga0395905_0000459 | Ga0395905_0000459_38217_38711 | 164 |
| 126 | 3300037471 | Ga0395905_0002580 | Ga0395905_0002580_16904_17398 | 164 |
| 127 | 3300037471 | Ga0395905_0189921 | Ga0395905_0189921_1370_1864 | 164 |
| 128 | 3300037471 | Ga0395905_0256423 | Ga0395905_0256423_114_608 | 164 |
| 129 | 3300037471 | Ga0395905_0300589 | Ga0395905_0300589_649_1143 | 164 |
| 130 | 3300037471 | Ga0395905_0881997 | Ga0395905_0881997_190_684 | 164 |
| 131 | 3300038443 | Ga0395901_0000533 | Ga0395901_0000533_35004_35498 | 164 |
| 132 | 3300038443 | Ga0395901_0043187 | Ga0395901_0043187_795_1289 | 164 |
| 133 | 3300038443 | Ga0395901_0058917 | Ga0395901_0058917_2742_3254 | 164 |
| 134 | 3300038443 | Ga0395901_0847825 | Ga0395901_0847825_68_562 | 164 |
| 135 | 3300039447 | Ga0436361_0080172 | Ga0436361_0080172_27930_28424 | 164 |
| 136 | 3300039447 | Ga0436361_0185793 | Ga0436361_0185793_4408_4902 | 164 |
| 137 | 3300039447 | Ga0436361_0222234 | Ga0436361_0222234_9600_10094 | 164 |
| 138 | 3300039447 | Ga0436361_0458107 | Ga0436361_0458107_4895_5389 | 164 |
| 139 | 3300039447 | Ga0436361_1082846 | Ga0436361_1082846_2323_2817 | 164 |
| 140 | 3300041404 | Ga0439436_0058881 | Ga0439436_0058881_282_776 | 164 |
| 141 | 3300042122 | Ga0450920_048174 | Ga0450920_048174_145_651 | 164 |
| 142 | 3300044658 | Ga0466972_0042176 | Ga0466972_0042176_912_1406 | 164 |
| 143 | 3300044684 | Ga0466966_0080591 | Ga0466966_0080591_457_951 | 164 |
| 144 | 3300044684 | Ga0466966_0098595 | Ga0466966_0098595_748_1242 | 164 |
| 145 | 3300044765 | Ga0466970_0019885 | Ga0466970_0019885_133_627 | 164 |
| 146 | 3300044765 | Ga0466970_0068583 | Ga0466970_0068583_869_1387 | 164 |
| 147 | 3300044765 | Ga0466970_0074379 | Ga0466970_0074379_444_938 | 164 |
| 148 | 3300045049 | Ga0466959_0031492 | Ga0466959_0031492_577_1071 | 164 |
| 149 | 3300045836 | Ga0466958_0111661 | Ga0466958_0111661_881_1375 | 164 |
| 150 | 3300046452 | Ga0495617_031580 | Ga0495617_031580_345_839 | 164 |
| 151 | 3300046454 | Ga0495592_0006504 | Ga0495592_0006504_2237_2731 | 164 |
| 152 | 3300046454 | Ga0495592_0100002 | Ga0495592_0100002_287_781 | 164 |
| 153 | 3300046455 | Ga0495603_0013539 | Ga0495603_0013539_2534_3148 | 164 |
| 154 | 3300046457 | Ga0495590_0000001 | Ga0495590_0000001_513271_513768 | 164 |
| 155 | 3300046457 | Ga0495590_0010453 | Ga0495590_0010453_1476_1970 | 164 |
| 156 | 3300046457 | Ga0495590_0082514 | Ga0495590_0082514_24_518 | 164 |
| 157 | 3300046458 | Ga0495591_006093 | Ga0495591_006093_1510_2004 | 164 |
| 158 | 3300046459 | Ga0495629_0027438 | Ga0495629_0027438_1798_2292 | 164 |
| 159 | 3300046460 | Ga0495638_0000086 | Ga0495638_0000086_48532_49029 | 164 |
| 160 | 3300046460 | Ga0495638_0019285 | Ga0495638_0019285_3224_3718 | 164 |
| 161 | 3300046460 | Ga0495638_0045046 | Ga0495638_0045046_512_1006 | 164 |
| 162 | 3300046460 | Ga0495638_0121834 | Ga0495638_0121834_609_1109 | 164 |
| 163 | 3300046460 | Ga0495638_0126705 | Ga0495638_0126705_411_920 | 164 |
| 164 | 3300046460 | Ga0495638_0212249 | Ga0495638_0212249_317_811 | 164 |
| 165 | 3300046460 | Ga0495638_0361046 | Ga0495638_0361046_100_594 | 164 |
| 166 | 3300046462 | Ga0495651_0011219 | Ga0495651_0011219_4225_4752 | 164 |
| 167 | 3300046462 | Ga0495651_0053629 | Ga0495651_0053629_662_1156 | 164 |
| 168 | 3300046462 | Ga0495651_0188061 | Ga0495651_0188061_183_710 | 164 |
| 169 | 3300046462 | Ga0495651_0199440 | Ga0495651_0199440_98_592 | 164 |
| 170 | 3300046463 | Ga0495653_0032369 | Ga0495653_0032369_1846_2373 | 164 |
| 171 | 3300046463 | Ga0495653_0040273 | Ga0495653_0040273_831_1325 | 164 |
| 172 | 3300046463 | Ga0495653_0061002 | Ga0495653_0061002_125_619 | 164 |
| 173 | 3300046463 | Ga0495653_0084113 | Ga0495653_0084113_821_1315 | 164 |
| 174 | 3300046463 | Ga0495653_0541791 | Ga0495653_0541791_174_701 | 164 |
| 175 | 3300046463 | Ga0495653_0659655 | Ga0495653_0659655_13_507 | 164 |
| 176 | 3300046471 | Ga0495650_0000156 | Ga0495650_0000156_15150_15659 | 164 |
| 177 | 3300046471 | Ga0495650_0000837 | Ga0495650_0000837_26761_27255 | 164 |
| 178 | 3300046471 | Ga0495650_0007154 | Ga0495650_0007154_181_678 | 164 |
| 179 | 3300046471 | Ga0495650_0047573 | Ga0495650_0047573_137_631 | 164 |
| 180 | 3300046472 | Ga0495580_0027408 | Ga0495580_0027408_1617_2111 | 164 |
| 181 | 3300046472 | Ga0495580_0028061 | Ga0495580_0028061_1791_2318 | 164 |
| 182 | 3300046472 | Ga0495580_0057301 | Ga0495580_0057301_2042_2569 | 164 |
| 183 | 3300046472 | Ga0495580_0063439 | Ga0495580_0063439_63_557 | 164 |
| 184 | 3300046472 | Ga0495580_0256385 | Ga0495580_0256385_628_1170 | 164 |
| 185 | 3300046473 | Ga0495582_0030048 | Ga0495582_0030048_1093_1620 | 164 |
| 186 | 3300046473 | Ga0495582_0074603 | Ga0495582_0074603_1066_1560 | 164 |
| 187 | 3300046474 | Ga0495605_0000168 | Ga0495605_0000168_25742_26245 | 164 |
| 188 | 3300046474 | Ga0495605_0049845 | Ga0495605_0049845_1271_1765 | 164 |
| 189 | 3300046475 | Ga0495639_0095302 | Ga0495639_0095302_475_972 | 164 |
| 190 | 3300046477 | Ga0495664_0035119 | Ga0495664_0035119_1414_1908 | 164 |
| 191 | 3300046477 | Ga0495664_0683716 | Ga0495664_0683716_46_540 | 164 |
| 192 | 3300046491 | Ga0495584_0001459 | Ga0495584_0001459_1020_1514 | 164 |
| 193 | 3300046491 | Ga0495584_0029037 | Ga0495584_0029037_1725_2219 | 164 |
| 194 | 3300046491 | Ga0495584_0420607 | Ga0495584_0420607_22_516 | 164 |
| 195 | 3300046492 | Ga0495585_0003521 | Ga0495585_0003521_3914_4423 | 164 |
| 196 | 3300046492 | Ga0495585_0016695 | Ga0495585_0016695_1276_1770 | 164 |
| 197 | 3300046492 | Ga0495585_0185972 | Ga0495585_0185972_160_654 | 164 |
| 198 | 3300046492 | Ga0495585_0243107 | Ga0495585_0243107_25_519 | 164 |
| 199 | 3300046500 | Ga0495596_0012787 | Ga0495596_0012787_1944_2438 | 164 |
| 200 | 3300046500 | Ga0495596_0166023 | Ga0495596_0166023_168_662 | 164 |
| 201 | 3300046501 | Ga0495607_0010595 | Ga0495607_0010595_705_1199 | 164 |
| 202 | 3300046501 | Ga0495607_0047035 | Ga0495607_0047035_848_1342 | 164 |
| 203 | 3300046501 | Ga0495607_0064211 | Ga0495607_0064211_710_1204 | 164 |
| 204 | 3300046506 | Ga0495583_0000177 | Ga0495583_0000177_45937_46431 | 164 |
| 205 | 3300046506 | Ga0495583_0000532 | Ga0495583_0000532_48730_49227 | 164 |
| 206 | 3300046506 | Ga0495583_0001113 | Ga0495583_0001113_711_1205 | 164 |
| 207 | 3300046506 | Ga0495583_0001849 | Ga0495583_0001849_13115_13609 | 164 |
| 208 | 3300046506 | Ga0495583_0013697 | Ga0495583_0013697_3241_3735 | 164 |
| 209 | 3300046507 | Ga0495606_0000864 | Ga0495606_0000864_17433_17933 | 164 |
| 210 | 3300046507 | Ga0495606_0007630 | Ga0495606_0007630_5204_5698 | 164 |
| 211 | 3300046507 | Ga0495606_0008551 | Ga0495606_0008551_7660_8154 | 164 |
| 212 | 3300046507 | Ga0495606_0018168 | Ga0495606_0018168_87_581 | 164 |
| 213 | 3300046507 | Ga0495606_0032639 | Ga0495606_0032639_2149_2643 | 164 |
| 214 | 3300046507 | Ga0495606_0053426 | Ga0495606_0053426_1268_1762 | 164 |
| 215 | 3300046507 | Ga0495606_0132346 | Ga0495606_0132346_87_581 | 164 |
| 216 | 3300046511 | Ga0495608_0000977 | Ga0495608_0000977_11839_12333 | 164 |
| 217 | 3300046511 | Ga0495608_0054657 | Ga0495608_0054657_2052_2546 | 164 |
| 218 | 3300046511 | Ga0495608_0096319 | Ga0495608_0096319_810_1304 | 164 |
| 219 | 3300046512 | Ga0495610_0000003 | Ga0495610_0000003_639159_639668 | 164 |
| 220 | 3300046512 | Ga0495610_0002840 | Ga0495610_0002840_13078_13578 | 164 |
| 221 | 3300046512 | Ga0495610_0010041 | Ga0495610_0010041_537_1031 | 164 |
| 222 | 3300046513 | Ga0495616_0028164 | Ga0495616_0028164_19_513 | 164 |
| 223 | 3300046513 | Ga0495616_0045970 | Ga0495616_0045970_462_956 | 164 |
| 224 | 3300046514 | Ga0495618_0006045 | Ga0495618_0006045_6689_7183 | 164 |
| 225 | 3300046514 | Ga0495618_0006680 | Ga0495618_0006680_3188_3682 | 164 |
| 226 | 3300046514 | Ga0495618_0260017 | Ga0495618_0260017_47_541 | 164 |
| 227 | 3300046515 | Ga0495620_0042075 | Ga0495620_0042075_1019_1513 | 164 |
| 228 | 3300046516 | Ga0495628_0000612 | Ga0495628_0000612_8690_9184 | 164 |
| 229 | 3300046516 | Ga0495628_0001590 | Ga0495628_0001590_7720_8214 | 164 |
| 230 | 3300046516 | Ga0495628_0038220 | Ga0495628_0038220_1894_2421 | 164 |
| 231 | 3300046516 | Ga0495628_0049377 | Ga0495628_0049377_1957_2484 | 164 |
| 232 | 3300046516 | Ga0495628_0080657 | Ga0495628_0080657_1787_2281 | 164 |
| 233 | 3300046517 | Ga0495630_0037486 | Ga0495630_0037486_2247_2741 | 164 |
| 234 | 3300046517 | Ga0495630_0113181 | Ga0495630_0113181_50_577 | 164 |
| 235 | 3300046517 | Ga0495630_0167459 | Ga0495630_0167459_704_1198 | 164 |
| 236 | 3300046520 | Ga0495637_0033494 | Ga0495637_0033494_1263_1757 | 164 |
| 237 | 3300046522 | Ga0495643_0000123 | Ga0495643_0000123_25228_25737 | 164 |
| 238 | 3300046522 | Ga0495643_0006019 | Ga0495643_0006019_6938_7435 | 164 |
| 239 | 3300046522 | Ga0495643_0012364 | Ga0495643_0012364_3105_3599 | 164 |
| 240 | 3300046523 | Ga0495644_0000892 | Ga0495644_0000892_2393_2887 | 164 |
| 241 | 3300046523 | Ga0495644_0001552 | Ga0495644_0001552_2306_2800 | 164 |
| 242 | 3300046524 | Ga0495648_0000001 | Ga0495648_0000001_249244_249741 | 164 |
| 243 | 3300046524 | Ga0495648_0000565 | Ga0495648_0000565_38867_39361 | 164 |
| 244 | 3300046524 | Ga0495648_0001518 | Ga0495648_0001518_3023_3532 | 164 |
| 245 | 3300046524 | Ga0495648_0011102 | Ga0495648_0011102_4635_5144 | 164 |
| 246 | 3300046524 | Ga0495648_0016985 | Ga0495648_0016985_877_1371 | 164 |
| 247 | 3300046524 | Ga0495648_0046851 | Ga0495648_0046851_791_1285 | 164 |
| 248 | 3300046524 | Ga0495648_0063600 | Ga0495648_0063600_770_1264 | 164 |
| 249 | 3300046524 | Ga0495648_0087636 | Ga0495648_0087636_797_1291 | 164 |
| 250 | 3300046524 | Ga0495648_0111419 | Ga0495648_0111419_962_1456 | 164 |
| 251 | 3300046526 | Ga0495666_0001182 | Ga0495666_0001182_6301_6795 | 164 |
| 252 | 3300046526 | Ga0495666_0053327 | Ga0495666_0053327_1227_1754 | 164 |
| 253 | 3300046528 | Ga0495642_0002613 | Ga0495642_0002613_6165_6662 | 164 |
| 254 | 3300046528 | Ga0495642_0041788 | Ga0495642_0041788_782_1276 | 164 |
| 255 | 3300046528 | Ga0495642_0049764 | Ga0495642_0049764_28_522 | 164 |
| 256 | 3300046529 | Ga0495652_0002873 | Ga0495652_0002873_13926_14420 | 164 |
| 257 | 3300046529 | Ga0495652_0003510 | Ga0495652_0003510_12707_13201 | 164 |
| 258 | 3300046529 | Ga0495652_0135377 | Ga0495652_0135377_1332_1826 | 164 |
| 259 | 3300046530 | Ga0495654_0003818 | Ga0495654_0003818_5370_5879 | 164 |
| 260 | 3300046530 | Ga0495654_0096448 | Ga0495654_0096448_653_1147 | 164 |
| 261 | 3300046531 | Ga0495665_0110481 | Ga0495665_0110481_268_819 | 164 |
| 262 | 3300046531 | Ga0495665_0163969 | Ga0495665_0163969_145_687 | 164 |
| 263 | 3300046533 | Ga0495640_0504360 | Ga0495640_0504360_104_598 | 164 |
| 264 | 3300046535 | Ga0495586_0122935 | Ga0495586_0122935_391_885 | 164 |
| 265 | 3300046536 | Ga0495587_0062522 | Ga0495587_0062522_460_954 | 164 |
| 266 | 3300046536 | Ga0495587_0436074 | Ga0495587_0436074_105_599 | 164 |
| 267 | 3300046538 | Ga0495609_0000479 | Ga0495609_0000479_12364_12858 | 164 |
| 268 | 3300046538 | Ga0495609_0018085 | Ga0495609_0018085_340_834 | 164 |
| 269 | 3300046538 | Ga0495609_0022768 | Ga0495609_0022768_372_869 | 164 |
| 270 | 3300046538 | Ga0495609_0028476 | Ga0495609_0028476_1635_2129 | 164 |
| 271 | 3300046538 | Ga0495609_0103380 | Ga0495609_0103380_237_746 | 164 |
| 272 | 3300046539 | Ga0495621_0256799 | Ga0495621_0256799_103_597 | 164 |
| 273 | 3300046542 | Ga0495597_0000208 | Ga0495597_0000208_52133_52642 | 164 |
| 274 | 3300046542 | Ga0495597_0002211 | Ga0495597_0002211_4592_5086 | 164 |
| 275 | 3300046542 | Ga0495597_0004990 | Ga0495597_0004990_750_1247 | 164 |
| 276 | 3300046542 | Ga0495597_0005042 | Ga0495597_0005042_2634_3128 | 164 |
| 277 | 3300046542 | Ga0495597_0030327 | Ga0495597_0030327_683_1177 | 164 |
| 278 | 3300046542 | Ga0495597_0051227 | Ga0495597_0051227_27_521 | 164 |
| 279 | 3300046542 | Ga0495597_0082665 | Ga0495597_0082665_227_769 | 164 |
| 280 | 3300046543 | Ga0495645_0113089 | Ga0495645_0113089_145_639 | 164 |
| 281 | 3300046543 | Ga0495645_0295426 | Ga0495645_0295426_426_920 | 164 |
| 282 | 3300046543 | Ga0495645_0316595 | Ga0495645_0316595_347_841 | 164 |
| 283 | 3300046557 | Ga0495622_0000028 | Ga0495622_0000028_25072_25566 | 164 |
| 284 | 3300046557 | Ga0495622_0002020 | Ga0495622_0002020_5970_6464 | 164 |
| 285 | 3300046557 | Ga0495622_0002846 | Ga0495622_0002846_727_1224 | 164 |
| 286 | 3300046557 | Ga0495622_0121546 | Ga0495622_0121546_459_953 | 164 |
| 287 | 3300046557 | Ga0495622_0202054 | Ga0495622_0202054_106_600 | 164 |
| 288 | 3300046558 | Ga0495633_0000272 | Ga0495633_0000272_48777_49274 | 164 |
| 289 | 3300046558 | Ga0495633_0002822 | Ga0495633_0002822_710_1204 | 164 |
| 290 | 3300046558 | Ga0495633_0008566 | Ga0495633_0008566_2269_2769 | 164 |
| 291 | 3300046558 | Ga0495633_0021198 | Ga0495633_0021198_1877_2386 | 164 |
| 292 | 3300046558 | Ga0495633_0106362 | Ga0495633_0106362_97_591 | 164 |
| 293 | 3300046558 | Ga0495633_0319728 | Ga0495633_0319728_31_525 | 164 |
| 294 | 3300046615 | Ga0495656_0009086 | Ga0495656_0009086_524_1018 | 164 |
| 295 | 3300046615 | Ga0495656_0049841 | Ga0495656_0049841_683_1177 | 164 |
| 296 | 3300046616 | Ga0495668_0000151 | Ga0495668_0000151_6855_7352 | 164 |
| 297 | 3300046616 | Ga0495668_0001575 | Ga0495668_0001575_17184_17693 | 164 |
| 298 | 3300046616 | Ga0495668_0275234 | Ga0495668_0275234_272_766 | 164 |
| 299 | 3300046642 | Ga0495634_0009348 | Ga0495634_0009348_5674_6168 | 164 |
| 300 | 3300046648 | Ga0495611_0001352 | Ga0495611_0001352_6730_7224 | 164 |
| 301 | 3300046648 | Ga0495611_0008148 | Ga0495611_0008148_1086_1580 | 164 |
| 302 | 3300046648 | Ga0495611_0270815 | Ga0495611_0270815_36_530 | 164 |
| 303 | 3300046660 | Ga0495625_0000480 | Ga0495625_0000480_6646_7143 | 164 |
| 304 | 3300046660 | Ga0495625_0003732 | Ga0495625_0003732_4112_4606 | 164 |
| 305 | 3300046660 | Ga0495625_0015020 | Ga0495625_0015020_255_749 | 164 |
| 306 | 3300046660 | Ga0495625_0052830 | Ga0495625_0052830_1059_1568 | 164 |
| 307 | 3300046660 | Ga0495625_0137311 | Ga0495625_0137311_767_1276 | 164 |
| 308 | 3300046663 | Ga0495635_0020613 | Ga0495635_0020613_661_1155 | 164 |
| 309 | 3300046663 | Ga0495635_0031650 | Ga0495635_0031650_2548_3042 | 164 |
| 310 | 3300046664 | Ga0495659_0000971 | Ga0495659_0000971_839_1333 | 164 |
| 311 | 3300046664 | Ga0495659_0029997 | Ga0495659_0029997_206_700 | 164 |
| 312 | 3300046665 | Ga0495661_0026684 | Ga0495661_0026684_2452_2946 | 164 |
| 313 | 3300046665 | Ga0495661_0030990 | Ga0495661_0030990_1021_1530 | 164 |
| 314 | 3300046665 | Ga0495661_0041411 | Ga0495661_0041411_406_900 | 164 |
| 315 | 3300046665 | Ga0495661_0077657 | Ga0495661_0077657_215_709 | 164 |
| 316 | 3300046665 | Ga0495661_0248376 | Ga0495661_0248376_114_608 | 164 |
| 317 | 3300046675 | Ga0495657_0071118 | Ga0495657_0071118_318_812 | 164 |
| 318 | 3300046675 | Ga0495657_0114487 | Ga0495657_0114487_647_1141 | 164 |
| 319 | 3300046678 | Ga0495599_0004330 | Ga0495599_0004330_7364_7858 | 164 |
| 320 | 3300046678 | Ga0495599_0031959 | Ga0495599_0031959_952_1479 | 164 |
| 321 | 3300046678 | Ga0495599_0099824 | Ga0495599_0099824_140_634 | 164 |
| 322 | 3300046679 | Ga0495623_0002700 | Ga0495623_0002700_5403_5897 | 164 |
| 323 | 3300046679 | Ga0495623_0021047 | Ga0495623_0021047_2163_2690 | 164 |
| 324 | 3300046679 | Ga0495623_0045220 | Ga0495623_0045220_2102_2596 | 164 |
| 325 | 3300046679 | Ga0495623_0129793 | Ga0495623_0129793_414_941 | 164 |
| 326 | 3300046680 | Ga0495646_0001994 | Ga0495646_0001994_11278_11772 | 164 |
| 327 | 3300046680 | Ga0495646_0012009 | Ga0495646_0012009_1655_2149 | 164 |
| 328 | 3300046680 | Ga0495646_0053438 | Ga0495646_0053438_330_824 | 164 |
| 329 | 3300046680 | Ga0495646_0095592 | Ga0495646_0095592_1063_1557 | 164 |
| 330 | 3300046680 | Ga0495646_0103192 | Ga0495646_0103192_581_1108 | 164 |
| 331 | 3300046689 | Ga0495613_0093199 | Ga0495613_0093199_810_1304 | 164 |
| 332 | 3300046689 | Ga0495613_0268721 | Ga0495613_0268721_324_818 | 164 |
| 333 | 3300046690 | Ga0495624_0008366 | Ga0495624_0008366_3479_3973 | 164 |
| 334 | 3300046690 | Ga0495624_0011605 | Ga0495624_0011605_1803_2330 | 164 |
| 335 | 3300046690 | Ga0495624_0013694 | Ga0495624_0013694_2525_3019 | 164 |
| 336 | 3300046690 | Ga0495624_0020813 | Ga0495624_0020813_1922_2449 | 164 |
| 337 | 3300046690 | Ga0495624_0080019 | Ga0495624_0080019_1182_1676 | 164 |
| 338 | 3300046691 | Ga0495670_0000597 | Ga0495670_0000597_6695_7189 | 164 |
| 339 | 3300046691 | Ga0495670_0013613 | Ga0495670_0013613_1087_1581 | 164 |
| 340 | 3300046691 | Ga0495670_0282728 | Ga0495670_0282728_152_646 | 164 |
| 341 | 3300046692 | Ga0495671_0000001 | Ga0495671_0000001_24789_25298 | 164 |
| 342 | 3300046692 | Ga0495671_0000108 | Ga0495671_0000108_21867_22361 | 164 |
| 343 | 3300046692 | Ga0495671_0010859 | Ga0495671_0010859_4372_4881 | 164 |
| 344 | 3300046692 | Ga0495671_0029988 | Ga0495671_0029988_784_1278 | 164 |
| 345 | 3300046692 | Ga0495671_0055844 | Ga0495671_0055844_1104_1613 | 164 |
| 346 | 3300046692 | Ga0495671_0091672 | Ga0495671_0091672_615_1109 | 164 |
| 347 | 3300046692 | Ga0495671_0102623 | Ga0495671_0102623_405_899 | 164 |
| 348 | 3300046694 | Ga0495649_0085067 | Ga0495649_0085067_256_765 | 164 |
| 349 | 3300046694 | Ga0495649_0106694 | Ga0495649_0106694_616_1110 | 164 |
| 350 | 3300046694 | Ga0495649_0205872 | Ga0495649_0205872_22_516 | 164 |
| 351 | 3300046694 | Ga0495649_0349414 | Ga0495649_0349414_97_591 | 164 |
| 352 | 3300046694 | Ga0495649_0385938 | Ga0495649_0385938_59_556 | 164 |
| 353 | 3300046794 | Ga0495589_0014007 | Ga0495589_0014007_877_1371 | 164 |
| 354 | 3300046794 | Ga0495589_0125073 | Ga0495589_0125073_100_594 | 164 |
| 355 | 3300046809 | Ga0495600_0000837 | Ga0495600_0000837_2508_3002 | 164 |
| 356 | 3300046809 | Ga0495600_0013225 | Ga0495600_0013225_492_986 | 164 |
| 357 | 3300046809 | Ga0495600_0175892 | Ga0495600_0175892_446_973 | 164 |
| 358 | 3300046810 | Ga0495660_0000705 | Ga0495660_0000705_18692_19186 | 164 |
| 359 | 3300046810 | Ga0495660_0013800 | Ga0495660_0013800_1394_1903 | 164 |
| 360 | 3300046810 | Ga0495660_0021450 | Ga0495660_0021450_486_983 | 164 |
| 361 | 3300046810 | Ga0495660_0063135 | Ga0495660_0063135_656_1150 | 164 |
| 362 | 3300047315 | Ga0495581_0087207 | Ga0495581_0087207_1036_1530 | 164 |
| 363 | 3300047317 | Ga0495604_0001208 | Ga0495604_0001208_8669_9163 | 164 |
| 364 | 3300047317 | Ga0495604_0014180 | Ga0495604_0014180_1139_1690 | 164 |
| 365 | 3300047317 | Ga0495604_0019556 | Ga0495604_0019556_2765_3259 | 164 |
| 366 | 3300047317 | Ga0495604_0032570 | Ga0495604_0032570_1699_2226 | 164 |
| 367 | 3300047318 | Ga0495636_0005094 | Ga0495636_0005094_2047_2541 | 164 |
| 368 | 3300047318 | Ga0495636_0013359 | Ga0495636_0013359_2484_2978 | 164 |
| 369 | 3300047318 | Ga0495636_0076626 | Ga0495636_0076626_797_1291 | 164 |
| 370 | 3300047319 | Ga0495674_0042230 | Ga0495674_0042230_2558_3085 | 164 |
| 371 | 3300047319 | Ga0495674_0064381 | Ga0495674_0064381_986_1480 | 164 |
| 372 | 3300047319 | Ga0495674_0064980 | Ga0495674_0064980_63_557 | 164 |
| 373 | 3300047319 | Ga0495674_0082969 | Ga0495674_0082969_1746_2240 | 164 |
| 374 | 3300047320 | Ga0495672_0000181 | Ga0495672_0000181_44626_45120 | 164 |
| 375 | 3300047320 | Ga0495672_0008922 | Ga0495672_0008922_757_1251 | 164 |
| 376 | 3300047320 | Ga0495672_0012839 | Ga0495672_0012839_4628_5137 | 164 |
| 377 | 3300047320 | Ga0495672_0087997 | Ga0495672_0087997_1059_1673 | 164 |
| 378 | 3300047321 | Ga0495676_0048758 | Ga0495676_0048758_1564_2058 | 164 |
| 379 | 3300047321 | Ga0495676_0063298 | Ga0495676_0063298_2224_2718 | 164 |
| 380 | 3300047322 | Ga0495680_0073946 | Ga0495680_0073946_810_1337 | 164 |
| 381 | 3300047322 | Ga0495680_0077519 | Ga0495680_0077519_1002_1529 | 164 |
| 382 | 3300047323 | Ga0495683_0008902 | Ga0495683_0008902_1023_1532 | 164 |
| 383 | 3300047323 | Ga0495683_0013406 | Ga0495683_0013406_1925_2419 | 164 |
| 384 | 3300047323 | Ga0495683_0146551 | Ga0495683_0146551_342_884 | 164 |
| 385 | 3300047323 | Ga0495683_0198685 | Ga0495683_0198685_103_597 | 164 |
| 386 | 3300047443 | Ga0495687_004715 | Ga0495687_004715_3092_3586 | 164 |
| 387 | 3300047443 | Ga0495687_006929 | Ga0495687_006929_3115_3612 | 164 |
| 388 | 3300047443 | Ga0495687_023617 | Ga0495687_023617_467_961 | 164 |
| 389 | 3300047443 | Ga0495687_043516 | Ga0495687_043516_520_1014 | 164 |
| 390 | 3300047443 | Ga0495687_100726 | Ga0495687_100726_498_1040 | 164 |
| 391 | 3300047444 | Ga0495675_0004214 | Ga0495675_0004214_1605_2099 | 164 |
| 392 | 3300047444 | Ga0495675_0035036 | Ga0495675_0035036_1970_2497 | 164 |
| 393 | 3300047444 | Ga0495675_0121177 | Ga0495675_0121177_969_1496 | 164 |
| 394 | 3300047445 | Ga0495677_0108530 | Ga0495677_0108530_307_804 | 164 |
| 395 | 3300047446 | Ga0495679_000214 | Ga0495679_000214_44925_45419 | 164 |
| 396 | 3300047446 | Ga0495679_003040 | Ga0495679_003040_2266_2760 | 164 |
| 397 | 3300047446 | Ga0495679_017601 | Ga0495679_017601_41_550 | 164 |
| 398 | 3300047447 | Ga0495685_000012 | Ga0495685_000012_62199_62693 | 164 |
| 399 | 3300047469 | Ga0495673_0000016 | Ga0495673_0000016_527394_527903 | 164 |
| 400 | 3300047469 | Ga0495673_0000188 | Ga0495673_0000188_22377_22886 | 164 |
| 401 | 3300047469 | Ga0495673_0018203 | Ga0495673_0018203_1548_2042 | 164 |
| 402 | 3300047469 | Ga0495673_0040705 | Ga0495673_0040705_1448_1942 | 164 |
| 403 | 3300047469 | Ga0495673_0065863 | Ga0495673_0065863_107_601 | 164 |
| 404 | 3300047471 | Ga0495684_0104358 | Ga0495684_0104358_1623_2117 | 164 |
| 405 | 3300047472 | Ga0495686_0000380 | Ga0495686_0000380_26419_26913 | 164 |
| 406 | 3300047472 | Ga0495686_0003712 | Ga0495686_0003712_2561_3055 | 164 |
| 407 | 3300047472 | Ga0495686_0522322 | Ga0495686_0522322_112_606 | 164 |
| 408 | 3300047673 | Ga0495593_0005003 | Ga0495593_0005003_1944_2438 | 164 |
| 409 | 3300047673 | Ga0495593_0104595 | Ga0495593_0104595_384_911 | 164 |
| 410 | 3300048088 | Ga0495602_0019692 | Ga0495602_0019692_4247_4741 | 164 |
| 411 | 3300048088 | Ga0495602_0029641 | Ga0495602_0029641_1460_1954 | 164 |
| 412 | 3300048088 | Ga0495602_0057703 | Ga0495602_0057703_1348_1875 | 164 |
| 413 | 3300048088 | Ga0495602_0059801 | Ga0495602_0059801_387_881 | 164 |
| 414 | 3300048088 | Ga0495602_0167345 | Ga0495602_0167345_419_946 | 164 |
| 415 | 3300048089 | Ga0495614_0020543 | Ga0495614_0020543_1845_2339 | 164 |
| 416 | 3300048903 | Ga0496100_0010876 | Ga0496100_0010876_1885_2499 | 164 |
| 417 | 3300048903 | Ga0496100_0381858 | Ga0496100_0381858_508_1005 | 164 |
| 418 | 3300048904 | Ga0496101_0001460 | Ga0496101_0001460_6022_6636 | 164 |
| 419 | 3300048905 | Ga0496102_0000707 | Ga0496102_0000707_798_1292 | 164 |
| 420 | 3300048905 | Ga0496102_0004487 | Ga0496102_0004487_2863_3477 | 164 |
| 421 | 3300048905 | Ga0496102_0018558 | Ga0496102_0018558_34_531 | 164 |
| 422 | 3300048905 | Ga0496102_0066325 | Ga0496102_0066325_1000_1494 | 164 |
| 423 | 3300048905 | Ga0496102_0111602 | Ga0496102_0111602_1293_1787 | 164 |
| 424 | 3300048905 | Ga0496102_0394789 | Ga0496102_0394789_90_584 | 164 |
| 425 | 3300048905 | Ga0496102_1102843 | Ga0496102_1102843_34_531 | 164 |
| 426 | 3300048906 | Ga0496103_0004588 | Ga0496103_0004588_1935_2549 | 164 |
| 427 | 3300048906 | Ga0496103_0020700 | Ga0496103_0020700_1602_2096 | 164 |
| 428 | 3300048906 | Ga0496103_0086791 | Ga0496103_0086791_772_1266 | 164 |
| 429 | 3300048906 | Ga0496103_0177532 | Ga0496103_0177532_854_1351 | 164 |
| 430 | 3300048907 | Ga0496104_0065700 | Ga0496104_0065700_1477_2091 | 164 |
| 431 | 3300048908 | Ga0496105_0026370 | Ga0496105_0026370_794_1291 | 164 |
| 432 | 3300048908 | Ga0496105_0170970 | Ga0496105_0170970_1123_1737 | 164 |
| 433 | 3300048908 | Ga0496105_0766991 | Ga0496105_0766991_211_705 | 164 |
| 434 | 3300048909 | Ga0496106_0286407 | Ga0496106_0286407_346_960 | 164 |
| 435 | 3300048909 | Ga0496106_0629474 | Ga0496106_0629474_349_846 | 164 |
| 436 | 3300048909 | Ga0496106_1250164 | Ga0496106_1250164_27_521 | 164 |
| 437 | 3300048910 | Ga0496107_0351864 | Ga0496107_0351864_306_920 | 164 |
| 438 | 3300048910 | Ga0496107_0553788 | Ga0496107_0553788_303_800 | 164 |
| 439 | 3300048912 | Ga0496109_0155046 | Ga0496109_0155046_1423_1920 | 164 |
| 440 | 3300048912 | Ga0496109_0266866 | Ga0496109_0266866_580_1077 | 164 |
| 441 | 3300048912 | Ga0496109_0319202 | Ga0496109_0319202_128_742 | 164 |
| 442 | 3300048913 | Ga0496110_0073716 | Ga0496110_0073716_888_1385 | 164 |
| 443 | 3300048913 | Ga0496110_0151202 | Ga0496110_0151202_523_1020 | 164 |
| 444 | 3300048914 | Ga0496111_0216067 | Ga0496111_0216067_809_1303 | 164 |
| 445 | 3300048915 | Ga0496112_0048110 | Ga0496112_0048110_763_1305 | 164 |
| 446 | 3300048916 | Ga0496113_0009991 | Ga0496113_0009991_41_583 | 164 |
| 447 | 3300048916 | Ga0496113_0858731 | Ga0496113_0858731_17_559 | 164 |
| 448 | 3300048917 | Ga0496114_0170251 | Ga0496114_0170251_319_816 | 164 |
| 449 | 3300048917 | Ga0496114_0725604 | Ga0496114_0725604_130_624 | 164 |
| 450 | 3300048917 | Ga0496114_1306630 | Ga0496114_1306630_87_581 | 164 |
| 451 | 3300048918 | Ga0496115_0300638 | Ga0496115_0300638_756_1250 | 164 |
| 452 | 3300048919 | Ga0496116_0184601 | Ga0496116_0184601_121_735 | 164 |
| 453 | 3300048920 | Ga0496117_0000589 | Ga0496117_0000589_50133_50747 | 164 |
| 454 | 3300048920 | Ga0496117_0057428 | Ga0496117_0057428_73_567 | 164 |
| 455 | 3300048921 | Ga0496118_0001182 | Ga0496118_0001182_4770_5384 | 164 |
| 456 | 3300048921 | Ga0496118_0040248 | Ga0496118_0040248_1764_2258 | 164 |
| 457 | 3300048922 | Ga0496119_0082875 | Ga0496119_0082875_909_1523 | 164 |
| 458 | 3300048923 | Ga0496120_0059718 | Ga0496120_0059718_1327_1836 | 164 |
| 459 | 3300048923 | Ga0496120_0257976 | Ga0496120_0257976_180_794 | 164 |
| 460 | 3300048924 | Ga0496121_0003626 | Ga0496121_0003626_6068_6682 | 164 |
| 461 | 3300048924 | Ga0496121_0119168 | Ga0496121_0119168_1249_1791 | 164 |
| 462 | 3300048925 | Ga0496122_0071160 | Ga0496122_0071160_1114_1623 | 164 |
| 463 | 3300048925 | Ga0496122_0080743 | Ga0496122_0080743_464_973 | 164 |
| 464 | 3300048925 | Ga0496122_0148499 | Ga0496122_0148499_95_589 | 164 |
| 465 | 3300048926 | Ga0496123_0003912 | Ga0496123_0003912_3738_4247 | 164 |
| 466 | 3300048926 | Ga0496123_0403841 | Ga0496123_0403841_22_564 | 164 |
| 467 | 3300048927 | Ga0496124_0111582 | Ga0496124_0111582_1685_2179 | 164 |
| 468 | 3300048927 | Ga0496124_0159647 | Ga0496124_0159647_1057_1599 | 164 |
| 469 | 3300048929 | Ga0496126_0952676 | Ga0496126_0952676_62_565 | 164 |
| 470 | 3300048929 | Ga0496126_0966263 | Ga0496126_0966263_56_550 | 164 |
| 471 | 3300049459 | Ga0495678_000313 | Ga0495678_000313_694_1203 | 164 |
| 472 | 3300049459 | Ga0495678_016878 | Ga0495678_016878_2525_3019 | 164 |
| 473 | 3300049459 | Ga0495678_028632 | Ga0495678_028632_1812_2309 | 164 |
| 474 | 3300049459 | Ga0495678_114124 | Ga0495678_114124_144_638 | 164 |
| 475 | 3300049459 | Ga0495678_116120 | Ga0495678_116120_369_866 | 164 |
| 476 | 3300049460 | Ga0495682_0000879 | Ga0495682_0000879_11438_11932 | 164 |
| 477 | 3300049460 | Ga0495682_0020496 | Ga0495682_0020496_1873_2367 | 164 |
| 478 | 3300049460 | Ga0495682_0138233 | Ga0495682_0138233_210_704 | 164 |
| 479 | 3300049571 | Ga0501034_0190716 | Ga0501034_0190716_249_743 | 164 |
| 480 | 3300049665 | Ga0501227_043109 | Ga0501227_043109_608_1102 | 164 |
| 481 | 3300049668 | Ga0501233_044232 | Ga0501233_044232_48_548 | 164 |
| 482 | 3300049766 | Ga0501269_000223 | Ga0501269_000223_10582_11076 | 164 |
| 483 | 3300049775 | Ga0501279_001408 | Ga0501279_001408_782_1276 | 164 |
| 484 | 3300050489 | nmdc:mga03683_45233_c1 | nmdc:mga03683_45233_c1_1173_1667 | 164 |
| 485 | 3300050490 | nmdc:mga03n38_23196_c1 | nmdc:mga03n38_23196_c1_1135_1629 | 164 |
| 486 | 3300053077 | Ga0495601_0014286 | Ga0495601_0014286_1435_1929 | 164 |
| 487 | 3300053092 | Ga0500583_0171453 | Ga0500583_0171453_36_530 | 164 |
| 488 | 3300053111 | Ga0500572_129445 | Ga0500572_129445_107_601 | 164 |
| 489 | 3300053118 | Ga0500594_0038473 | Ga0500594_0038473_306_800 | 164 |
| 490 | 3300053119 | Ga0500595_001034 | Ga0500595_001034_11582_12076 | 164 |
| 491 | 3300053136 | Ga0500559_0412869 | Ga0500559_0412869_29_538 | 164 |
| 492 | 3300053141 | Ga0500574_000414 | Ga0500574_000414_3980_4474 | 164 |
| 493 | 3300053145 | Ga0500586_000675 | Ga0500586_000675_5857_6366 | 164 |
| 494 | 3300053145 | Ga0500586_005090 | Ga0500586_005090_1274_1783 | 164 |
| 495 | 3300053154 | Ga0500619_001380 | Ga0500619_001380_2618_3112 | 164 |
| 496 | 3300061719 | Ga0466962_0149709 | Ga0466962_0149709_305_799 | 164 |
| 497 | 3300001915 | JGI24741J21665_1000336 | JGI24741J21665_10003367 | 165 |
| 498 | 3300001979 | JGI24740J21852_10000987 | JGI24740J21852_100009877 | 165 |
| 499 | 3300001979 | JGI24740J21852_10001604 | JGI24740J21852_100016046 | 165 |
| 500 | 3300002705 | JGI25156J39149_1003822 | JGI25156J39149_10038222 | 165 |
| 501 | 3300002705 | JGI25156J39149_1025430 | JGI25156J39149_10254302 | 165 |
| 502 | 3300003752 | Ga0055539_1000123 | Ga0055539_100012311 | 165 |
| 503 | 3300003756 | Ga0055533_1004483 | Ga0055533_10044832 | 165 |
| 504 | 3300003758 | Ga0055532_1000029 | Ga0055532_100002929 | 165 |
| 505 | 3300003759 | Ga0055525_1000794 | Ga0055525_10007942 | 165 |
| 506 | 3300003763 | Ga0055529_1000376 | Ga0055529_100037629 | 165 |
| 507 | 3300005337 | Ga0070682_100510419 | Ga0070682_1005104191 | 165 |
| 508 | 3300005344 | Ga0070661_100000057 | Ga0070661_1000000578 | 165 |
| 509 | 3300005366 | Ga0070659_100001495 | Ga0070659_1000014959 | 165 |
| 510 | 3300005455 | Ga0070663_100000011 | Ga0070663_100000011126 | 165 |
| 511 | 3300005564 | Ga0070664_100000008 | Ga0070664_10000000870 | 165 |
| 512 | 3300005577 | Ga0068857_100073874 | Ga0068857_1000738742 | 165 |
| 513 | 3300005578 | Ga0068854_100000072 | Ga0068854_10000007249 | 165 |
| 514 | 3300005614 | Ga0068856_100000009 | Ga0068856_100000009103 | 165 |
| 515 | 3300005616 | Ga0068852_100145780 | Ga0068852_1001457801 | 165 |
| 516 | 3300013100 | Ga0157373_10002213 | Ga0157373_1000221310 | 165 |
| 517 | 3300013102 | Ga0157371_10000068 | Ga0157371_10000068108 | 165 |
| 518 | 3300013104 | Ga0157370_10000200 | Ga0157370_1000020052 | 165 |
| 519 | 3300013105 | Ga0157369_10019027 | Ga0157369_100190277 | 165 |
| 520 | 3300013296 | Ga0157374_10633192 | Ga0157374_106331922 | 165 |
| 521 | 3300013307 | Ga0157372_10002606 | Ga0157372_100026063 | 165 |
| 522 | 3300014497 | Ga0182008_10050334 | Ga0182008_100503342 | 165 |
| 523 | 3300015261 | Ga0182006_1001681 | Ga0182006_10016817 | 165 |
| 524 | 3300015262 | Ga0182007_10023032 | Ga0182007_100230322 | 165 |
| 525 | 3300020610 | Ga0154015_1131725 | Ga0154015_11317253 | 165 |
| 526 | 3300025224 | Ga0209784_100003 | Ga0209784_100003896 | 165 |
| 527 | 3300025224 | Ga0209784_101002 | Ga0209784_1010024 | 165 |
| 528 | 3300025225 | Ga0209566_100002 | Ga0209566_1000021850 | 165 |
| 529 | 3300025226 | Ga0209674_100008 | Ga0209674_100008335 | 165 |
| 530 | 3300025229 | Ga0209147_100002 | Ga0209147_1000021515 | 165 |
| 531 | 3300025230 | Ga0209563_100004 | Ga0209563_1000041267 | 165 |
| 532 | 3300025242 | Ga0209258_100002 | Ga0209258_1000021515 | 165 |
| 533 | 3300025253 | Ga0209677_100009 | Ga0209677_100009365 | 165 |
| 534 | 3300025254 | Ga0209148_1002765 | Ga0209148_10027655 | 165 |
| 535 | 3300025256 | Ga0209759_1001579 | Ga0209759_10015794 | 165 |
| 536 | 3300025256 | Ga0209759_1009803 | Ga0209759_10098032 | 165 |
| 537 | 3300025272 | Ga0209455_1000021 | Ga0209455_1000021102 | 165 |
| 538 | 3300025904 | Ga0207647_10179766 | Ga0207647_101797662 | 165 |
| 539 | 3300025913 | Ga0207695_10000729 | Ga0207695_1000072918 | 165 |
| 540 | 3300025920 | Ga0207649_10000334 | Ga0207649_1000033420 | 165 |
| 541 | 3300025932 | Ga0207690_10001327 | Ga0207690_1000132711 | 165 |
| 542 | 3300025945 | Ga0207679_10000001 | Ga0207679_10000001106 | 165 |
| 543 | 3300025981 | Ga0207640_10000088 | Ga0207640_1000008820 | 165 |
| 544 | 3300026067 | Ga0207678_10000001 | Ga0207678_10000001325 | 165 |
| 545 | 3300026078 | Ga0207702_10000024 | Ga0207702_1000002416 | 165 |
| 546 | 3300026116 | Ga0207674_10012499 | Ga0207674_100124992 | 165 |
| 547 | 3300028786 | Ga0307517_10002949 | Ga0307517_100029492 | 165 |
| 548 | 3300028794 | Ga0307515_10006247 | Ga0307515_1000624715 | 165 |
| 549 | 3300030521 | Ga0307511_10004324 | Ga0307511_1000432413 | 165 |
| 550 | 3300030522 | Ga0307512_10131488 | Ga0307512_101314881 | 165 |
| 551 | 3300031456 | Ga0307513_10044260 | Ga0307513_100442601 | 165 |
| 552 | 3300031507 | Ga0307509_10055843 | Ga0307509_100558435 | 165 |
| 553 | 3300031616 | Ga0307508_10017445 | Ga0307508_100174453 | 165 |
| 554 | 3300031649 | Ga0307514_10003612 | Ga0307514_100036122 | 165 |
| 555 | 3300031730 | Ga0307516_10021295 | Ga0307516_100212952 | 165 |
| 556 | 3300031838 | Ga0307518_10036168 | Ga0307518_100361683 | 165 |
| 557 | 3300031838 | Ga0307518_10051590 | Ga0307518_100515901 | 165 |
| 558 | 3300033179 | Ga0307507_10010750 | Ga0307507_100107502 | 165 |
| 559 | 3300033180 | Ga0307510_10001287 | Ga0307510_100012872 | 165 |
| 560 | 3300037418 | Ga0395900_0023490 | Ga0395900_0023490_4380_4877 | 165 |
| 561 | 3300037471 | Ga0395905_0462153 | Ga0395905_0462153_471_968 | 165 |
| 562 | 3300044650 | Ga0466986_0474690 | Ga0466986_0474690_195_692 | 165 |
| 563 | 3300044656 | Ga0466969_0141975 | Ga0466969_0141975_160_657 | 165 |
| 564 | 3300044658 | Ga0466972_0077899 | Ga0466972_0077899_322_819 | 165 |
| 565 | 3300044671 | Ga0466978_0091367 | Ga0466978_0091367_1053_1550 | 165 |
| 566 | 3300044683 | Ga0466965_0021997 | Ga0466965_0021997_1114_1611 | 165 |
| 567 | 3300044693 | Ga0466961_0001383 | Ga0466961_0001383_8524_9021 | 165 |
| 568 | 3300044706 | Ga0466964_0028264 | Ga0466964_0028264_1141_1638 | 165 |
| 569 | 3300044712 | Ga0453684_0322630 | Ga0453684_0322630_573_1076 | 165 |
| 570 | 3300044735 | Ga0466968_0045163 | Ga0466968_0045163_638_1135 | 165 |
| 571 | 3300044765 | Ga0466970_0065027 | Ga0466970_0065027_264_761 | 165 |
| 572 | 3300044842 | Ga0466957_0038958 | Ga0466957_0038958_566_1063 | 165 |
| 573 | 3300045049 | Ga0466959_0011953 | Ga0466959_0011953_4667_5164 | 165 |
| 574 | 3300045051 | Ga0451576_0128031 | Ga0451576_0128031_1630_2133 | 165 |
| 575 | 3300045976 | Ga0466967_0414218 | Ga0466967_0414218_359_856 | 165 |
| 576 | 3300048919 | Ga0496116_0216141 | Ga0496116_0216141_411_908 | 165 |
| 577 | 3300048920 | Ga0496117_0145304 | Ga0496117_0145304_708_1205 | 165 |
| 578 | 3300048928 | Ga0496125_0023589 | Ga0496125_0023589_4651_5148 | 165 |
| 579 | 3300053079 | Ga0500610_0009979 | Ga0500610_0009979_1012_1512 | 165 |
| 580 | 3300053086 | Ga0500578_0016611 | Ga0500578_0016611_1117_1617 | 165 |
| 581 | 3300053088 | Ga0500644_0085750 | Ga0500644_0085750_331_831 | 165 |
| 582 | 3300053089 | Ga0500581_003822 | Ga0500581_003822_480_980 | 165 |
| 583 | 3300053091 | Ga0500647_0002520 | Ga0500647_0002520_5828_6328 | 165 |
| 584 | 3300053092 | Ga0500583_0032061 | Ga0500583_0032061_1100_1600 | 165 |
| 585 | 3300053093 | Ga0500651_0000973 | Ga0500651_0000973_4429_4929 | 165 |
| 586 | 3300053094 | Ga0500566_0117908 | Ga0500566_0117908_356_856 | 165 |
| 587 | 3300053095 | Ga0500640_003358 | Ga0500640_003358_4199_4699 | 165 |
| 588 | 3300053097 | Ga0500648_073316 | Ga0500648_073316_1012_1512 | 165 |
| 589 | 3300053098 | Ga0500650_0002451 | Ga0500650_0002451_3489_3989 | 165 |
| 590 | 3300053099 | Ga0500654_003531 | Ga0500654_003531_1256_1756 | 165 |
| 591 | 3300053100 | Ga0500660_001827 | Ga0500660_001827_1275_1775 | 165 |
| 592 | 3300053101 | Ga0500553_000074 | Ga0500553_000074_20504_21004 | 165 |
| 593 | 3300053104 | Ga0500556_0037853 | Ga0500556_0037853_1074_1574 | 165 |
| 594 | 3300053105 | Ga0500557_026577 | Ga0500557_026577_830_1330 | 165 |
| 595 | 3300053106 | Ga0500558_000689 | Ga0500558_000689_3833_4333 | 165 |
| 596 | 3300053109 | Ga0500569_012791 | Ga0500569_012791_903_1403 | 165 |
| 597 | 3300053110 | Ga0500571_003220 | Ga0500571_003220_3239_3739 | 165 |
| 598 | 3300053112 | Ga0500575_000537 | Ga0500575_000537_5724_6224 | 165 |
| 599 | 3300053113 | Ga0500580_020038 | Ga0500580_020038_1453_1953 | 165 |
| 600 | 3300053115 | Ga0500591_000140 | Ga0500591_000140_15680_16180 | 165 |
| 601 | 3300053117 | Ga0500593_005593 | Ga0500593_005593_842_1342 | 165 |
| 602 | 3300053120 | Ga0500597_010458 | Ga0500597_010458_2181_2681 | 165 |
| 603 | 3300053122 | Ga0500608_010157 | Ga0500608_010157_1220_1720 | 165 |
| 604 | 3300053123 | Ga0500614_026292 | Ga0500614_026292_346_846 | 165 |
| 605 | 3300053124 | Ga0500617_011362 | Ga0500617_011362_2164_2664 | 165 |
| 606 | 3300053126 | Ga0500621_001981 | Ga0500621_001981_831_1331 | 165 |
| 607 | 3300053127 | Ga0500623_027327 | Ga0500623_027327_1020_1520 | 165 |
| 608 | 3300053128 | Ga0500626_003298 | Ga0500626_003298_4167_4667 | 165 |
| 609 | 3300053129 | Ga0500628_082209 | Ga0500628_082209_147_647 | 165 |
| 610 | 3300053131 | Ga0500652_002535 | Ga0500652_002535_265_765 | 165 |
| 611 | 3300053134 | Ga0500658_0186005 | Ga0500658_0186005_112_612 | 165 |
| 612 | 3300053135 | Ga0500659_0009475 | Ga0500659_0009475_1221_1721 | 165 |
| 613 | 3300053138 | Ga0500564_000460 | Ga0500564_000460_3877_4377 | 165 |
| 614 | 3300053140 | Ga0500573_0004519 | Ga0500573_0004519_2131_2631 | 165 |
| 615 | 3300053143 | Ga0500579_005172 | Ga0500579_005172_606_1106 | 165 |
| 616 | 3300053144 | Ga0500585_000271 | Ga0500585_000271_4533_5033 | 165 |
| 617 | 3300053145 | Ga0500586_122489 | Ga0500586_122489_106_606 | 165 |
| 618 | 3300053146 | Ga0500588_0013584 | Ga0500588_0013584_329_829 | 165 |
| 619 | 3300053147 | Ga0500589_013853 | Ga0500589_013853_3048_3548 | 165 |
| 620 | 3300053148 | Ga0500590_001873 | Ga0500590_001873_3923_4423 | 165 |
| 621 | 3300053149 | Ga0500600_0014131 | Ga0500600_0014131_4104_4604 | 165 |
| 622 | 3300053154 | Ga0500619_010793 | Ga0500619_010793_255_755 | 165 |
| 623 | 3300053155 | Ga0500620_108518 | Ga0500620_108518_95_595 | 165 |
| 624 | 3300053156 | Ga0500622_0052661 | Ga0500622_0052661_170_670 | 165 |
| 625 | 3300053158 | Ga0500627_0021916 | Ga0500627_0021916_1006_1506 | 165 |
| 626 | 3300053159 | Ga0500630_000154 | Ga0500630_000154_21035_21535 | 165 |
| 627 | 3300053160 | Ga0500633_0032782 | Ga0500633_0032782_798_1298 | 165 |
| 628 | 3300053161 | Ga0500634_0003669 | Ga0500634_0003669_5053_5553 | 165 |
| 629 | 3300053163 | Ga0500639_052102 | Ga0500639_052102_1343_1843 | 165 |
| 630 | 3300053177 | Ga0500636_0047670 | Ga0500636_0047670_589_1089 | 165 |
| 631 | 3300053178 | Ga0500637_0249207 | Ga0500637_0249207_431_931 | 165 |
| 632 | 3300053722 | Ga0500649_077055 | Ga0500649_077055_819_1319 | 165 |
| 633 | 3300053723 | Ga0500567_006289 | Ga0500567_006289_618_1118 | 165 |
| 634 | 3300053724 | Ga0500570_004269 | Ga0500570_004269_3209_3709 | 165 |
| 635 | 3300053725 | Ga0500576_001310 | Ga0500576_001310_2343_2843 | 165 |
| 636 | 3300053726 | Ga0500584_038898 | Ga0500584_038898_323_823 | 165 |
| 637 | 3300053728 | Ga0500657_000766 | Ga0500657_000766_8671_9171 | 165 |
| 638 | 3300053729 | Ga0500625_000446 | Ga0500625_000446_1135_1635 | 165 |
| 639 | 3300053734 | Ga0500565_030602 | Ga0500565_030602_194_694 | 165 |
| 640 | 3300061719 | Ga0466962_0088242 | Ga0466962_0088242_304_801 | 165 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2yjv-assembly1.cif.gz_A | crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb | 0.9795 | 3 | 165 |
| 3c8o-assembly1.cif.gz_B | the crystal structure of rraa from pao1 | 0.9754 | 2 | 165 |
| 2yjv-assembly1.cif.gz_A | crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb | 0.9734 | 3 | 165 |
| 1j3l-assembly1.cif.gz_A | structure of the rna-processing inhibitor rraa from thermus thermophilis | 0.9586 | 2 | 165 |
| 3c8o-assembly1.cif.gz_B | the crystal structure of rraa from pao1 | 0.9577 | 2 | 165 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6Z6G8_4_168_3.50.30.40 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9916 | 2 | 165 | 3.50.30.40 |
| af_P0A8R0_1_161_3.50.30.40 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9799 | 2 | 165 | 3.50.30.40 |
| 1j3lD00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9638 | 2 | 165 | 3.50.30.40 |
| af_P0A8R0_1_161_3.50.30.40 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.962 | 2 | 165 | 3.50.30.40 |
| 1nxjC00 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like | 0.9591 | 2 | 159 | 3.50.30.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I8FNE9-F1-model_v4 | deleted | 1 | 3 | 165 |
|
| AF-D8N4V6-F1-model_v4 | deleted | 0.9999 | 1 | 165 |
|
| AF-A0A2D6RR48-F1-model_v4 | 4-hydroxy-4-methyl-2-oxoglutarate aldolase (HMG aldolase) (EC 4.1.1.112) (EC 4.1.3.17) (Oxaloacetate decarboxylase) | 0.9978 | 3 | 165 |
GO:0008428
GO:0008948 GO:0046872 GO:0047443 GO:0051252 |
| AF-A0A6P4BKD3-F1-model_v4 | 4-hydroxy-4-methyl-2-oxoglutarate aldolase (HMG aldolase) (EC 4.1.1.112) (EC 4.1.3.17) (Oxaloacetate decarboxylase) | 0.9969 | 1 | 165 |
GO:0008428
GO:0008948 GO:0046872 GO:0047443 GO:0051252 |
| AF-A0A1J3JUG2-F1-model_v4 | 4-hydroxy-4-methyl-2-oxoglutarate aldolase (HMG aldolase) (EC 4.1.1.112) (EC 4.1.3.17) (Oxaloacetate decarboxylase) | 0.9962 | 10 | 165 |
GO:0008428
GO:0008948 GO:0046872 GO:0047443 GO:0051252 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar