F471669

General Info

Members Datasets Scaffolds Average Seq Length
640 335 640 167

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100768724|Ga0070699_1007687242
Length 180
Sequence VVCSCAELCSKESRKLHNAMSTLRPTADLCDEYGSDAQVITPGLIDFGGQCAFGGPITTLHLYEDNALVRVVLTDPGEGRVLVVDGGASLRCALVGGNLAKLAERNQWSGIVVWGAVRDVSELRQCRIGMRALAANPRKSEKSGRGQRDVPVVIGGVVVHPGYWLAADADGIIVCARQLR

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
16 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
59 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
60 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
63 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
64 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
70 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
105 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
106 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
107 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
108 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
109 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
110 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
111 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
117 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
118 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
170 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
171 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
172 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
173 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
177 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
178 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
189 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
190 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
201 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
210 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
211 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
226 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
227 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
260 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
263 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
264 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
265 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
266 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
270 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
271 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
272 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
273 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
274 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
277 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
278 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
279 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
280 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
281 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
282 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
283 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
284 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
285 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
286 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
287 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
288 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
289 3300053112 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere Metagenome Endosphere
290 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
291 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
292 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
293 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
296 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
297 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
298 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
299 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
300 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
301 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
302 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
303 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
304 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
305 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
306 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
307 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
308 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
309 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
310 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
311 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
312 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
313 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
314 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
315 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
316 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
317 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
318 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
321 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
322 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
323 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
324 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
325 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
326 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
327 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
328 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
329 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
330 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
331 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
332 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
333 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
334 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
335 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.97
Nodule 0
Rhizoplane 5.62
Rhizosphere 64.06
Stem 0
Stem Tuber 0
Unclassified 7.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000336 3300001915 Bacteria 14055
2 JGI24740J21852_10000987 3300001979 Bacteria 12709
3 JGI24740J21852_10001604 3300001979 Bacteria 10392
4 JGI25156J39149_1003822 3300002705 Bacteria 4789
5 JGI25156J39149_1025430 3300002705 Bacteria 952
6 JGI25158J39367_1000340 3300002739 Bacteria 10305
7 JGI25158J39367_1000538 3300002739 Bacteria 7643
8 JGI25150J39212_1000541 3300002774 Bacteria 15335
9 JGI25159J45721_1001185 3300002987 Bacteria 11135
10 JGI25165J46597_1000122 3300003214 Bacteria 132559
11 JGI25153J46596_10011326 3300003215 Bacteria 3950
12 rootH1_10195554 3300003316 Bacteria 1304
13 rootL2_10004113 3300003322 Bacteria 2019
14 rootL2_10103840 3300003322 Bacteria 4113
15 rootL2_10162097 3300003322 Bacteria 1678
16 JGI25160J50197_1000102 3300003354 Bacteria 82464
17 JGI25161J50226_1000788 3300003374 Bacteria 11955
18 JGI25161J50226_1006104 3300003374 Bacteria 2227
19 Ga0007409J51694_1084677 3300003575 Unclassified 1090
20 Ga0032354_1094307 3300003693 Unclassified 842
21 Ga0055538_1000048 3300003751 Bacteria 132559
22 Ga0055539_1000070 3300003752 Bacteria 132559
23 Ga0055539_1000123 3300003752 Bacteria 83036
24 Ga0055533_1000078 3300003756 Bacteria 132559
25 Ga0055533_1004483 3300003756 Bacteria 2491
26 Ga0055532_1000029 3300003758 Bacteria 232900
27 Ga0055525_1000106 3300003759 Bacteria 132559
28 Ga0055525_1000794 3300003759 Bacteria 9973
29 Ga0055529_1000376 3300003763 Bacteria 48166
30 Ga0055526_1041454 3300003771 Bacteria 1147
31 Ga0055537_1004000 3300003773 Bacteria 4342
32 Ga0055524_1002098 3300003775 Bacteria 10542
33 Ga0055524_1005941 3300003775 Bacteria 5372
34 Ga0055534_1014825 3300003784 Bacteria 1448
35 Ga0055528_1007400 3300003790 Bacteria 4858
36 Ga0055531_10006854 3300003794 Bacteria 6350
37 Ga0055541_1000050 3300003841 Bacteria 132559
38 Ga0055543_1000916 3300004625 Bacteria 13766
39 Ga0065165_1000787 3300005262 Bacteria 42471
40 Ga0065165_1002791 3300005262 Bacteria 13766
41 Ga0065165_1051609 3300005262 Bacteria 1165
42 Ga0070670_100467594 3300005331 Bacteria 1119
43 Ga0070682_100510419 3300005337 Bacteria 933
44 Ga0070660_100000687 3300005339 Bacteria 22380
45 Ga0070661_100000057 3300005344 Bacteria 87637
46 Ga0070661_100005128 3300005344 Bacteria 9024
47 Ga0070659_100001495 3300005366 Bacteria 16845
48 Ga0070659_100009975 3300005366 Bacteria 6987
49 Ga0070663_100000011 3300005455 Bacteria 146097
50 Ga0070699_100768724 3300005518 Bacteria 881
51 Ga0070664_100000008 3300005564 Bacteria 173734
52 Ga0070664_100081826 3300005564 Bacteria 2783
53 Ga0068857_100073874 3300005577 Bacteria 3038
54 Ga0068854_100000072 3300005578 Bacteria 72718
55 Ga0068854_100015327 3300005578 Bacteria 5075
56 Ga0068856_100000009 3300005614 Bacteria 181448
57 Ga0068852_100145780 3300005616 Bacteria 2196
58 Ga0070712_100330783 3300006175 Bacteria 1241
59 Ga0105244_10015596 3300009036 Bacteria 4354
60 Ga0105240_10043193 3300009093 Bacteria 5738
61 Ga0105240_11181744 3300009093 Bacteria 811
62 Ga0105237_10020612 3300009545 Bacteria 6793
63 Ga0105238_10000356 3300009551 Bacteria 49238
64 Ga0105239_10091537 3300010375 Bacteria 3356
65 Ga0157373_10002213 3300013100 Bacteria 14720
66 Ga0157371_10000068 3300013102 Bacteria 168110
67 Ga0157370_10000200 3300013104 Bacteria 75469
68 Ga0157369_10019027 3300013105 Bacteria 7690
69 Ga0157374_10633192 3300013296 Bacteria 1081
70 Ga0157372_10002606 3300013307 Bacteria 19510
71 Ga0182008_10050334 3300014497 Bacteria 2068
72 Ga0157376_10596527 3300014969 Bacteria 1099
73 Ga0182006_1001681 3300015261 Bacteria 12972
74 Ga0182006_1010262 3300015261 Bacteria 4170
75 Ga0182007_10001513 3300015262 Bacteria 12411
76 Ga0182007_10005716 3300015262 Bacteria 5421
77 Ga0182007_10023032 3300015262 Bacteria 2194
78 Ga0182005_1000637 3300015265 Bacteria 16681
79 Ga0183361_10006 3300016635 Bacteria 368532
80 Ga0154015_1131725 3300020610 Bacteria 12806
81 Ga0213872_10006910 3300021361 Bacteria 5647
82 Ga0213872_10023990 3300021361 Bacteria 2805
83 Ga0213872_10174509 3300021361 Bacteria 930
84 Ga0209760_101327 3300025207 Bacteria 2674
85 Ga0209436_100109 3300025208 Bacteria 41259
86 Ga0209784_100003 3300025224 Bacteria 1379451
87 Ga0209784_100062 3300025224 Bacteria 162240
88 Ga0209784_101002 3300025224 Bacteria 5161
89 Ga0209566_100002 3300025225 Bacteria 2614868
90 Ga0209566_100023 3300025225 Bacteria 396571
91 Ga0209674_100008 3300025226 Bacteria 1076909
92 Ga0209674_100040 3300025226 Bacteria 396571
93 Ga0209147_100002 3300025229 Bacteria 2158988
94 Ga0209563_100004 3300025230 Bacteria 1814108
95 Ga0209563_100096 3300025230 Bacteria 162240
96 Ga0207427_100948 3300025231 Bacteria 12347
97 Ga0209437_100146 3300025233 Bacteria 162240
98 Ga0209258_100002 3300025242 Bacteria 2158988
99 Ga0207425_1000001 3300025245 Bacteria 2525432
100 Ga0207425_1000304 3300025245 Bacteria 35899
101 Ga0209677_100009 3300025253 Bacteria 749530
102 Ga0209677_100058 3300025253 Bacteria 162240
103 Ga0209148_1002765 3300025254 Bacteria 5528
104 Ga0209759_1000030 3300025256 Bacteria 285649
105 Ga0209759_1001579 3300025256 Bacteria 12396
106 Ga0209759_1009803 3300025256 Bacteria 2866
107 Ga0209129_1000001 3300025258 Bacteria 1452436
108 Ga0209129_1001453 3300025258 Bacteria 13213
109 Ga0209233_1000159 3300025261 Bacteria 162240
110 Ga0209233_1026630 3300025261 Bacteria 1410
111 Ga0209565_1000902 3300025263 Bacteria 16045
112 Ga0209565_1001159 3300025263 Bacteria 12725
113 Ga0209565_1002038 3300025263 Bacteria 7780
114 Ga0209565_1004668 3300025263 Bacteria 4122
115 Ga0209455_1000021 3300025272 Bacteria 699993
116 Ga0209130_1000507 3300025284 Bacteria 39512
117 Ga0209130_1001852 3300025284 Bacteria 12138
118 Ga0209675_1000769 3300025291 Bacteria 21492
119 Ga0209675_1001368 3300025291 Bacteria 14271
120 Ga0209564_1001707 3300025295 Bacteria 20758
121 Ga0209564_1005199 3300025295 Bacteria 7536
122 Ga0209564_1007977 3300025295 Bacteria 5326
123 Ga0209758_1000073 3300025297 Bacteria 276262
124 Ga0209050_1000046 3300025298 Bacteria 386466
125 Ga0209256_1000467 3300025299 Bacteria 60978
126 Ga0209256_1002001 3300025299 Bacteria 18236
127 Ga0207426_1000125 3300025302 Bacteria 217504
128 Ga0207426_1001239 3300025302 Bacteria 22460
129 Ga0207426_1065226 3300025302 Bacteria 1033
130 Ga0209051_1018958 3300025303 Bacteria 3023
131 Ga0209257_1000068 3300025304 Bacteria 341291
132 Ga0207647_10179766 3300025904 Bacteria 1229
133 Ga0207695_10000729 3300025913 Bacteria 63923
134 Ga0207695_10016554 3300025913 Bacteria 8620
135 Ga0207695_10510095 3300025913 Bacteria 1084
136 Ga0207671_10301878 3300025914 Bacteria 1265
137 Ga0207693_10261622 3300025915 Bacteria 1356
138 Ga0207657_10002005 3300025919 Bacteria 22014
139 Ga0207649_10000334 3300025920 Bacteria 35813
140 Ga0207649_10008188 3300025920 Bacteria 5692
141 Ga0207694_10000474 3300025924 Bacteria 36659
142 Ga0207650_10227865 3300025925 Bacteria 1502
143 Ga0207690_10001327 3300025932 Bacteria 15557
144 Ga0207690_10055385 3300025932 Bacteria 2671
145 Ga0207679_10000001 3300025945 Bacteria 777444
146 Ga0207679_10015374 3300025945 Bacteria 5056
147 Ga0207679_10215439 3300025945 Bacteria 1613
148 Ga0207667_10104965 3300025949 Bacteria 2915
149 Ga0207640_10000088 3300025981 Bacteria 72802
150 Ga0207640_10069543 3300025981 Bacteria 2364
151 Ga0207678_10000001 3300026067 Bacteria 433184
152 Ga0207702_10000024 3300026078 Bacteria 187719
153 Ga0207674_10012499 3300026116 Bacteria 9486
154 Ga0207674_10149413 3300026116 Bacteria 2294
155 Ga0307517_10002949 3300028786 Eukaryota 26903
156 Ga0307515_10006247 3300028794 Eukaryota 23908
157 Ga0307511_10004324 3300030521 Eukaryota 14501
158 Ga0307512_10131488 3300030522 Eukaryota 1567
159 Ga0316177_1045075 3300030731 Bacteria 5699
160 Ga0316177_1061609 3300030731 Bacteria 2027
161 Ga0316180_1180291 3300030736 Bacteria 1553
162 Ga0316181_1266052 3300030744 Bacteria 1074
163 Ga0316182_1006372 3300030745 Bacteria 7098
164 Ga0316182_1229639 3300030745 Bacteria 744
165 Ga0307513_10044260 3300031456 Eukaryota 4877
166 Ga0307509_10055843 3300031507 Eukaryota 4193
167 Ga0307408_100000471 3300031548 Bacteria 35204
168 Ga0307408_100010708 3300031548 Bacteria 6049
169 Ga0307408_100148318 3300031548 Bacteria 1849
170 Ga0307508_10017445 3300031616 Eukaryota 6527
171 Ga0307514_10003612 3300031649 Eukaryota 14713
172 Ga0307516_10021295 3300031730 Eukaryota 6676
173 Ga0307518_10036168 3300031838 Bacteria 3588
174 Ga0307518_10051590 3300031838 Eukaryota 2989
175 Ga0307412_10424486 3300031911 Bacteria 1088
176 Ga0307416_100260964 3300032002 Bacteria 1693
177 Ga0307416_100615349 3300032002 Bacteria 1167
178 Ga0307414_10254560 3300032004 Bacteria 1461
179 Ga0307507_10010750 3300033179 Eukaryota 11728
180 Ga0307510_10001287 3300033180 Eukaryota 27361
181 Ga0395899_0000473 3300037312 Bacteria 45449
182 Ga0395899_0001163 3300037312 Bacteria 23230
183 Ga0395899_0033403 3300037312 Bacteria 3863
184 Ga0395900_0023490 3300037418 Bacteria 6310
185 Ga0395900_0080789 3300037418 Bacteria 3341
186 Ga0395900_1156177 3300037418 Bacteria 690
187 Ga0395898_0430966 3300037466 Bacteria 1256
188 Ga0395905_0000459 3300037471 Bacteria 57003
189 Ga0395905_0002580 3300037471 Bacteria 19948
190 Ga0395905_0189921 3300037471 Bacteria 1927
191 Ga0395905_0256423 3300037471 Bacteria 1633
192 Ga0395905_0300589 3300037471 Bacteria 1492
193 Ga0395905_0462153 3300037471 Bacteria 1168
194 Ga0395905_0881997 3300037471 Bacteria 798
195 Ga0395901_0000533 3300038443 Bacteria 43906
196 Ga0395901_0043187 3300038443 Bacteria 4676
197 Ga0395901_0058917 3300038443 Bacteria 3995
198 Ga0395901_0847825 3300038443 Bacteria 899
199 Ga0436361_0080172 3300039447 Bacteria 39325
200 Ga0436361_0185793 3300039447 Bacteria 6828
201 Ga0436361_0222234 3300039447 Bacteria 19124
202 Ga0436361_0458107 3300039447 Bacteria 5669
203 Ga0436361_1082846 3300039447 Bacteria 3657
204 Ga0439436_0058881 3300041404 Bacteria 1077
205 Ga0450920_048174 3300042122 Bacteria 853
206 Ga0466986_0474690 3300044650 Bacteria 708
207 Ga0466969_0141975 3300044656 Bacteria 1109
208 Ga0466972_0042176 3300044658 Bacteria 2220
209 Ga0466972_0077899 3300044658 Bacteria 1578
210 Ga0466978_0091367 3300044671 Bacteria 1896
211 Ga0466965_0021997 3300044683 Bacteria 3073
212 Ga0466966_0080591 3300044684 Bacteria 2027
213 Ga0466966_0098595 3300044684 Bacteria 1809
214 Ga0466961_0001383 3300044693 Bacteria 14990
215 Ga0466964_0028264 3300044706 Bacteria 2208
216 Ga0453684_0322630 3300044712 Bacteria 1748
217 Ga0466968_0045163 3300044735 Bacteria 1868
218 Ga0466970_0019885 3300044765 Bacteria 3484
219 Ga0466970_0065027 3300044765 Bacteria 1956
220 Ga0466970_0068583 3300044765 Bacteria 1905
221 Ga0466970_0074379 3300044765 Bacteria 1829
222 Ga0466957_0038958 3300044842 Bacteria 2866
223 Ga0466959_0011953 3300045049 Bacteria 6259
224 Ga0466959_0031492 3300045049 Bacteria 3923
225 Ga0451576_0128031 3300045051 Bacteria 2646
226 Ga0466958_0111661 3300045836 Bacteria 1707
227 Ga0466967_0414218 3300045976 Bacteria 1312
228 Ga0495617_031580 3300046452 Bacteria 1778
229 Ga0495592_0006504 3300046454 Bacteria 8704
230 Ga0495592_0100002 3300046454 Bacteria 2068
231 Ga0495603_0013539 3300046455 Bacteria 4934
232 Ga0495590_0000001 3300046457 Bacteria 762984
233 Ga0495590_0010453 3300046457 Bacteria 3488
234 Ga0495590_0082514 3300046457 Bacteria 1133
235 Ga0495591_006093 3300046458 Bacteria 5416
236 Ga0495629_0027438 3300046459 Bacteria 4041
237 Ga0495638_0000086 3300046460 Bacteria 152781
238 Ga0495638_0019285 3300046460 Bacteria 4512
239 Ga0495638_0045046 3300046460 Bacteria 2777
240 Ga0495638_0121834 3300046460 Bacteria 1540
241 Ga0495638_0126705 3300046460 Bacteria 1504
242 Ga0495638_0212249 3300046460 Bacteria 1086
243 Ga0495638_0361046 3300046460 Bacteria 764
244 Ga0495651_0011219 3300046462 Bacteria 6886
245 Ga0495651_0053629 3300046462 Bacteria 3103
246 Ga0495651_0188061 3300046462 Bacteria 1455
247 Ga0495651_0199440 3300046462 Bacteria 1401
248 Ga0495653_0032369 3300046463 Bacteria 4152
249 Ga0495653_0040273 3300046463 Bacteria 3652
250 Ga0495653_0061002 3300046463 Bacteria 2854
251 Ga0495653_0084113 3300046463 Bacteria 2344
252 Ga0495653_0541791 3300046463 Bacteria 721
253 Ga0495653_0659655 3300046463 Bacteria 638
254 Ga0495650_0000156 3300046471 Bacteria 155338
255 Ga0495650_0000837 3300046471 Bacteria 37114
256 Ga0495650_0007154 3300046471 Bacteria 6766
257 Ga0495650_0047573 3300046471 Bacteria 1793
258 Ga0495580_0027408 3300046472 Bacteria 4145
259 Ga0495580_0028061 3300046472 Bacteria 4093
260 Ga0495580_0057301 3300046472 Bacteria 2742
261 Ga0495580_0063439 3300046472 Bacteria 2591
262 Ga0495580_0256385 3300046472 Bacteria 1196
263 Ga0495582_0030048 3300046473 Bacteria 2982
264 Ga0495582_0074603 3300046473 Bacteria 1878
265 Ga0495605_0000168 3300046474 Bacteria 82889
266 Ga0495605_0049845 3300046474 Bacteria 2044
267 Ga0495639_0095302 3300046475 Bacteria 1400
268 Ga0495664_0035119 3300046477 Bacteria 2951
269 Ga0495664_0683716 3300046477 Bacteria 607
270 Ga0495584_0001459 3300046491 Bacteria 14208
271 Ga0495584_0029037 3300046491 Bacteria 2803
272 Ga0495584_0420607 3300046491 Bacteria 679
273 Ga0495585_0003521 3300046492 Bacteria 10552
274 Ga0495585_0016695 3300046492 Bacteria 4253
275 Ga0495585_0185972 3300046492 Bacteria 1065
276 Ga0495585_0243107 3300046492 Bacteria 900
277 Ga0495596_0012787 3300046500 Bacteria 3580
278 Ga0495596_0166023 3300046500 Bacteria 858
279 Ga0495607_0010595 3300046501 Bacteria 6187
280 Ga0495607_0047035 3300046501 Bacteria 2529
281 Ga0495607_0064211 3300046501 Bacteria 2074
282 Ga0495583_0000177 3300046506 Bacteria 108704
283 Ga0495583_0000532 3300046506 Bacteria 53953
284 Ga0495583_0001113 3300046506 Bacteria 29722
285 Ga0495583_0001849 3300046506 Bacteria 19724
286 Ga0495583_0013697 3300046506 Bacteria 4506
287 Ga0495606_0000864 3300046507 Bacteria 45347
288 Ga0495606_0007630 3300046507 Bacteria 9611
289 Ga0495606_0008551 3300046507 Bacteria 8860
290 Ga0495606_0018168 3300046507 Bacteria 5285
291 Ga0495606_0032639 3300046507 Bacteria 3603
292 Ga0495606_0053426 3300046507 Bacteria 2621
293 Ga0495606_0132346 3300046507 Bacteria 1481
294 Ga0495608_0000977 3300046511 Bacteria 20193
295 Ga0495608_0054657 3300046511 Bacteria 2639
296 Ga0495608_0096319 3300046511 Bacteria 1911
297 Ga0495610_0000003 3300046512 Bacteria 1203910
298 Ga0495610_0002840 3300046512 Bacteria 14090
299 Ga0495610_0010041 3300046512 Bacteria 5914
300 Ga0495616_0028164 3300046513 Bacteria 2975
301 Ga0495616_0045970 3300046513 Bacteria 2206
302 Ga0495618_0006045 3300046514 Bacteria 7350
303 Ga0495618_0006680 3300046514 Bacteria 6992
304 Ga0495618_0260017 3300046514 Bacteria 1087
305 Ga0495620_0042075 3300046515 Bacteria 1998
306 Ga0495628_0000612 3300046516 Bacteria 32753
307 Ga0495628_0001590 3300046516 Bacteria 20832
308 Ga0495628_0038220 3300046516 Bacteria 3843
309 Ga0495628_0049377 3300046516 Bacteria 3332
310 Ga0495628_0080657 3300046516 Bacteria 2528
311 Ga0495630_0037486 3300046517 Bacteria 3625
312 Ga0495630_0113181 3300046517 Bacteria 2055
313 Ga0495630_0167459 3300046517 Bacteria 1673
314 Ga0495637_0033494 3300046520 Bacteria 2256
315 Ga0495643_0000123 3300046522 Bacteria 124936
316 Ga0495643_0006019 3300046522 Bacteria 8091
317 Ga0495643_0012364 3300046522 Bacteria 5152
318 Ga0495644_0000892 3300046523 Bacteria 12360
319 Ga0495644_0001552 3300046523 Bacteria 9368
320 Ga0495648_0000001 3300046524 Bacteria 696872
321 Ga0495648_0000565 3300046524 Bacteria 39546
322 Ga0495648_0001518 3300046524 Bacteria 22730
323 Ga0495648_0011102 3300046524 Bacteria 6817
324 Ga0495648_0016985 3300046524 Bacteria 5222
325 Ga0495648_0046851 3300046524 Bacteria 2677
326 Ga0495648_0063600 3300046524 Bacteria 2177
327 Ga0495648_0087636 3300046524 Bacteria 1752
328 Ga0495648_0111419 3300046524 Bacteria 1488
329 Ga0495666_0001182 3300046526 Bacteria 12563
330 Ga0495666_0053327 3300046526 Bacteria 1941
331 Ga0495642_0002613 3300046528 Bacteria 7263
332 Ga0495642_0041788 3300046528 Bacteria 1865
333 Ga0495642_0049764 3300046528 Bacteria 1722
334 Ga0495652_0002873 3300046529 Bacteria 17371
335 Ga0495652_0003510 3300046529 Bacteria 15428
336 Ga0495652_0135377 3300046529 Bacteria 1944
337 Ga0495654_0003818 3300046530 Bacteria 9115
338 Ga0495654_0096448 3300046530 Bacteria 1366
339 Ga0495665_0110481 3300046531 Bacteria 1442
340 Ga0495665_0163969 3300046531 Bacteria 1158
341 Ga0495640_0504360 3300046533 Bacteria 736
342 Ga0495586_0122935 3300046535 Bacteria 1450
343 Ga0495587_0062522 3300046536 Bacteria 2179
344 Ga0495587_0436074 3300046536 Bacteria 726
345 Ga0495609_0000479 3300046538 Bacteria 32080
346 Ga0495609_0018085 3300046538 Bacteria 3269
347 Ga0495609_0022768 3300046538 Bacteria 2886
348 Ga0495609_0028476 3300046538 Bacteria 2549
349 Ga0495609_0103380 3300046538 Bacteria 1233
350 Ga0495621_0256799 3300046539 Bacteria 715
351 Ga0495597_0000208 3300046542 Bacteria 53439
352 Ga0495597_0002211 3300046542 Bacteria 12758
353 Ga0495597_0004990 3300046542 Bacteria 7122
354 Ga0495597_0005042 3300046542 Bacteria 7068
355 Ga0495597_0030327 3300046542 Bacteria 2465
356 Ga0495597_0051227 3300046542 Bacteria 1821
357 Ga0495597_0082665 3300046542 Bacteria 1372
358 Ga0495645_0113089 3300046543 Bacteria 1919
359 Ga0495645_0295426 3300046543 Bacteria 1060
360 Ga0495645_0316595 3300046543 Bacteria 1014
361 Ga0495622_0000028 3300046557 Bacteria 133197
362 Ga0495622_0002020 3300046557 Bacteria 9917
363 Ga0495622_0002846 3300046557 Bacteria 8255
364 Ga0495622_0121546 3300046557 Bacteria 1192
365 Ga0495622_0202054 3300046557 Bacteria 885
366 Ga0495633_0000272 3300046558 Bacteria 60512
367 Ga0495633_0002822 3300046558 Bacteria 11996
368 Ga0495633_0008566 3300046558 Bacteria 5747
369 Ga0495633_0021198 3300046558 Bacteria 3253
370 Ga0495633_0106362 3300046558 Bacteria 1301
371 Ga0495633_0319728 3300046558 Bacteria 704
372 Ga0495656_0009086 3300046615 Bacteria 3567
373 Ga0495656_0049841 3300046615 Bacteria 1785
374 Ga0495668_0000151 3300046616 Bacteria 105466
375 Ga0495668_0001575 3300046616 Bacteria 21547
376 Ga0495668_0275234 3300046616 Bacteria 922
377 Ga0495634_0009348 3300046642 Bacteria 7232
378 Ga0495611_0001352 3300046648 Bacteria 12401
379 Ga0495611_0008148 3300046648 Bacteria 4445
380 Ga0495611_0270815 3300046648 Bacteria 785
381 Ga0495625_0000480 3300046660 Bacteria 59788
382 Ga0495625_0003732 3300046660 Bacteria 14830
383 Ga0495625_0015020 3300046660 Bacteria 6152
384 Ga0495625_0052830 3300046660 Bacteria 2908
385 Ga0495625_0137311 3300046660 Bacteria 1652
386 Ga0495635_0020613 3300046663 Bacteria 4591
387 Ga0495635_0031650 3300046663 Bacteria 3671
388 Ga0495659_0000971 3300046664 Bacteria 10089
389 Ga0495659_0029997 3300046664 Bacteria 1890
390 Ga0495661_0026684 3300046665 Bacteria 3718
391 Ga0495661_0030990 3300046665 Bacteria 3400
392 Ga0495661_0041411 3300046665 Bacteria 2850
393 Ga0495661_0077657 3300046665 Bacteria 1923
394 Ga0495661_0248376 3300046665 Bacteria 909
395 Ga0495657_0071118 3300046675 Bacteria 2272
396 Ga0495657_0114487 3300046675 Bacteria 1705
397 Ga0495599_0004330 3300046678 Bacteria 8398
398 Ga0495599_0031959 3300046678 Bacteria 3303
399 Ga0495599_0099824 3300046678 Bacteria 1809
400 Ga0495623_0002700 3300046679 Bacteria 11722
401 Ga0495623_0021047 3300046679 Bacteria 4213
402 Ga0495623_0045220 3300046679 Bacteria 2797
403 Ga0495623_0129793 3300046679 Bacteria 1510
404 Ga0495646_0001994 3300046680 Bacteria 12336
405 Ga0495646_0012009 3300046680 Bacteria 5510
406 Ga0495646_0053438 3300046680 Bacteria 2435
407 Ga0495646_0095592 3300046680 Bacteria 1709
408 Ga0495646_0103192 3300046680 Bacteria 1632
409 Ga0495613_0093199 3300046689 Bacteria 2180
410 Ga0495613_0268721 3300046689 Bacteria 1187
411 Ga0495624_0008366 3300046690 Bacteria 7221
412 Ga0495624_0011605 3300046690 Bacteria 6052
413 Ga0495624_0013694 3300046690 Bacteria 5522
414 Ga0495624_0020813 3300046690 Bacteria 4358
415 Ga0495624_0080019 3300046690 Bacteria 2025
416 Ga0495670_0000597 3300046691 Bacteria 17240
417 Ga0495670_0013613 3300046691 Bacteria 3999
418 Ga0495670_0282728 3300046691 Bacteria 887
419 Ga0495671_0000001 3300046692 Bacteria 1169494
420 Ga0495671_0000108 3300046692 Bacteria 74169
421 Ga0495671_0010859 3300046692 Bacteria 5033
422 Ga0495671_0029988 3300046692 Bacteria 2788
423 Ga0495671_0055844 3300046692 Bacteria 1956
424 Ga0495671_0091672 3300046692 Bacteria 1487
425 Ga0495671_0102623 3300046692 Bacteria 1397
426 Ga0495649_0085067 3300046694 Bacteria 1688
427 Ga0495649_0106694 3300046694 Bacteria 1486
428 Ga0495649_0205872 3300046694 Bacteria 1021
429 Ga0495649_0349414 3300046694 Bacteria 747
430 Ga0495649_0385938 3300046694 Bacteria 704
431 Ga0495589_0014007 3300046794 Bacteria 4135
432 Ga0495589_0125073 3300046794 Bacteria 1236
433 Ga0495600_0000837 3300046809 Bacteria 16388
434 Ga0495600_0013225 3300046809 Bacteria 5180
435 Ga0495600_0175892 3300046809 Bacteria 1380
436 Ga0495660_0000705 3300046810 Bacteria 25643
437 Ga0495660_0013800 3300046810 Bacteria 4682
438 Ga0495660_0021450 3300046810 Bacteria 3699
439 Ga0495660_0063135 3300046810 Bacteria 1984
440 Ga0495581_0087207 3300047315 Bacteria 1809
441 Ga0495604_0001208 3300047317 Bacteria 21323
442 Ga0495604_0014180 3300047317 Bacteria 6353
443 Ga0495604_0019556 3300047317 Bacteria 5420
444 Ga0495604_0032570 3300047317 Bacteria 4130
445 Ga0495636_0005094 3300047318 Bacteria 5162
446 Ga0495636_0013359 3300047318 Bacteria 3258
447 Ga0495636_0076626 3300047318 Bacteria 1434
448 Ga0495674_0042230 3300047319 Bacteria 4068
449 Ga0495674_0064381 3300047319 Bacteria 3187
450 Ga0495674_0064980 3300047319 Bacteria 3170
451 Ga0495674_0082969 3300047319 Bacteria 2748
452 Ga0495672_0000181 3300047320 Bacteria 91278
453 Ga0495672_0008922 3300047320 Bacteria 7321
454 Ga0495672_0012839 3300047320 Bacteria 5815
455 Ga0495672_0087997 3300047320 Bacteria 1713
456 Ga0495676_0048758 3300047321 Bacteria 3411
457 Ga0495676_0063298 3300047321 Bacteria 2884
458 Ga0495680_0073946 3300047322 Bacteria 2589
459 Ga0495680_0077519 3300047322 Bacteria 2517
460 Ga0495683_0008902 3300047323 Bacteria 5356
461 Ga0495683_0013406 3300047323 Bacteria 4287
462 Ga0495683_0146551 3300047323 Bacteria 1102
463 Ga0495683_0198685 3300047323 Bacteria 905
464 Ga0495687_004715 3300047443 Bacteria 9036
465 Ga0495687_006929 3300047443 Bacteria 6817
466 Ga0495687_023617 3300047443 Bacteria 2934
467 Ga0495687_043516 3300047443 Bacteria 1955
468 Ga0495687_100726 3300047443 Bacteria 1084
469 Ga0495675_0004214 3300047444 Bacteria 8700
470 Ga0495675_0035036 3300047444 Bacteria 3206
471 Ga0495675_0121177 3300047444 Bacteria 1629
472 Ga0495677_0108530 3300047445 Bacteria 1054
473 Ga0495679_000214 3300047446 Bacteria 49621
474 Ga0495679_003040 3300047446 Bacteria 8245
475 Ga0495679_017601 3300047446 Bacteria 2555
476 Ga0495685_000012 3300047447 Bacteria 80496
477 Ga0495673_0000016 3300047469 Bacteria 580643
478 Ga0495673_0000188 3300047469 Bacteria 99425
479 Ga0495673_0018203 3300047469 Bacteria 3548
480 Ga0495673_0040705 3300047469 Bacteria 2096
481 Ga0495673_0065863 3300047469 Bacteria 1537
482 Ga0495684_0104358 3300047471 Bacteria 2142
483 Ga0495686_0000380 3300047472 Bacteria 71038
484 Ga0495686_0003712 3300047472 Bacteria 13033
485 Ga0495686_0522322 3300047472 Bacteria 623
486 Ga0495593_0005003 3300047673 Bacteria 7845
487 Ga0495593_0104595 3300047673 Bacteria 1449
488 Ga0495602_0019692 3300048088 Bacteria 6688
489 Ga0495602_0029641 3300048088 Bacteria 5204
490 Ga0495602_0057703 3300048088 Bacteria 3403
491 Ga0495602_0059801 3300048088 Bacteria 3324
492 Ga0495602_0167345 3300048088 Bacteria 1709
493 Ga0495614_0020543 3300048089 Bacteria 2854
494 Ga0496100_0010876 3300048903 Bacteria 5164
495 Ga0496100_0381858 3300048903 Bacteria 1070
496 Ga0496101_0001460 3300048904 Bacteria 14113
497 Ga0496102_0000707 3300048905 Bacteria 33079
498 Ga0496102_0004487 3300048905 Bacteria 11784
499 Ga0496102_0018558 3300048905 Bacteria 6115
500 Ga0496102_0066325 3300048905 Bacteria 3308
501 Ga0496102_0111602 3300048905 Bacteria 2549
502 Ga0496102_0394789 3300048905 Bacteria 1301
503 Ga0496102_1102843 3300048905 Bacteria 713
504 Ga0496103_0004588 3300048906 Bacteria 8365
505 Ga0496103_0020700 3300048906 Bacteria 3954
506 Ga0496103_0086791 3300048906 Bacteria 1972
507 Ga0496103_0177532 3300048906 Unclassified 1368
508 Ga0496104_0065700 3300048907 Bacteria 3443
509 Ga0496105_0026370 3300048908 Bacteria 4740
510 Ga0496105_0170970 3300048908 Bacteria 1781
511 Ga0496105_0766991 3300048908 Bacteria 735
512 Ga0496106_0286407 3300048909 Bacteria 1320
513 Ga0496106_0629474 3300048909 Bacteria 858
514 Ga0496106_1250164 3300048909 Bacteria 578
515 Ga0496107_0351864 3300048910 Bacteria 1096
516 Ga0496107_0553788 3300048910 Bacteria 852
517 Ga0496109_0155046 3300048912 Bacteria 2145
518 Ga0496109_0266866 3300048912 Bacteria 1613
519 Ga0496109_0319202 3300048912 Bacteria 1466
520 Ga0496110_0073716 3300048913 Bacteria 3029
521 Ga0496110_0151202 3300048913 Bacteria 2102
522 Ga0496111_0216067 3300048914 Bacteria 1424
523 Ga0496112_0048110 3300048915 Bacteria 4182
524 Ga0496113_0009991 3300048916 Bacteria 6256
525 Ga0496113_0858731 3300048916 Bacteria 719
526 Ga0496114_0170251 3300048917 Bacteria 1898
527 Ga0496114_0725604 3300048917 Bacteria 870
528 Ga0496114_1306630 3300048917 Bacteria 612
529 Ga0496115_0300638 3300048918 Bacteria 1315
530 Ga0496116_0184601 3300048919 Bacteria 1112
531 Ga0496116_0216141 3300048919 Bacteria 988
532 Ga0496117_0000589 3300048920 Bacteria 59852
533 Ga0496117_0057428 3300048920 Bacteria 2703
534 Ga0496117_0145304 3300048920 Bacteria 1413
535 Ga0496118_0001182 3300048921 Bacteria 40316
536 Ga0496118_0040248 3300048921 Bacteria 3718
537 Ga0496119_0082875 3300048922 Bacteria 1843
538 Ga0496120_0059718 3300048923 Bacteria 2136
539 Ga0496120_0257976 3300048923 Bacteria 815
540 Ga0496121_0003626 3300048924 Bacteria 21747
541 Ga0496121_0119168 3300048924 Bacteria 1996
542 Ga0496122_0071160 3300048925 Bacteria 2480
543 Ga0496122_0080743 3300048925 Bacteria 2266
544 Ga0496122_0148499 3300048925 Bacteria 1452
545 Ga0496123_0003912 3300048926 Bacteria 16190
546 Ga0496123_0403841 3300048926 Bacteria 621
547 Ga0496124_0111582 3300048927 Bacteria 2200
548 Ga0496124_0159647 3300048927 Bacteria 1759
549 Ga0496124_0368154 3300048927 Bacteria 1010
550 Ga0496125_0023589 3300048928 Bacteria 5675
551 Ga0496126_0952676 3300048929 Bacteria 647
552 Ga0496126_0966263 3300048929 Bacteria 641
553 Ga0495678_000313 3300049459 Bacteria 51964
554 Ga0495678_016878 3300049459 Bacteria 3322
555 Ga0495678_028632 3300049459 Bacteria 2348
556 Ga0495678_114124 3300049459 Bacteria 917
557 Ga0495678_116120 3300049459 Bacteria 905
558 Ga0495682_0000879 3300049460 Bacteria 18626
559 Ga0495682_0020496 3300049460 Bacteria 2482
560 Ga0495682_0138233 3300049460 Bacteria 870
561 Ga0501034_0190716 3300049571 Bacteria 2012
562 Ga0501227_043109 3300049665 Bacteria 1120
563 Ga0501233_044232 3300049668 Bacteria 1058
564 Ga0501269_000223 3300049766 Bacteria 16628
565 Ga0501279_001408 3300049775 Bacteria 3143
566 nmdc:mga03683_45233_c1 3300050489 Bacteria 1821
567 nmdc:mga03n38_23196_c1 3300050490 Bacteria 2521
568 Ga0495601_0014286 3300053077 Bacteria 4783
569 Ga0500610_0009979 3300053079 Eukaryota 4247
570 Ga0500578_0016611 3300053086 Eukaryota 4728
571 Ga0500644_0085750 3300053088 Eukaryota 1168
572 Ga0500581_003822 3300053089 Eukaryota 6819
573 Ga0500647_0002520 3300053091 Eukaryota 6857
574 Ga0500583_0032061 3300053092 Eukaryota 2316
575 Ga0500583_0171453 3300053092 Bacteria 1081
576 Ga0500651_0000973 3300053093 Eukaryota 14089
577 Ga0500566_0117908 3300053094 Eukaryota 1434
578 Ga0500640_003358 3300053095 Eukaryota 5570
579 Ga0500648_073316 3300053097 Eukaryota 1933
580 Ga0500650_0002451 3300053098 Eukaryota 6112
581 Ga0500654_003531 3300053099 Eukaryota 11137
582 Ga0500660_001827 3300053100 Eukaryota 10533
583 Ga0500553_000074 3300053101 Eukaryota 24889
584 Ga0500556_0037853 3300053104 Eukaryota 1680
585 Ga0500557_026577 3300053105 Eukaryota 1714
586 Ga0500558_000689 3300053106 Eukaryota 8300
587 Ga0500569_012791 3300053109 Eukaryota 2038
588 Ga0500571_003220 3300053110 Eukaryota 8339
589 Ga0500572_129445 3300053111 Bacteria 819
590 Ga0500575_000537 3300053112 Eukaryota 6814
591 Ga0500580_020038 3300053113 Eukaryota 2785
592 Ga0500591_000140 3300053115 Eukaryota 17278
593 Ga0500593_005593 3300053117 Eukaryota 4971
594 Ga0500594_0038473 3300053118 Bacteria 1296
595 Ga0500595_001034 3300053119 Bacteria 15528
596 Ga0500597_010458 3300053120 Eukaryota 3314
597 Ga0500608_010157 3300053122 Eukaryota 4031
598 Ga0500614_026292 3300053123 Eukaryota 1391
599 Ga0500617_011362 3300053124 Eukaryota 3715
600 Ga0500621_001981 3300053126 Eukaryota 5162
601 Ga0500623_027327 3300053127 Eukaryota 2958
602 Ga0500626_003298 3300053128 Eukaryota 5865
603 Ga0500628_082209 3300053129 Eukaryota 826
604 Ga0500652_002535 3300053131 Eukaryota 5507
605 Ga0500658_0186005 3300053134 Eukaryota 947
606 Ga0500659_0009475 3300053135 Eukaryota 5350
607 Ga0500559_0412869 3300053136 Bacteria 627
608 Ga0500564_000460 3300053138 Eukaryota 11876
609 Ga0500573_0004519 3300053140 Eukaryota 7350
610 Ga0500574_000414 3300053141 Bacteria 5389
611 Ga0500579_005172 3300053143 Eukaryota 7993
612 Ga0500585_000271 3300053144 Eukaryota 6307
613 Ga0500586_000675 3300053145 Bacteria 6982
614 Ga0500586_005090 3300053145 Bacteria 3298
615 Ga0500586_122489 3300053145 Eukaryota 904
616 Ga0500588_0013584 3300053146 Eukaryota 2046
617 Ga0500589_013853 3300053147 Eukaryota 3564
618 Ga0500590_001873 3300053148 Eukaryota 8952
619 Ga0500600_0014131 3300053149 Eukaryota 4856
620 Ga0500619_001380 3300053154 Bacteria 4270
621 Ga0500619_010793 3300053154 Eukaryota 2326
622 Ga0500620_108518 3300053155 Eukaryota 972
623 Ga0500622_0052661 3300053156 Eukaryota 2092
624 Ga0500627_0021916 3300053158 Eukaryota 2584
625 Ga0500630_000154 3300053159 Eukaryota 24903
626 Ga0500633_0032782 3300053160 Eukaryota 1690
627 Ga0500634_0003669 3300053161 Eukaryota 6908
628 Ga0500639_052102 3300053163 Eukaryota 2130
629 Ga0500636_0047670 3300053177 Eukaryota 2523
630 Ga0500637_0249207 3300053178 Eukaryota 991
631 Ga0500649_077055 3300053722 Eukaryota 1364
632 Ga0500567_006289 3300053723 Eukaryota 5539
633 Ga0500570_004269 3300053724 Eukaryota 7493
634 Ga0500576_001310 3300053725 Eukaryota 8209
635 Ga0500584_038898 3300053726 Eukaryota 2187
636 Ga0500657_000766 3300053728 Eukaryota 10977
637 Ga0500625_000446 3300053729 Eukaryota 11030
638 Ga0500565_030602 3300053734 Eukaryota 706
639 Ga0466962_0088242 3300061719 Bacteria 1485
640 Ga0466962_0149709 3300061719 Bacteria 1132

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100768724 Ga0070699_1007687242 160
2 3300005578 Ga0068854_100015327 Ga0068854_1000153272 163
3 3300009093 Ga0105240_10043193 Ga0105240_100431935 163
4 3300009093 Ga0105240_11181744 Ga0105240_111817442 163
5 3300009545 Ga0105237_10020612 Ga0105237_100206123 163
6 3300009551 Ga0105238_10000356 Ga0105238_1000035624 163
7 3300010375 Ga0105239_10091537 Ga0105239_100915372 163
8 3300015261 Ga0182006_1010262 Ga0182006_10102622 163
9 3300025913 Ga0207695_10016554 Ga0207695_100165542 163
10 3300025913 Ga0207695_10510095 Ga0207695_105100952 163
11 3300025914 Ga0207671_10301878 Ga0207671_103018782 163
12 3300025924 Ga0207694_10000474 Ga0207694_1000047423 163
13 3300025949 Ga0207667_10104965 Ga0207667_101049652 163
14 3300025981 Ga0207640_10069543 Ga0207640_100695432 163
15 3300026116 Ga0207674_10149413 Ga0207674_101494132 163
16 3300048927 Ga0496124_0368154 Ga0496124_0368154_389_889 163
17 3300002739 JGI25158J39367_1000340 JGI25158J39367_10003405 164
18 3300002739 JGI25158J39367_1000538 JGI25158J39367_10005386 164
19 3300002774 JGI25150J39212_1000541 JGI25150J39212_10005416 164
20 3300002987 JGI25159J45721_1001185 JGI25159J45721_10011856 164
21 3300003214 JGI25165J46597_1000122 JGI25165J46597_100012220 164
22 3300003215 JGI25153J46596_10011326 JGI25153J46596_100113264 164
23 3300003316 rootH1_10195554 rootH1_101955542 164
24 3300003322 rootL2_10004113 rootL2_100041132 164
25 3300003322 rootL2_10103840 rootL2_101038404 164
26 3300003322 rootL2_10162097 rootL2_101620973 164
27 3300003354 JGI25160J50197_1000102 JGI25160J50197_100010237 164
28 3300003374 JGI25161J50226_1000788 JGI25161J50226_10007887 164
29 3300003374 JGI25161J50226_1006104 JGI25161J50226_10061042 164
30 3300003575 Ga0007409J51694_1084677 Ga0007409J51694_10846771 164
31 3300003693 Ga0032354_1094307 Ga0032354_10943071 164
32 3300003751 Ga0055538_1000048 Ga0055538_100004820 164
33 3300003752 Ga0055539_1000070 Ga0055539_100007080 164
34 3300003756 Ga0055533_1000078 Ga0055533_100007820 164
35 3300003759 Ga0055525_1000106 Ga0055525_100010620 164
36 3300003771 Ga0055526_1041454 Ga0055526_10414541 164
37 3300003773 Ga0055537_1004000 Ga0055537_10040003 164
38 3300003775 Ga0055524_1002098 Ga0055524_10020986 164
39 3300003775 Ga0055524_1005941 Ga0055524_10059413 164
40 3300003784 Ga0055534_1014825 Ga0055534_10148252 164
41 3300003790 Ga0055528_1007400 Ga0055528_10074006 164
42 3300003794 Ga0055531_10006854 Ga0055531_100068542 164
43 3300003841 Ga0055541_1000050 Ga0055541_100005020 164
44 3300004625 Ga0055543_1000916 Ga0055543_10009168 164
45 3300005262 Ga0065165_1000787 Ga0065165_10007871 164
46 3300005262 Ga0065165_1002791 Ga0065165_10027918 164
47 3300005262 Ga0065165_1051609 Ga0065165_10516092 164
48 3300005331 Ga0070670_100467594 Ga0070670_1004675942 164
49 3300005339 Ga0070660_100000687 Ga0070660_1000006878 164
50 3300005344 Ga0070661_100005128 Ga0070661_1000051289 164
51 3300005366 Ga0070659_100009975 Ga0070659_1000099752 164
52 3300005564 Ga0070664_100081826 Ga0070664_1000818263 164
53 3300006175 Ga0070712_100330783 Ga0070712_1003307832 164
54 3300009036 Ga0105244_10015596 Ga0105244_100155962 164
55 3300014969 Ga0157376_10596527 Ga0157376_105965272 164
56 3300015262 Ga0182007_10001513 Ga0182007_1000151313 164
57 3300015262 Ga0182007_10005716 Ga0182007_100057163 164
58 3300015265 Ga0182005_1000637 Ga0182005_100063716 164
59 3300016635 Ga0183361_10006 Ga0183361_10006202 164
60 3300021361 Ga0213872_10006910 Ga0213872_100069105 164
61 3300021361 Ga0213872_10023990 Ga0213872_100239902 164
62 3300021361 Ga0213872_10174509 Ga0213872_101745092 164
63 3300025207 Ga0209760_101327 Ga0209760_1013272 164
64 3300025208 Ga0209436_100109 Ga0209436_10010911 164
65 3300025224 Ga0209784_100062 Ga0209784_10006220 164
66 3300025225 Ga0209566_100023 Ga0209566_100023241 164
67 3300025226 Ga0209674_100040 Ga0209674_100040241 164
68 3300025230 Ga0209563_100096 Ga0209563_10009620 164
69 3300025231 Ga0207427_100948 Ga0207427_1009483 164
70 3300025233 Ga0209437_100146 Ga0209437_10014620 164
71 3300025245 Ga0207425_1000001 Ga0207425_10000011299 164
72 3300025245 Ga0207425_1000304 Ga0207425_100030425 164
73 3300025253 Ga0209677_100058 Ga0209677_10005820 164
74 3300025256 Ga0209759_1000030 Ga0209759_100003046 164
75 3300025258 Ga0209129_1000001 Ga0209129_1000001476 164
76 3300025258 Ga0209129_1001453 Ga0209129_10014534 164
77 3300025261 Ga0209233_1000159 Ga0209233_100015920 164
78 3300025261 Ga0209233_1026630 Ga0209233_10266302 164
79 3300025263 Ga0209565_1000902 Ga0209565_10009026 164
80 3300025263 Ga0209565_1001159 Ga0209565_100115913 164
81 3300025263 Ga0209565_1002038 Ga0209565_10020382 164
82 3300025263 Ga0209565_1004668 Ga0209565_10046684 164
83 3300025284 Ga0209130_1000507 Ga0209130_100050725 164
84 3300025284 Ga0209130_1001852 Ga0209130_10018523 164
85 3300025291 Ga0209675_1000769 Ga0209675_100076916 164
86 3300025291 Ga0209675_1001368 Ga0209675_10013686 164
87 3300025295 Ga0209564_1001707 Ga0209564_10017074 164
88 3300025295 Ga0209564_1005199 Ga0209564_10051994 164
89 3300025295 Ga0209564_1007977 Ga0209564_10079774 164
90 3300025297 Ga0209758_1000073 Ga0209758_100007325 164
91 3300025298 Ga0209050_1000046 Ga0209050_1000046117 164
92 3300025299 Ga0209256_1000467 Ga0209256_100046759 164
93 3300025299 Ga0209256_1002001 Ga0209256_100200114 164
94 3300025302 Ga0207426_1000125 Ga0207426_1000125161 164
95 3300025302 Ga0207426_1001239 Ga0207426_100123912 164
96 3300025302 Ga0207426_1065226 Ga0207426_10652262 164
97 3300025303 Ga0209051_1018958 Ga0209051_10189582 164
98 3300025304 Ga0209257_1000068 Ga0209257_1000068213 164
99 3300025915 Ga0207693_10261622 Ga0207693_102616222 164
100 3300025919 Ga0207657_10002005 Ga0207657_1000200517 164
101 3300025920 Ga0207649_10008188 Ga0207649_100081883 164
102 3300025925 Ga0207650_10227865 Ga0207650_102278653 164
103 3300025932 Ga0207690_10055385 Ga0207690_100553852 164
104 3300025945 Ga0207679_10015374 Ga0207679_100153745 164
105 3300025945 Ga0207679_10215439 Ga0207679_102154393 164
106 3300030731 Ga0316177_1045075 Ga0316177_10450755 164
107 3300030731 Ga0316177_1061609 Ga0316177_10616093 164
108 3300030736 Ga0316180_1180291 Ga0316180_11802912 164
109 3300030744 Ga0316181_1266052 Ga0316181_12660521 164
110 3300030745 Ga0316182_1006372 Ga0316182_10063724 164
111 3300030745 Ga0316182_1229639 Ga0316182_12296391 164
112 3300031548 Ga0307408_100000471 Ga0307408_1000004715 164
113 3300031548 Ga0307408_100010708 Ga0307408_1000107083 164
114 3300031548 Ga0307408_100148318 Ga0307408_1001483181 164
115 3300031911 Ga0307412_10424486 Ga0307412_104244862 164
116 3300032002 Ga0307416_100260964 Ga0307416_1002609642 164
117 3300032002 Ga0307416_100615349 Ga0307416_1006153491 164
118 3300032004 Ga0307414_10254560 Ga0307414_102545602 164
119 3300037312 Ga0395899_0000473 Ga0395899_0000473_8548_9102 164
120 3300037312 Ga0395899_0001163 Ga0395899_0001163_18040_18534 164
121 3300037312 Ga0395899_0033403 Ga0395899_0033403_2557_3051 164
122 3300037418 Ga0395900_0080789 Ga0395900_0080789_1626_2120 164
123 3300037418 Ga0395900_1156177 Ga0395900_1156177_182_676 164
124 3300037466 Ga0395898_0430966 Ga0395898_0430966_324_818 164
125 3300037471 Ga0395905_0000459 Ga0395905_0000459_38217_38711 164
126 3300037471 Ga0395905_0002580 Ga0395905_0002580_16904_17398 164
127 3300037471 Ga0395905_0189921 Ga0395905_0189921_1370_1864 164
128 3300037471 Ga0395905_0256423 Ga0395905_0256423_114_608 164
129 3300037471 Ga0395905_0300589 Ga0395905_0300589_649_1143 164
130 3300037471 Ga0395905_0881997 Ga0395905_0881997_190_684 164
131 3300038443 Ga0395901_0000533 Ga0395901_0000533_35004_35498 164
132 3300038443 Ga0395901_0043187 Ga0395901_0043187_795_1289 164
133 3300038443 Ga0395901_0058917 Ga0395901_0058917_2742_3254 164
134 3300038443 Ga0395901_0847825 Ga0395901_0847825_68_562 164
135 3300039447 Ga0436361_0080172 Ga0436361_0080172_27930_28424 164
136 3300039447 Ga0436361_0185793 Ga0436361_0185793_4408_4902 164
137 3300039447 Ga0436361_0222234 Ga0436361_0222234_9600_10094 164
138 3300039447 Ga0436361_0458107 Ga0436361_0458107_4895_5389 164
139 3300039447 Ga0436361_1082846 Ga0436361_1082846_2323_2817 164
140 3300041404 Ga0439436_0058881 Ga0439436_0058881_282_776 164
141 3300042122 Ga0450920_048174 Ga0450920_048174_145_651 164
142 3300044658 Ga0466972_0042176 Ga0466972_0042176_912_1406 164
143 3300044684 Ga0466966_0080591 Ga0466966_0080591_457_951 164
144 3300044684 Ga0466966_0098595 Ga0466966_0098595_748_1242 164
145 3300044765 Ga0466970_0019885 Ga0466970_0019885_133_627 164
146 3300044765 Ga0466970_0068583 Ga0466970_0068583_869_1387 164
147 3300044765 Ga0466970_0074379 Ga0466970_0074379_444_938 164
148 3300045049 Ga0466959_0031492 Ga0466959_0031492_577_1071 164
149 3300045836 Ga0466958_0111661 Ga0466958_0111661_881_1375 164
150 3300046452 Ga0495617_031580 Ga0495617_031580_345_839 164
151 3300046454 Ga0495592_0006504 Ga0495592_0006504_2237_2731 164
152 3300046454 Ga0495592_0100002 Ga0495592_0100002_287_781 164
153 3300046455 Ga0495603_0013539 Ga0495603_0013539_2534_3148 164
154 3300046457 Ga0495590_0000001 Ga0495590_0000001_513271_513768 164
155 3300046457 Ga0495590_0010453 Ga0495590_0010453_1476_1970 164
156 3300046457 Ga0495590_0082514 Ga0495590_0082514_24_518 164
157 3300046458 Ga0495591_006093 Ga0495591_006093_1510_2004 164
158 3300046459 Ga0495629_0027438 Ga0495629_0027438_1798_2292 164
159 3300046460 Ga0495638_0000086 Ga0495638_0000086_48532_49029 164
160 3300046460 Ga0495638_0019285 Ga0495638_0019285_3224_3718 164
161 3300046460 Ga0495638_0045046 Ga0495638_0045046_512_1006 164
162 3300046460 Ga0495638_0121834 Ga0495638_0121834_609_1109 164
163 3300046460 Ga0495638_0126705 Ga0495638_0126705_411_920 164
164 3300046460 Ga0495638_0212249 Ga0495638_0212249_317_811 164
165 3300046460 Ga0495638_0361046 Ga0495638_0361046_100_594 164
166 3300046462 Ga0495651_0011219 Ga0495651_0011219_4225_4752 164
167 3300046462 Ga0495651_0053629 Ga0495651_0053629_662_1156 164
168 3300046462 Ga0495651_0188061 Ga0495651_0188061_183_710 164
169 3300046462 Ga0495651_0199440 Ga0495651_0199440_98_592 164
170 3300046463 Ga0495653_0032369 Ga0495653_0032369_1846_2373 164
171 3300046463 Ga0495653_0040273 Ga0495653_0040273_831_1325 164
172 3300046463 Ga0495653_0061002 Ga0495653_0061002_125_619 164
173 3300046463 Ga0495653_0084113 Ga0495653_0084113_821_1315 164
174 3300046463 Ga0495653_0541791 Ga0495653_0541791_174_701 164
175 3300046463 Ga0495653_0659655 Ga0495653_0659655_13_507 164
176 3300046471 Ga0495650_0000156 Ga0495650_0000156_15150_15659 164
177 3300046471 Ga0495650_0000837 Ga0495650_0000837_26761_27255 164
178 3300046471 Ga0495650_0007154 Ga0495650_0007154_181_678 164
179 3300046471 Ga0495650_0047573 Ga0495650_0047573_137_631 164
180 3300046472 Ga0495580_0027408 Ga0495580_0027408_1617_2111 164
181 3300046472 Ga0495580_0028061 Ga0495580_0028061_1791_2318 164
182 3300046472 Ga0495580_0057301 Ga0495580_0057301_2042_2569 164
183 3300046472 Ga0495580_0063439 Ga0495580_0063439_63_557 164
184 3300046472 Ga0495580_0256385 Ga0495580_0256385_628_1170 164
185 3300046473 Ga0495582_0030048 Ga0495582_0030048_1093_1620 164
186 3300046473 Ga0495582_0074603 Ga0495582_0074603_1066_1560 164
187 3300046474 Ga0495605_0000168 Ga0495605_0000168_25742_26245 164
188 3300046474 Ga0495605_0049845 Ga0495605_0049845_1271_1765 164
189 3300046475 Ga0495639_0095302 Ga0495639_0095302_475_972 164
190 3300046477 Ga0495664_0035119 Ga0495664_0035119_1414_1908 164
191 3300046477 Ga0495664_0683716 Ga0495664_0683716_46_540 164
192 3300046491 Ga0495584_0001459 Ga0495584_0001459_1020_1514 164
193 3300046491 Ga0495584_0029037 Ga0495584_0029037_1725_2219 164
194 3300046491 Ga0495584_0420607 Ga0495584_0420607_22_516 164
195 3300046492 Ga0495585_0003521 Ga0495585_0003521_3914_4423 164
196 3300046492 Ga0495585_0016695 Ga0495585_0016695_1276_1770 164
197 3300046492 Ga0495585_0185972 Ga0495585_0185972_160_654 164
198 3300046492 Ga0495585_0243107 Ga0495585_0243107_25_519 164
199 3300046500 Ga0495596_0012787 Ga0495596_0012787_1944_2438 164
200 3300046500 Ga0495596_0166023 Ga0495596_0166023_168_662 164
201 3300046501 Ga0495607_0010595 Ga0495607_0010595_705_1199 164
202 3300046501 Ga0495607_0047035 Ga0495607_0047035_848_1342 164
203 3300046501 Ga0495607_0064211 Ga0495607_0064211_710_1204 164
204 3300046506 Ga0495583_0000177 Ga0495583_0000177_45937_46431 164
205 3300046506 Ga0495583_0000532 Ga0495583_0000532_48730_49227 164
206 3300046506 Ga0495583_0001113 Ga0495583_0001113_711_1205 164
207 3300046506 Ga0495583_0001849 Ga0495583_0001849_13115_13609 164
208 3300046506 Ga0495583_0013697 Ga0495583_0013697_3241_3735 164
209 3300046507 Ga0495606_0000864 Ga0495606_0000864_17433_17933 164
210 3300046507 Ga0495606_0007630 Ga0495606_0007630_5204_5698 164
211 3300046507 Ga0495606_0008551 Ga0495606_0008551_7660_8154 164
212 3300046507 Ga0495606_0018168 Ga0495606_0018168_87_581 164
213 3300046507 Ga0495606_0032639 Ga0495606_0032639_2149_2643 164
214 3300046507 Ga0495606_0053426 Ga0495606_0053426_1268_1762 164
215 3300046507 Ga0495606_0132346 Ga0495606_0132346_87_581 164
216 3300046511 Ga0495608_0000977 Ga0495608_0000977_11839_12333 164
217 3300046511 Ga0495608_0054657 Ga0495608_0054657_2052_2546 164
218 3300046511 Ga0495608_0096319 Ga0495608_0096319_810_1304 164
219 3300046512 Ga0495610_0000003 Ga0495610_0000003_639159_639668 164
220 3300046512 Ga0495610_0002840 Ga0495610_0002840_13078_13578 164
221 3300046512 Ga0495610_0010041 Ga0495610_0010041_537_1031 164
222 3300046513 Ga0495616_0028164 Ga0495616_0028164_19_513 164
223 3300046513 Ga0495616_0045970 Ga0495616_0045970_462_956 164
224 3300046514 Ga0495618_0006045 Ga0495618_0006045_6689_7183 164
225 3300046514 Ga0495618_0006680 Ga0495618_0006680_3188_3682 164
226 3300046514 Ga0495618_0260017 Ga0495618_0260017_47_541 164
227 3300046515 Ga0495620_0042075 Ga0495620_0042075_1019_1513 164
228 3300046516 Ga0495628_0000612 Ga0495628_0000612_8690_9184 164
229 3300046516 Ga0495628_0001590 Ga0495628_0001590_7720_8214 164
230 3300046516 Ga0495628_0038220 Ga0495628_0038220_1894_2421 164
231 3300046516 Ga0495628_0049377 Ga0495628_0049377_1957_2484 164
232 3300046516 Ga0495628_0080657 Ga0495628_0080657_1787_2281 164
233 3300046517 Ga0495630_0037486 Ga0495630_0037486_2247_2741 164
234 3300046517 Ga0495630_0113181 Ga0495630_0113181_50_577 164
235 3300046517 Ga0495630_0167459 Ga0495630_0167459_704_1198 164
236 3300046520 Ga0495637_0033494 Ga0495637_0033494_1263_1757 164
237 3300046522 Ga0495643_0000123 Ga0495643_0000123_25228_25737 164
238 3300046522 Ga0495643_0006019 Ga0495643_0006019_6938_7435 164
239 3300046522 Ga0495643_0012364 Ga0495643_0012364_3105_3599 164
240 3300046523 Ga0495644_0000892 Ga0495644_0000892_2393_2887 164
241 3300046523 Ga0495644_0001552 Ga0495644_0001552_2306_2800 164
242 3300046524 Ga0495648_0000001 Ga0495648_0000001_249244_249741 164
243 3300046524 Ga0495648_0000565 Ga0495648_0000565_38867_39361 164
244 3300046524 Ga0495648_0001518 Ga0495648_0001518_3023_3532 164
245 3300046524 Ga0495648_0011102 Ga0495648_0011102_4635_5144 164
246 3300046524 Ga0495648_0016985 Ga0495648_0016985_877_1371 164
247 3300046524 Ga0495648_0046851 Ga0495648_0046851_791_1285 164
248 3300046524 Ga0495648_0063600 Ga0495648_0063600_770_1264 164
249 3300046524 Ga0495648_0087636 Ga0495648_0087636_797_1291 164
250 3300046524 Ga0495648_0111419 Ga0495648_0111419_962_1456 164
251 3300046526 Ga0495666_0001182 Ga0495666_0001182_6301_6795 164
252 3300046526 Ga0495666_0053327 Ga0495666_0053327_1227_1754 164
253 3300046528 Ga0495642_0002613 Ga0495642_0002613_6165_6662 164
254 3300046528 Ga0495642_0041788 Ga0495642_0041788_782_1276 164
255 3300046528 Ga0495642_0049764 Ga0495642_0049764_28_522 164
256 3300046529 Ga0495652_0002873 Ga0495652_0002873_13926_14420 164
257 3300046529 Ga0495652_0003510 Ga0495652_0003510_12707_13201 164
258 3300046529 Ga0495652_0135377 Ga0495652_0135377_1332_1826 164
259 3300046530 Ga0495654_0003818 Ga0495654_0003818_5370_5879 164
260 3300046530 Ga0495654_0096448 Ga0495654_0096448_653_1147 164
261 3300046531 Ga0495665_0110481 Ga0495665_0110481_268_819 164
262 3300046531 Ga0495665_0163969 Ga0495665_0163969_145_687 164
263 3300046533 Ga0495640_0504360 Ga0495640_0504360_104_598 164
264 3300046535 Ga0495586_0122935 Ga0495586_0122935_391_885 164
265 3300046536 Ga0495587_0062522 Ga0495587_0062522_460_954 164
266 3300046536 Ga0495587_0436074 Ga0495587_0436074_105_599 164
267 3300046538 Ga0495609_0000479 Ga0495609_0000479_12364_12858 164
268 3300046538 Ga0495609_0018085 Ga0495609_0018085_340_834 164
269 3300046538 Ga0495609_0022768 Ga0495609_0022768_372_869 164
270 3300046538 Ga0495609_0028476 Ga0495609_0028476_1635_2129 164
271 3300046538 Ga0495609_0103380 Ga0495609_0103380_237_746 164
272 3300046539 Ga0495621_0256799 Ga0495621_0256799_103_597 164
273 3300046542 Ga0495597_0000208 Ga0495597_0000208_52133_52642 164
274 3300046542 Ga0495597_0002211 Ga0495597_0002211_4592_5086 164
275 3300046542 Ga0495597_0004990 Ga0495597_0004990_750_1247 164
276 3300046542 Ga0495597_0005042 Ga0495597_0005042_2634_3128 164
277 3300046542 Ga0495597_0030327 Ga0495597_0030327_683_1177 164
278 3300046542 Ga0495597_0051227 Ga0495597_0051227_27_521 164
279 3300046542 Ga0495597_0082665 Ga0495597_0082665_227_769 164
280 3300046543 Ga0495645_0113089 Ga0495645_0113089_145_639 164
281 3300046543 Ga0495645_0295426 Ga0495645_0295426_426_920 164
282 3300046543 Ga0495645_0316595 Ga0495645_0316595_347_841 164
283 3300046557 Ga0495622_0000028 Ga0495622_0000028_25072_25566 164
284 3300046557 Ga0495622_0002020 Ga0495622_0002020_5970_6464 164
285 3300046557 Ga0495622_0002846 Ga0495622_0002846_727_1224 164
286 3300046557 Ga0495622_0121546 Ga0495622_0121546_459_953 164
287 3300046557 Ga0495622_0202054 Ga0495622_0202054_106_600 164
288 3300046558 Ga0495633_0000272 Ga0495633_0000272_48777_49274 164
289 3300046558 Ga0495633_0002822 Ga0495633_0002822_710_1204 164
290 3300046558 Ga0495633_0008566 Ga0495633_0008566_2269_2769 164
291 3300046558 Ga0495633_0021198 Ga0495633_0021198_1877_2386 164
292 3300046558 Ga0495633_0106362 Ga0495633_0106362_97_591 164
293 3300046558 Ga0495633_0319728 Ga0495633_0319728_31_525 164
294 3300046615 Ga0495656_0009086 Ga0495656_0009086_524_1018 164
295 3300046615 Ga0495656_0049841 Ga0495656_0049841_683_1177 164
296 3300046616 Ga0495668_0000151 Ga0495668_0000151_6855_7352 164
297 3300046616 Ga0495668_0001575 Ga0495668_0001575_17184_17693 164
298 3300046616 Ga0495668_0275234 Ga0495668_0275234_272_766 164
299 3300046642 Ga0495634_0009348 Ga0495634_0009348_5674_6168 164
300 3300046648 Ga0495611_0001352 Ga0495611_0001352_6730_7224 164
301 3300046648 Ga0495611_0008148 Ga0495611_0008148_1086_1580 164
302 3300046648 Ga0495611_0270815 Ga0495611_0270815_36_530 164
303 3300046660 Ga0495625_0000480 Ga0495625_0000480_6646_7143 164
304 3300046660 Ga0495625_0003732 Ga0495625_0003732_4112_4606 164
305 3300046660 Ga0495625_0015020 Ga0495625_0015020_255_749 164
306 3300046660 Ga0495625_0052830 Ga0495625_0052830_1059_1568 164
307 3300046660 Ga0495625_0137311 Ga0495625_0137311_767_1276 164
308 3300046663 Ga0495635_0020613 Ga0495635_0020613_661_1155 164
309 3300046663 Ga0495635_0031650 Ga0495635_0031650_2548_3042 164
310 3300046664 Ga0495659_0000971 Ga0495659_0000971_839_1333 164
311 3300046664 Ga0495659_0029997 Ga0495659_0029997_206_700 164
312 3300046665 Ga0495661_0026684 Ga0495661_0026684_2452_2946 164
313 3300046665 Ga0495661_0030990 Ga0495661_0030990_1021_1530 164
314 3300046665 Ga0495661_0041411 Ga0495661_0041411_406_900 164
315 3300046665 Ga0495661_0077657 Ga0495661_0077657_215_709 164
316 3300046665 Ga0495661_0248376 Ga0495661_0248376_114_608 164
317 3300046675 Ga0495657_0071118 Ga0495657_0071118_318_812 164
318 3300046675 Ga0495657_0114487 Ga0495657_0114487_647_1141 164
319 3300046678 Ga0495599_0004330 Ga0495599_0004330_7364_7858 164
320 3300046678 Ga0495599_0031959 Ga0495599_0031959_952_1479 164
321 3300046678 Ga0495599_0099824 Ga0495599_0099824_140_634 164
322 3300046679 Ga0495623_0002700 Ga0495623_0002700_5403_5897 164
323 3300046679 Ga0495623_0021047 Ga0495623_0021047_2163_2690 164
324 3300046679 Ga0495623_0045220 Ga0495623_0045220_2102_2596 164
325 3300046679 Ga0495623_0129793 Ga0495623_0129793_414_941 164
326 3300046680 Ga0495646_0001994 Ga0495646_0001994_11278_11772 164
327 3300046680 Ga0495646_0012009 Ga0495646_0012009_1655_2149 164
328 3300046680 Ga0495646_0053438 Ga0495646_0053438_330_824 164
329 3300046680 Ga0495646_0095592 Ga0495646_0095592_1063_1557 164
330 3300046680 Ga0495646_0103192 Ga0495646_0103192_581_1108 164
331 3300046689 Ga0495613_0093199 Ga0495613_0093199_810_1304 164
332 3300046689 Ga0495613_0268721 Ga0495613_0268721_324_818 164
333 3300046690 Ga0495624_0008366 Ga0495624_0008366_3479_3973 164
334 3300046690 Ga0495624_0011605 Ga0495624_0011605_1803_2330 164
335 3300046690 Ga0495624_0013694 Ga0495624_0013694_2525_3019 164
336 3300046690 Ga0495624_0020813 Ga0495624_0020813_1922_2449 164
337 3300046690 Ga0495624_0080019 Ga0495624_0080019_1182_1676 164
338 3300046691 Ga0495670_0000597 Ga0495670_0000597_6695_7189 164
339 3300046691 Ga0495670_0013613 Ga0495670_0013613_1087_1581 164
340 3300046691 Ga0495670_0282728 Ga0495670_0282728_152_646 164
341 3300046692 Ga0495671_0000001 Ga0495671_0000001_24789_25298 164
342 3300046692 Ga0495671_0000108 Ga0495671_0000108_21867_22361 164
343 3300046692 Ga0495671_0010859 Ga0495671_0010859_4372_4881 164
344 3300046692 Ga0495671_0029988 Ga0495671_0029988_784_1278 164
345 3300046692 Ga0495671_0055844 Ga0495671_0055844_1104_1613 164
346 3300046692 Ga0495671_0091672 Ga0495671_0091672_615_1109 164
347 3300046692 Ga0495671_0102623 Ga0495671_0102623_405_899 164
348 3300046694 Ga0495649_0085067 Ga0495649_0085067_256_765 164
349 3300046694 Ga0495649_0106694 Ga0495649_0106694_616_1110 164
350 3300046694 Ga0495649_0205872 Ga0495649_0205872_22_516 164
351 3300046694 Ga0495649_0349414 Ga0495649_0349414_97_591 164
352 3300046694 Ga0495649_0385938 Ga0495649_0385938_59_556 164
353 3300046794 Ga0495589_0014007 Ga0495589_0014007_877_1371 164
354 3300046794 Ga0495589_0125073 Ga0495589_0125073_100_594 164
355 3300046809 Ga0495600_0000837 Ga0495600_0000837_2508_3002 164
356 3300046809 Ga0495600_0013225 Ga0495600_0013225_492_986 164
357 3300046809 Ga0495600_0175892 Ga0495600_0175892_446_973 164
358 3300046810 Ga0495660_0000705 Ga0495660_0000705_18692_19186 164
359 3300046810 Ga0495660_0013800 Ga0495660_0013800_1394_1903 164
360 3300046810 Ga0495660_0021450 Ga0495660_0021450_486_983 164
361 3300046810 Ga0495660_0063135 Ga0495660_0063135_656_1150 164
362 3300047315 Ga0495581_0087207 Ga0495581_0087207_1036_1530 164
363 3300047317 Ga0495604_0001208 Ga0495604_0001208_8669_9163 164
364 3300047317 Ga0495604_0014180 Ga0495604_0014180_1139_1690 164
365 3300047317 Ga0495604_0019556 Ga0495604_0019556_2765_3259 164
366 3300047317 Ga0495604_0032570 Ga0495604_0032570_1699_2226 164
367 3300047318 Ga0495636_0005094 Ga0495636_0005094_2047_2541 164
368 3300047318 Ga0495636_0013359 Ga0495636_0013359_2484_2978 164
369 3300047318 Ga0495636_0076626 Ga0495636_0076626_797_1291 164
370 3300047319 Ga0495674_0042230 Ga0495674_0042230_2558_3085 164
371 3300047319 Ga0495674_0064381 Ga0495674_0064381_986_1480 164
372 3300047319 Ga0495674_0064980 Ga0495674_0064980_63_557 164
373 3300047319 Ga0495674_0082969 Ga0495674_0082969_1746_2240 164
374 3300047320 Ga0495672_0000181 Ga0495672_0000181_44626_45120 164
375 3300047320 Ga0495672_0008922 Ga0495672_0008922_757_1251 164
376 3300047320 Ga0495672_0012839 Ga0495672_0012839_4628_5137 164
377 3300047320 Ga0495672_0087997 Ga0495672_0087997_1059_1673 164
378 3300047321 Ga0495676_0048758 Ga0495676_0048758_1564_2058 164
379 3300047321 Ga0495676_0063298 Ga0495676_0063298_2224_2718 164
380 3300047322 Ga0495680_0073946 Ga0495680_0073946_810_1337 164
381 3300047322 Ga0495680_0077519 Ga0495680_0077519_1002_1529 164
382 3300047323 Ga0495683_0008902 Ga0495683_0008902_1023_1532 164
383 3300047323 Ga0495683_0013406 Ga0495683_0013406_1925_2419 164
384 3300047323 Ga0495683_0146551 Ga0495683_0146551_342_884 164
385 3300047323 Ga0495683_0198685 Ga0495683_0198685_103_597 164
386 3300047443 Ga0495687_004715 Ga0495687_004715_3092_3586 164
387 3300047443 Ga0495687_006929 Ga0495687_006929_3115_3612 164
388 3300047443 Ga0495687_023617 Ga0495687_023617_467_961 164
389 3300047443 Ga0495687_043516 Ga0495687_043516_520_1014 164
390 3300047443 Ga0495687_100726 Ga0495687_100726_498_1040 164
391 3300047444 Ga0495675_0004214 Ga0495675_0004214_1605_2099 164
392 3300047444 Ga0495675_0035036 Ga0495675_0035036_1970_2497 164
393 3300047444 Ga0495675_0121177 Ga0495675_0121177_969_1496 164
394 3300047445 Ga0495677_0108530 Ga0495677_0108530_307_804 164
395 3300047446 Ga0495679_000214 Ga0495679_000214_44925_45419 164
396 3300047446 Ga0495679_003040 Ga0495679_003040_2266_2760 164
397 3300047446 Ga0495679_017601 Ga0495679_017601_41_550 164
398 3300047447 Ga0495685_000012 Ga0495685_000012_62199_62693 164
399 3300047469 Ga0495673_0000016 Ga0495673_0000016_527394_527903 164
400 3300047469 Ga0495673_0000188 Ga0495673_0000188_22377_22886 164
401 3300047469 Ga0495673_0018203 Ga0495673_0018203_1548_2042 164
402 3300047469 Ga0495673_0040705 Ga0495673_0040705_1448_1942 164
403 3300047469 Ga0495673_0065863 Ga0495673_0065863_107_601 164
404 3300047471 Ga0495684_0104358 Ga0495684_0104358_1623_2117 164
405 3300047472 Ga0495686_0000380 Ga0495686_0000380_26419_26913 164
406 3300047472 Ga0495686_0003712 Ga0495686_0003712_2561_3055 164
407 3300047472 Ga0495686_0522322 Ga0495686_0522322_112_606 164
408 3300047673 Ga0495593_0005003 Ga0495593_0005003_1944_2438 164
409 3300047673 Ga0495593_0104595 Ga0495593_0104595_384_911 164
410 3300048088 Ga0495602_0019692 Ga0495602_0019692_4247_4741 164
411 3300048088 Ga0495602_0029641 Ga0495602_0029641_1460_1954 164
412 3300048088 Ga0495602_0057703 Ga0495602_0057703_1348_1875 164
413 3300048088 Ga0495602_0059801 Ga0495602_0059801_387_881 164
414 3300048088 Ga0495602_0167345 Ga0495602_0167345_419_946 164
415 3300048089 Ga0495614_0020543 Ga0495614_0020543_1845_2339 164
416 3300048903 Ga0496100_0010876 Ga0496100_0010876_1885_2499 164
417 3300048903 Ga0496100_0381858 Ga0496100_0381858_508_1005 164
418 3300048904 Ga0496101_0001460 Ga0496101_0001460_6022_6636 164
419 3300048905 Ga0496102_0000707 Ga0496102_0000707_798_1292 164
420 3300048905 Ga0496102_0004487 Ga0496102_0004487_2863_3477 164
421 3300048905 Ga0496102_0018558 Ga0496102_0018558_34_531 164
422 3300048905 Ga0496102_0066325 Ga0496102_0066325_1000_1494 164
423 3300048905 Ga0496102_0111602 Ga0496102_0111602_1293_1787 164
424 3300048905 Ga0496102_0394789 Ga0496102_0394789_90_584 164
425 3300048905 Ga0496102_1102843 Ga0496102_1102843_34_531 164
426 3300048906 Ga0496103_0004588 Ga0496103_0004588_1935_2549 164
427 3300048906 Ga0496103_0020700 Ga0496103_0020700_1602_2096 164
428 3300048906 Ga0496103_0086791 Ga0496103_0086791_772_1266 164
429 3300048906 Ga0496103_0177532 Ga0496103_0177532_854_1351 164
430 3300048907 Ga0496104_0065700 Ga0496104_0065700_1477_2091 164
431 3300048908 Ga0496105_0026370 Ga0496105_0026370_794_1291 164
432 3300048908 Ga0496105_0170970 Ga0496105_0170970_1123_1737 164
433 3300048908 Ga0496105_0766991 Ga0496105_0766991_211_705 164
434 3300048909 Ga0496106_0286407 Ga0496106_0286407_346_960 164
435 3300048909 Ga0496106_0629474 Ga0496106_0629474_349_846 164
436 3300048909 Ga0496106_1250164 Ga0496106_1250164_27_521 164
437 3300048910 Ga0496107_0351864 Ga0496107_0351864_306_920 164
438 3300048910 Ga0496107_0553788 Ga0496107_0553788_303_800 164
439 3300048912 Ga0496109_0155046 Ga0496109_0155046_1423_1920 164
440 3300048912 Ga0496109_0266866 Ga0496109_0266866_580_1077 164
441 3300048912 Ga0496109_0319202 Ga0496109_0319202_128_742 164
442 3300048913 Ga0496110_0073716 Ga0496110_0073716_888_1385 164
443 3300048913 Ga0496110_0151202 Ga0496110_0151202_523_1020 164
444 3300048914 Ga0496111_0216067 Ga0496111_0216067_809_1303 164
445 3300048915 Ga0496112_0048110 Ga0496112_0048110_763_1305 164
446 3300048916 Ga0496113_0009991 Ga0496113_0009991_41_583 164
447 3300048916 Ga0496113_0858731 Ga0496113_0858731_17_559 164
448 3300048917 Ga0496114_0170251 Ga0496114_0170251_319_816 164
449 3300048917 Ga0496114_0725604 Ga0496114_0725604_130_624 164
450 3300048917 Ga0496114_1306630 Ga0496114_1306630_87_581 164
451 3300048918 Ga0496115_0300638 Ga0496115_0300638_756_1250 164
452 3300048919 Ga0496116_0184601 Ga0496116_0184601_121_735 164
453 3300048920 Ga0496117_0000589 Ga0496117_0000589_50133_50747 164
454 3300048920 Ga0496117_0057428 Ga0496117_0057428_73_567 164
455 3300048921 Ga0496118_0001182 Ga0496118_0001182_4770_5384 164
456 3300048921 Ga0496118_0040248 Ga0496118_0040248_1764_2258 164
457 3300048922 Ga0496119_0082875 Ga0496119_0082875_909_1523 164
458 3300048923 Ga0496120_0059718 Ga0496120_0059718_1327_1836 164
459 3300048923 Ga0496120_0257976 Ga0496120_0257976_180_794 164
460 3300048924 Ga0496121_0003626 Ga0496121_0003626_6068_6682 164
461 3300048924 Ga0496121_0119168 Ga0496121_0119168_1249_1791 164
462 3300048925 Ga0496122_0071160 Ga0496122_0071160_1114_1623 164
463 3300048925 Ga0496122_0080743 Ga0496122_0080743_464_973 164
464 3300048925 Ga0496122_0148499 Ga0496122_0148499_95_589 164
465 3300048926 Ga0496123_0003912 Ga0496123_0003912_3738_4247 164
466 3300048926 Ga0496123_0403841 Ga0496123_0403841_22_564 164
467 3300048927 Ga0496124_0111582 Ga0496124_0111582_1685_2179 164
468 3300048927 Ga0496124_0159647 Ga0496124_0159647_1057_1599 164
469 3300048929 Ga0496126_0952676 Ga0496126_0952676_62_565 164
470 3300048929 Ga0496126_0966263 Ga0496126_0966263_56_550 164
471 3300049459 Ga0495678_000313 Ga0495678_000313_694_1203 164
472 3300049459 Ga0495678_016878 Ga0495678_016878_2525_3019 164
473 3300049459 Ga0495678_028632 Ga0495678_028632_1812_2309 164
474 3300049459 Ga0495678_114124 Ga0495678_114124_144_638 164
475 3300049459 Ga0495678_116120 Ga0495678_116120_369_866 164
476 3300049460 Ga0495682_0000879 Ga0495682_0000879_11438_11932 164
477 3300049460 Ga0495682_0020496 Ga0495682_0020496_1873_2367 164
478 3300049460 Ga0495682_0138233 Ga0495682_0138233_210_704 164
479 3300049571 Ga0501034_0190716 Ga0501034_0190716_249_743 164
480 3300049665 Ga0501227_043109 Ga0501227_043109_608_1102 164
481 3300049668 Ga0501233_044232 Ga0501233_044232_48_548 164
482 3300049766 Ga0501269_000223 Ga0501269_000223_10582_11076 164
483 3300049775 Ga0501279_001408 Ga0501279_001408_782_1276 164
484 3300050489 nmdc:mga03683_45233_c1 nmdc:mga03683_45233_c1_1173_1667 164
485 3300050490 nmdc:mga03n38_23196_c1 nmdc:mga03n38_23196_c1_1135_1629 164
486 3300053077 Ga0495601_0014286 Ga0495601_0014286_1435_1929 164
487 3300053092 Ga0500583_0171453 Ga0500583_0171453_36_530 164
488 3300053111 Ga0500572_129445 Ga0500572_129445_107_601 164
489 3300053118 Ga0500594_0038473 Ga0500594_0038473_306_800 164
490 3300053119 Ga0500595_001034 Ga0500595_001034_11582_12076 164
491 3300053136 Ga0500559_0412869 Ga0500559_0412869_29_538 164
492 3300053141 Ga0500574_000414 Ga0500574_000414_3980_4474 164
493 3300053145 Ga0500586_000675 Ga0500586_000675_5857_6366 164
494 3300053145 Ga0500586_005090 Ga0500586_005090_1274_1783 164
495 3300053154 Ga0500619_001380 Ga0500619_001380_2618_3112 164
496 3300061719 Ga0466962_0149709 Ga0466962_0149709_305_799 164
497 3300001915 JGI24741J21665_1000336 JGI24741J21665_10003367 165
498 3300001979 JGI24740J21852_10000987 JGI24740J21852_100009877 165
499 3300001979 JGI24740J21852_10001604 JGI24740J21852_100016046 165
500 3300002705 JGI25156J39149_1003822 JGI25156J39149_10038222 165
501 3300002705 JGI25156J39149_1025430 JGI25156J39149_10254302 165
502 3300003752 Ga0055539_1000123 Ga0055539_100012311 165
503 3300003756 Ga0055533_1004483 Ga0055533_10044832 165
504 3300003758 Ga0055532_1000029 Ga0055532_100002929 165
505 3300003759 Ga0055525_1000794 Ga0055525_10007942 165
506 3300003763 Ga0055529_1000376 Ga0055529_100037629 165
507 3300005337 Ga0070682_100510419 Ga0070682_1005104191 165
508 3300005344 Ga0070661_100000057 Ga0070661_1000000578 165
509 3300005366 Ga0070659_100001495 Ga0070659_1000014959 165
510 3300005455 Ga0070663_100000011 Ga0070663_100000011126 165
511 3300005564 Ga0070664_100000008 Ga0070664_10000000870 165
512 3300005577 Ga0068857_100073874 Ga0068857_1000738742 165
513 3300005578 Ga0068854_100000072 Ga0068854_10000007249 165
514 3300005614 Ga0068856_100000009 Ga0068856_100000009103 165
515 3300005616 Ga0068852_100145780 Ga0068852_1001457801 165
516 3300013100 Ga0157373_10002213 Ga0157373_1000221310 165
517 3300013102 Ga0157371_10000068 Ga0157371_10000068108 165
518 3300013104 Ga0157370_10000200 Ga0157370_1000020052 165
519 3300013105 Ga0157369_10019027 Ga0157369_100190277 165
520 3300013296 Ga0157374_10633192 Ga0157374_106331922 165
521 3300013307 Ga0157372_10002606 Ga0157372_100026063 165
522 3300014497 Ga0182008_10050334 Ga0182008_100503342 165
523 3300015261 Ga0182006_1001681 Ga0182006_10016817 165
524 3300015262 Ga0182007_10023032 Ga0182007_100230322 165
525 3300020610 Ga0154015_1131725 Ga0154015_11317253 165
526 3300025224 Ga0209784_100003 Ga0209784_100003896 165
527 3300025224 Ga0209784_101002 Ga0209784_1010024 165
528 3300025225 Ga0209566_100002 Ga0209566_1000021850 165
529 3300025226 Ga0209674_100008 Ga0209674_100008335 165
530 3300025229 Ga0209147_100002 Ga0209147_1000021515 165
531 3300025230 Ga0209563_100004 Ga0209563_1000041267 165
532 3300025242 Ga0209258_100002 Ga0209258_1000021515 165
533 3300025253 Ga0209677_100009 Ga0209677_100009365 165
534 3300025254 Ga0209148_1002765 Ga0209148_10027655 165
535 3300025256 Ga0209759_1001579 Ga0209759_10015794 165
536 3300025256 Ga0209759_1009803 Ga0209759_10098032 165
537 3300025272 Ga0209455_1000021 Ga0209455_1000021102 165
538 3300025904 Ga0207647_10179766 Ga0207647_101797662 165
539 3300025913 Ga0207695_10000729 Ga0207695_1000072918 165
540 3300025920 Ga0207649_10000334 Ga0207649_1000033420 165
541 3300025932 Ga0207690_10001327 Ga0207690_1000132711 165
542 3300025945 Ga0207679_10000001 Ga0207679_10000001106 165
543 3300025981 Ga0207640_10000088 Ga0207640_1000008820 165
544 3300026067 Ga0207678_10000001 Ga0207678_10000001325 165
545 3300026078 Ga0207702_10000024 Ga0207702_1000002416 165
546 3300026116 Ga0207674_10012499 Ga0207674_100124992 165
547 3300028786 Ga0307517_10002949 Ga0307517_100029492 165
548 3300028794 Ga0307515_10006247 Ga0307515_1000624715 165
549 3300030521 Ga0307511_10004324 Ga0307511_1000432413 165
550 3300030522 Ga0307512_10131488 Ga0307512_101314881 165
551 3300031456 Ga0307513_10044260 Ga0307513_100442601 165
552 3300031507 Ga0307509_10055843 Ga0307509_100558435 165
553 3300031616 Ga0307508_10017445 Ga0307508_100174453 165
554 3300031649 Ga0307514_10003612 Ga0307514_100036122 165
555 3300031730 Ga0307516_10021295 Ga0307516_100212952 165
556 3300031838 Ga0307518_10036168 Ga0307518_100361683 165
557 3300031838 Ga0307518_10051590 Ga0307518_100515901 165
558 3300033179 Ga0307507_10010750 Ga0307507_100107502 165
559 3300033180 Ga0307510_10001287 Ga0307510_100012872 165
560 3300037418 Ga0395900_0023490 Ga0395900_0023490_4380_4877 165
561 3300037471 Ga0395905_0462153 Ga0395905_0462153_471_968 165
562 3300044650 Ga0466986_0474690 Ga0466986_0474690_195_692 165
563 3300044656 Ga0466969_0141975 Ga0466969_0141975_160_657 165
564 3300044658 Ga0466972_0077899 Ga0466972_0077899_322_819 165
565 3300044671 Ga0466978_0091367 Ga0466978_0091367_1053_1550 165
566 3300044683 Ga0466965_0021997 Ga0466965_0021997_1114_1611 165
567 3300044693 Ga0466961_0001383 Ga0466961_0001383_8524_9021 165
568 3300044706 Ga0466964_0028264 Ga0466964_0028264_1141_1638 165
569 3300044712 Ga0453684_0322630 Ga0453684_0322630_573_1076 165
570 3300044735 Ga0466968_0045163 Ga0466968_0045163_638_1135 165
571 3300044765 Ga0466970_0065027 Ga0466970_0065027_264_761 165
572 3300044842 Ga0466957_0038958 Ga0466957_0038958_566_1063 165
573 3300045049 Ga0466959_0011953 Ga0466959_0011953_4667_5164 165
574 3300045051 Ga0451576_0128031 Ga0451576_0128031_1630_2133 165
575 3300045976 Ga0466967_0414218 Ga0466967_0414218_359_856 165
576 3300048919 Ga0496116_0216141 Ga0496116_0216141_411_908 165
577 3300048920 Ga0496117_0145304 Ga0496117_0145304_708_1205 165
578 3300048928 Ga0496125_0023589 Ga0496125_0023589_4651_5148 165
579 3300053079 Ga0500610_0009979 Ga0500610_0009979_1012_1512 165
580 3300053086 Ga0500578_0016611 Ga0500578_0016611_1117_1617 165
581 3300053088 Ga0500644_0085750 Ga0500644_0085750_331_831 165
582 3300053089 Ga0500581_003822 Ga0500581_003822_480_980 165
583 3300053091 Ga0500647_0002520 Ga0500647_0002520_5828_6328 165
584 3300053092 Ga0500583_0032061 Ga0500583_0032061_1100_1600 165
585 3300053093 Ga0500651_0000973 Ga0500651_0000973_4429_4929 165
586 3300053094 Ga0500566_0117908 Ga0500566_0117908_356_856 165
587 3300053095 Ga0500640_003358 Ga0500640_003358_4199_4699 165
588 3300053097 Ga0500648_073316 Ga0500648_073316_1012_1512 165
589 3300053098 Ga0500650_0002451 Ga0500650_0002451_3489_3989 165
590 3300053099 Ga0500654_003531 Ga0500654_003531_1256_1756 165
591 3300053100 Ga0500660_001827 Ga0500660_001827_1275_1775 165
592 3300053101 Ga0500553_000074 Ga0500553_000074_20504_21004 165
593 3300053104 Ga0500556_0037853 Ga0500556_0037853_1074_1574 165
594 3300053105 Ga0500557_026577 Ga0500557_026577_830_1330 165
595 3300053106 Ga0500558_000689 Ga0500558_000689_3833_4333 165
596 3300053109 Ga0500569_012791 Ga0500569_012791_903_1403 165
597 3300053110 Ga0500571_003220 Ga0500571_003220_3239_3739 165
598 3300053112 Ga0500575_000537 Ga0500575_000537_5724_6224 165
599 3300053113 Ga0500580_020038 Ga0500580_020038_1453_1953 165
600 3300053115 Ga0500591_000140 Ga0500591_000140_15680_16180 165
601 3300053117 Ga0500593_005593 Ga0500593_005593_842_1342 165
602 3300053120 Ga0500597_010458 Ga0500597_010458_2181_2681 165
603 3300053122 Ga0500608_010157 Ga0500608_010157_1220_1720 165
604 3300053123 Ga0500614_026292 Ga0500614_026292_346_846 165
605 3300053124 Ga0500617_011362 Ga0500617_011362_2164_2664 165
606 3300053126 Ga0500621_001981 Ga0500621_001981_831_1331 165
607 3300053127 Ga0500623_027327 Ga0500623_027327_1020_1520 165
608 3300053128 Ga0500626_003298 Ga0500626_003298_4167_4667 165
609 3300053129 Ga0500628_082209 Ga0500628_082209_147_647 165
610 3300053131 Ga0500652_002535 Ga0500652_002535_265_765 165
611 3300053134 Ga0500658_0186005 Ga0500658_0186005_112_612 165
612 3300053135 Ga0500659_0009475 Ga0500659_0009475_1221_1721 165
613 3300053138 Ga0500564_000460 Ga0500564_000460_3877_4377 165
614 3300053140 Ga0500573_0004519 Ga0500573_0004519_2131_2631 165
615 3300053143 Ga0500579_005172 Ga0500579_005172_606_1106 165
616 3300053144 Ga0500585_000271 Ga0500585_000271_4533_5033 165
617 3300053145 Ga0500586_122489 Ga0500586_122489_106_606 165
618 3300053146 Ga0500588_0013584 Ga0500588_0013584_329_829 165
619 3300053147 Ga0500589_013853 Ga0500589_013853_3048_3548 165
620 3300053148 Ga0500590_001873 Ga0500590_001873_3923_4423 165
621 3300053149 Ga0500600_0014131 Ga0500600_0014131_4104_4604 165
622 3300053154 Ga0500619_010793 Ga0500619_010793_255_755 165
623 3300053155 Ga0500620_108518 Ga0500620_108518_95_595 165
624 3300053156 Ga0500622_0052661 Ga0500622_0052661_170_670 165
625 3300053158 Ga0500627_0021916 Ga0500627_0021916_1006_1506 165
626 3300053159 Ga0500630_000154 Ga0500630_000154_21035_21535 165
627 3300053160 Ga0500633_0032782 Ga0500633_0032782_798_1298 165
628 3300053161 Ga0500634_0003669 Ga0500634_0003669_5053_5553 165
629 3300053163 Ga0500639_052102 Ga0500639_052102_1343_1843 165
630 3300053177 Ga0500636_0047670 Ga0500636_0047670_589_1089 165
631 3300053178 Ga0500637_0249207 Ga0500637_0249207_431_931 165
632 3300053722 Ga0500649_077055 Ga0500649_077055_819_1319 165
633 3300053723 Ga0500567_006289 Ga0500567_006289_618_1118 165
634 3300053724 Ga0500570_004269 Ga0500570_004269_3209_3709 165
635 3300053725 Ga0500576_001310 Ga0500576_001310_2343_2843 165
636 3300053726 Ga0500584_038898 Ga0500584_038898_323_823 165
637 3300053728 Ga0500657_000766 Ga0500657_000766_8671_9171 165
638 3300053729 Ga0500625_000446 Ga0500625_000446_1135_1635 165
639 3300053734 Ga0500565_030602 Ga0500565_030602_194_694 165
640 3300061719 Ga0466962_0088242 Ga0466962_0088242_304_801 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03737

RraA-like

Aldolase/RraA

26

174

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yjv-assembly1.cif.gz_A crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb 0.9795 3 165
3c8o-assembly1.cif.gz_B the crystal structure of rraa from pao1 0.9754 2 165
2yjv-assembly1.cif.gz_A crystal structure of e. coli regulator of ribonuclease activity a (rraa) bound to fragment of dead-box protein rhlb 0.9734 3 165
1j3l-assembly1.cif.gz_A structure of the rna-processing inhibitor rraa from thermus thermophilis 0.9586 2 165
3c8o-assembly1.cif.gz_B the crystal structure of rraa from pao1 0.9577 2 165
ID Description Score Start End Superfamily
af_Q6Z6G8_4_168_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9916 2 165 3.50.30.40
af_P0A8R0_1_161_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9799 2 165 3.50.30.40
1j3lD00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9638 2 165 3.50.30.40
af_P0A8R0_1_161_3.50.30.40 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.962 2 165 3.50.30.40
1nxjC00 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Ribonuclease E inhibitor RraA/RraA-like 0.9591 2 159 3.50.30.40
ID Description Score Start End GO Terms
AF-A0A7I8FNE9-F1-model_v4 deleted 1 3 165
AF-D8N4V6-F1-model_v4 deleted 0.9999 1 165
AF-A0A2D6RR48-F1-model_v4 4-hydroxy-4-methyl-2-oxoglutarate aldolase (HMG aldolase) (EC 4.1.1.112) (EC 4.1.3.17) (Oxaloacetate decarboxylase) 0.9978 3 165 GO:0008428
GO:0008948
GO:0046872
GO:0047443
GO:0051252
AF-A0A6P4BKD3-F1-model_v4 4-hydroxy-4-methyl-2-oxoglutarate aldolase (HMG aldolase) (EC 4.1.1.112) (EC 4.1.3.17) (Oxaloacetate decarboxylase) 0.9969 1 165 GO:0008428
GO:0008948
GO:0046872
GO:0047443
GO:0051252
AF-A0A1J3JUG2-F1-model_v4 4-hydroxy-4-methyl-2-oxoglutarate aldolase (HMG aldolase) (EC 4.1.1.112) (EC 4.1.3.17) (Oxaloacetate decarboxylase) 0.9962 10 165 GO:0008428
GO:0008948
GO:0046872
GO:0047443
GO:0051252

Feature Viewer

pLDDT pTM Quality
96.55 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map