F471165

General Info

Members Datasets Scaffolds Average Seq Length
634 329 1268 263

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10020435|Ga0182008_100204353
Length 293
Sequence MNIRTLLEKYSSGELSIDEVQRQISIDSIKMVGNNFAQLDIDREIRKEVPEVVFAKGKEYKDILRIVLASLSRNKQVVVSKIQVGHIHKLCNILRKKNLSIEIGKKSTTILVTDSSSGKRISRVGGGKIGILAAGTSDIGIAEEARLVAKAMGCETILSYDVGIAGIHRIFPALEEMMSDKVSAIVVVAGMEGALASVVSSMVNIPVIGVPTSVGYGFGSDGVAALASMLQTCTFGLAVVNIDNGIGGGAFAALIATQRVRSILNAPAGNNYTIRPKETESEAGYGKRRNKNR

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
157 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
158 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
161 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
198 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
201 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
202 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
203 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
204 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
205 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
208 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
209 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
210 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
214 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
237 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
238 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
239 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
240 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
257 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
267 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
268 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
269 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
270 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
271 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
272 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
273 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
274 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
275 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
276 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
277 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
278 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
279 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
280 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
281 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
282 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
283 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
284 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
285 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
286 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
287 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
288 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
289 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
290 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
291 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
294 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
295 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
296 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
297 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
298 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
299 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
300 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
301 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
302 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
303 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
304 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
305 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
306 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
311 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
312 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
313 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
314 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
315 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
316 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
317 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
318 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
319 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
322 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
323 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
324 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.37
Rhizosphere 97.48
Stem 0
Stem Tuber 0
Unclassified 5.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10020435 3300014497 Archaea 3410
2 SwRhRL3b_contig_681274 2162886006 Archaea 1460
3 SwRhRL2b_contig_1613685 2162886007 Archaea 3119
4 SwRhRL2b_contig_722707 2162886007 Archaea 1752
5 MRS1b_contig_23994 2162886011 Archaea 2253
6 JGI24737J22298_10006557 3300001990 Archaea 3969
7 JGI24743J22301_10024950 3300001991 Archaea 1156
8 JGI24744J21845_10004131 3300002077 Archaea 2995
9 JGI24033J26618_1004191 3300002155 Archaea 1548
10 JGI24742J22300_10013406 3300002244 Archaea 1371
11 rootH1_10187853 3300003316 Archaea 1899
12 JGI25407J50210_10000178 3300003373 Archaea 10431
13 Ga0058861_10150217 3300004800 Bacteria 4102
14 Ga0065704_10001129 3300005289 Bacteria 23046
15 Ga0065704_10012315 3300005289 Archaea 3964
16 Ga0065704_10087136 3300005289 Archaea 3052
17 Ga0065712_10000822 3300005290 Archaea 9773
18 Ga0065715_10000273 3300005293 Archaea 29813
19 Ga0065707_10085330 3300005295 Bacteria 6246
20 Ga0070676_10003895 3300005328 Archaea 7831
21 Ga0070676_10058153 3300005328 Archaea 2290
22 Ga0070676_10067855 3300005328 Archaea 2133
23 Ga0070683_100016315 3300005329 Bacteria 6549
24 Ga0070683_100055521 3300005329 Archaea 3676
25 Ga0070683_100196148 3300005329 Archaea 1917
26 Ga0070683_100377209 3300005329 Archaea 1351
27 Ga0070670_100047954 3300005331 Archaea 3676
28 Ga0070670_100117515 3300005331 Archaea 2293
29 Ga0070670_100291841 3300005331 Archaea 1425
30 Ga0070670_100547335 3300005331 Archaea 1032
31 Ga0070677_10003471 3300005333 Bacteria 5086
32 Ga0068869_100009891 3300005334 Archaea 6195
33 Ga0070680_100002858 3300005336 Archaea 12821
34 Ga0070680_100081965 3300005336 Archaea 2662
35 Ga0070682_100003552 3300005337 Archaea 8628
36 Ga0070682_100006358 3300005337 Bacteria 6634
37 Ga0070682_100328026 3300005337 Archaea 1133
38 Ga0068868_100013571 3300005338 Archaea 5979
39 Ga0068868_100040227 3300005338 Archaea 3638
40 Ga0068868_100176412 3300005338 Bacteria 1771
41 Ga0070689_100506356 3300005340 Archaea 1035
42 Ga0070691_10048755 3300005341 Bacteria 2016
43 Ga0070687_100047843 3300005343 Unclassified 2196
44 Ga0070661_100176069 3300005344 Bacteria 1626
45 Ga0070692_10015803 3300005345 Unclassified 3578
46 Ga0070692_10030474 3300005345 Archaea 2697
47 Ga0070692_10049877 3300005345 Unclassified 2172
48 Ga0070668_100013188 3300005347 Bacteria 6162
49 Ga0070674_100262754 3300005356 Archaea 1361
50 Ga0070673_100020725 3300005364 Unclassified 4746
51 Ga0070688_100338622 3300005365 Archaea 1098
52 Ga0070709_10034722 3300005434 Archaea 3059
53 Ga0070709_10096931 3300005434 Archaea 1957
54 Ga0070713_100015608 3300005436 Archaea 5688
55 Ga0070710_10014860 3300005437 Archaea 3926
56 Ga0070710_10100101 3300005437 Archaea 1724
57 Ga0070710_10219307 3300005437 Archaea 1209
58 Ga0070701_10153551 3300005438 Archaea 1328
59 Ga0070711_100001696 3300005439 Archaea 12205
60 Ga0070711_100003753 3300005439 Archaea 8911
61 Ga0070711_100012425 3300005439 Archaea 5319
62 Ga0070711_100063046 3300005439 Archaea 2586
63 Ga0070711_100085062 3300005439 Archaea 2264
64 Ga0070711_100141701 3300005439 Archaea 1803
65 Ga0070711_100148466 3300005439 Archaea 1765
66 Ga0070711_100471964 3300005439 Archaea 1030
67 Ga0070711_100612967 3300005439 Archaea 909
68 Ga0070705_100001944 3300005440 Archaea 10591
69 Ga0070700_100113430 3300005441 Archaea 1806
70 Ga0070700_100606461 3300005441 Archaea 858
71 Ga0070694_100000060 3300005444 Archaea 51746
72 Ga0070694_100083027 3300005444 Archaea 2232
73 Ga0070694_100089726 3300005444 Archaea 2154
74 Ga0070663_100046412 3300005455 Archaea 3074
75 Ga0070678_100032793 3300005456 Archaea 3599
76 Ga0070678_100038951 3300005456 Bacteria 3350
77 Ga0070681_10004919 3300005458 Archaea 12833
78 Ga0070681_10136986 3300005458 Archaea 2378
79 Ga0068867_100004493 3300005459 Archaea 9801
80 Ga0068867_100071121 3300005459 Archaea 2602
81 Ga0070685_10453429 3300005466 Archaea 899
82 Ga0070707_100050874 3300005468 Archaea 3972
83 Ga0070698_100000735 3300005471 Archaea 35249
84 Ga0070699_100088984 3300005518 Archaea 2697
85 Ga0070699_100270459 3300005518 Archaea 1521
86 Ga0070679_100150417 3300005530 Archaea 2305
87 Ga0070684_100003852 3300005535 Unclassified 11350
88 Ga0070684_100120724 3300005535 Archaea 2358
89 Ga0070684_100196528 3300005535 Archaea 1837
90 Ga0070697_100010266 3300005536 Bacteria 7298
91 Ga0070672_100026374 3300005543 Archaea 4323
92 Ga0070672_100502585 3300005543 Archaea 1049
93 Ga0070686_100025123 3300005544 Archaea 3580
94 Ga0070686_100215081 3300005544 Archaea 1386
95 Ga0070696_100003718 3300005546 Archaea 10180
96 Ga0070696_100245084 3300005546 Unclassified 1353
97 Ga0070693_100001547 3300005547 Archaea 10394
98 Ga0070693_100005181 3300005547 Bacteria 6236
99 Ga0070704_100001657 3300005549 Bacteria 12071
100 Ga0070704_100002035 3300005549 Archaea 11207
101 Ga0070664_100043231 3300005564 Archaea 3801
102 Ga0068857_100056580 3300005577 Archaea 3481
103 Ga0068857_100134827 3300005577 Archaea 2229
104 Ga0068857_100196587 3300005577 Archaea 1838
105 Ga0068854_100027822 3300005578 Bacteria 3900
106 Ga0068856_100007306 3300005614 Bacteria 10783
107 Ga0068856_100186991 3300005614 Archaea 2085
108 Ga0070702_100000383 3300005615 Archaea 15658
109 Ga0070702_100040256 3300005615 Archaea 2614
110 Ga0068852_100246045 3300005616 Bacteria 1711
111 Ga0068864_100097109 3300005618 Bacteria 2608
112 Ga0068864_100122218 3300005618 Archaea 2329
113 Ga0068851_10031770 3300005834 Bacteria 2624
114 Ga0068870_10000403 3300005840 Bacteria 16249
115 Ga0068870_10004337 3300005840 Archaea 6106
116 Ga0068870_10017219 3300005840 Archaea 3468
117 Ga0068860_100333341 3300005843 Archaea 1491
118 Ga0081455_10000259 3300005937 Archaea 69843
119 Ga0081455_10015350 3300005937 Archaea 7447
120 Ga0081538_10000668 3300005981 Archaea 37737
121 Ga0081538_10003642 3300005981 Archaea 14486
122 Ga0081538_10009824 3300005981 Archaea 7918
123 Ga0081538_10019480 3300005981 Viruses 5040
124 Ga0075432_10017963 3300006058 Archaea 2411
125 Ga0070715_10010124 3300006163 Archaea 3350
126 Ga0070715_10045479 3300006163 Archaea 1861
127 Ga0070716_100000162 3300006173 Archaea 26314
128 Ga0070712_100000568 3300006175 Archaea 21485
129 Ga0070712_100092970 3300006175 Unclassified 2213
130 Ga0070712_100127515 3300006175 Archaea 1924
131 Ga0070712_100214310 3300006175 Archaea 1520
132 Ga0070712_100241033 3300006175 Archaea 1440
133 Ga0097621_100002430 3300006237 Unclassified 12755
134 Ga0068871_100029921 3300006358 Bacteria 4283
135 Ga0075428_100007480 3300006844 Archaea 12104
136 Ga0075428_100036624 3300006844 Archaea 5403
137 Ga0075428_100078712 3300006844 Archaea 3599
138 Ga0075428_100089353 3300006844 Archaea 3360
139 Ga0075430_100003474 3300006846 Archaea 13179
140 Ga0075430_100022245 3300006846 Archaea 5392
141 Ga0075430_100030232 3300006846 Archaea 4599
142 Ga0075430_100156997 3300006846 Archaea 1894
143 Ga0075430_100203539 3300006846 Bacteria 1643
144 Ga0075431_100077005 3300006847 Archaea 3442
145 Ga0075431_100094808 3300006847 Archaea 3080
146 Ga0075431_100188206 3300006847 Archaea 2116
147 Ga0075433_10090415 3300006852 Archaea 2706
148 Ga0075433_10131933 3300006852 Unclassified 2219
149 Ga0075434_100019556 3300006871 Bacteria 6556
150 Ga0075434_100022238 3300006871 Archaea 6177
151 Ga0075434_100031590 3300006871 Archaea 5220
152 Ga0075434_100091301 3300006871 Archaea 3047
153 Ga0075429_100012145 3300006880 Archaea 7464
154 Ga0075429_100016708 3300006880 Archaea 6356
155 Ga0075429_100026744 3300006880 Bacteria 5009
156 Ga0075429_100032333 3300006880 Archaea 4547
157 Ga0075429_100063293 3300006880 Archaea 3223
158 Ga0075429_100258326 3300006880 Archaea 1525
159 Ga0068865_100048421 3300006881 Archaea 2925
160 Ga0075436_100017636 3300006914 Archaea 4887
161 Ga0075436_100038427 3300006914 Archaea 3304
162 Ga0075436_100121047 3300006914 Archaea 1831
163 Ga0075436_100312559 3300006914 Bacteria 1128
164 Ga0075435_100045736 3300007076 Archaea 3510
165 Ga0075435_100056234 3300007076 Archaea 3180
166 Ga0105240_10099339 3300009093 Archaea 3543
167 Ga0111539_10103505 3300009094 Archaea 3341
168 Ga0111539_10126836 3300009094 Archaea 2989
169 Ga0111539_10298986 3300009094 Archaea 1873
170 Ga0111539_10345244 3300009094 Archaea 1732
171 Ga0105247_10259845 3300009101 Unclassified 1190
172 Ga0114129_10007943 3300009147 Archaea 15106
173 Ga0114129_10008340 3300009147 Archaea 14779
174 Ga0114129_10024933 3300009147 Archaea 8479
175 Ga0114129_10051515 3300009147 Archaea 5779
176 Ga0114129_10067710 3300009147 Archaea 4979
177 Ga0114129_10095065 3300009147 Archaea 4127
178 Ga0114129_10592913 3300009147 Archaea 1437
179 Ga0105241_10031143 3300009174 Bacteria 3992
180 Ga0105241_10293530 3300009174 Archaea 1393
181 Ga0105237_10186477 3300009545 Bacteria 2074
182 Ga0105249_10010922 3300009553 Bacteria 7980
183 Ga0105249_10071521 3300009553 Archaea 3205
184 Ga0105239_10069283 3300010375 Archaea 3876
185 Ga0105239_10296108 3300010375 Bacteria 1822
186 Ga0105239_10428973 3300010375 Archaea 1498
187 Ga0105246_10004514 3300011119 Archaea 8465
188 Ga0105246_10005782 3300011119 Archaea 7540
189 Ga0105246_10005846 3300011119 Bacteria 7503
190 Ga0105246_10044322 3300011119 Archaea 3022
191 Ga0157373_10135915 3300013100 Archaea 1728
192 Ga0157371_10021158 3300013102 Bacteria 4778
193 Ga0157374_10002338 3300013296 Unclassified 16018
194 Ga0157378_10008480 3300013297 Archaea 8949
195 Ga0163162_10628158 3300013306 Archaea 1199
196 Ga0157372_10009575 3300013307 Bacteria 10298
197 Ga0157372_10564647 3300013307 Archaea 1326
198 Ga0157380_10040616 3300014326 Archaea 3625
199 Ga0182008_10004391 3300014497 Archaea 8249
200 Ga0157377_10001945 3300014745 Archaea 9035
201 Ga0157377_10005574 3300014745 Bacteria 5928
202 Ga0157377_10025386 3300014745 Archaea 3161
203 Ga0157376_10025790 3300014969 Bacteria 4634
204 Ga0197907_10724537 3300020069 Bacteria 1763
205 Ga0206351_10162475 3300020077 Bacteria 4379
206 Ga0206352_10629570 3300020078 Bacteria 2603
207 Ga0206350_10042663 3300020080 Archaea 2007
208 Ga0206350_10906309 3300020080 Bacteria 2912
209 Ga0206350_11303573 3300020080 Archaea 6380
210 Ga0224712_10003479 3300022467 Bacteria 4100
211 Ga0207682_10001844 3300025893 Bacteria 9659
212 Ga0207692_10018720 3300025898 Archaea 3114
213 Ga0207692_10227045 3300025898 Archaea 1109
214 Ga0207688_10008824 3300025901 Archaea 5487
215 Ga0207647_10005234 3300025904 Bacteria 9550
216 Ga0207685_10010996 3300025905 Unclassified 2702
217 Ga0207685_10024512 3300025905 Archaea 2069
218 Ga0207699_10037084 3300025906 Archaea 2784
219 Ga0207699_10084122 3300025906 Archaea 1981
220 Ga0207645_10006413 3300025907 Archaea 8445
221 Ga0207645_10024045 3300025907 Archaea 3953
222 Ga0207645_10103536 3300025907 Archaea 1838
223 Ga0207643_10000137 3300025908 Bacteria 49456
224 Ga0207643_10009429 3300025908 Bacteria 5245
225 Ga0207643_10029457 3300025908 Archaea 3053
226 Ga0207684_10128145 3300025910 Archaea 2178
227 Ga0207654_10187850 3300025911 Bacteria 1352
228 Ga0207707_10004853 3300025912 Archaea 11798
229 Ga0207707_10069527 3300025912 Archaea 3068
230 Ga0207707_10149856 3300025912 Unclassified 2040
231 Ga0207695_10125868 3300025913 Archaea 2525
232 Ga0207693_10001206 3300025915 Archaea 23043
233 Ga0207693_10009497 3300025915 Archaea 7922
234 Ga0207693_10018426 3300025915 Bacteria 5562
235 Ga0207693_10082410 3300025915 Unclassified 2519
236 Ga0207693_10412509 3300025915 Archaea 1056
237 Ga0207663_10007289 3300025916 Archaea 5724
238 Ga0207663_10007500 3300025916 Archaea 5659
239 Ga0207663_10009574 3300025916 Archaea 5126
240 Ga0207663_10020610 3300025916 Archaea 3736
241 Ga0207663_10037362 3300025916 Archaea 2927
242 Ga0207663_10070152 3300025916 Archaea 2257
243 Ga0207663_10077856 3300025916 Archaea 2160
244 Ga0207660_10003511 3300025917 Bacteria 10213
245 Ga0207660_10017442 3300025917 Archaea 4771
246 Ga0207660_10047439 3300025917 Unclassified 3037
247 Ga0207662_10065827 3300025918 Unclassified 2182
248 Ga0207652_10343948 3300025921 Archaea 1346
249 Ga0207646_10005062 3300025922 Archaea 14011
250 Ga0207650_10066948 3300025925 Archaea 2694
251 Ga0207700_10093457 3300025928 Archaea 2380
252 Ga0207700_10126233 3300025928 Archaea 2082
253 Ga0207664_10020678 3300025929 Archaea 4884
254 Ga0207664_10051937 3300025929 Archaea 3239
255 Ga0207664_10484901 3300025929 Archaea 1106
256 Ga0207670_10499412 3300025936 Archaea 987
257 Ga0207669_10033385 3300025937 Archaea 2904
258 Ga0207665_10000078 3300025939 Archaea 62766
259 Ga0207665_10012682 3300025939 Archaea 5541
260 Ga0207691_10012482 3300025940 Archaea 8146
261 Ga0207691_10070424 3300025940 Archaea 3158
262 Ga0207691_10100576 3300025940 Archaea 2580
263 Ga0207689_10002489 3300025942 Archaea 17114
264 Ga0207661_10011200 3300025944 Bacteria 6487
265 Ga0207679_10078776 3300025945 Bacteria 2511
266 Ga0207679_10585450 3300025945 Archaea 1004
267 Ga0207651_10037632 3300025960 Unclassified 3171
268 Ga0207651_10253581 3300025960 Archaea 1441
269 Ga0207677_10153594 3300026023 Bacteria 1779
270 Ga0207678_10066423 3300026067 Archaea 3097
271 Ga0207678_10161390 3300026067 Archaea 1914
272 Ga0207708_10047677 3300026075 Archaea 3261
273 Ga0207708_10261707 3300026075 Unclassified 1396
274 Ga0207708_10631232 3300026075 Archaea 910
275 Ga0207702_10009299 3300026078 Bacteria 8256
276 Ga0207648_10004384 3300026089 Bacteria 14515
277 Ga0207648_10044963 3300026089 Archaea 3874
278 Ga0207648_10171322 3300026089 Archaea 1919
279 Ga0207648_10469388 3300026089 Archaea 1148
280 Ga0207676_10007699 3300026095 Bacteria 7654
281 Ga0207676_10052340 3300026095 Archaea 3191
282 Ga0207674_10007252 3300026116 Bacteria 12931
283 Ga0207674_10060415 3300026116 Archaea 3832
284 Ga0207674_10434170 3300026116 Archaea 1269
285 Ga0207675_100323747 3300026118 Archaea 1505
286 Ga0207683_10369663 3300026121 Archaea 1317
287 Ga0207698_10209675 3300026142 Bacteria 1752
288 Ga0210000_1004958 3300027462 Unclassified 1928
289 Ga0209968_1001825 3300027526 Archaea 3232
290 Ga0209982_1001054 3300027552 Archaea 3677
291 Ga0209970_1002644 3300027614 Archaea 3031
292 Ga0209983_1022581 3300027665 Archaea 1319
293 Ga0209998_10000984 3300027717 Bacteria 7203
294 Ga0209974_10001254 3300027876 Bacteria 9104
295 Ga0207428_10000047 3300027907 Archaea 189880
296 Ga0207428_10007614 3300027907 Archaea 9862
297 Ga0207428_10238528 3300027907 Archaea 1359
298 Ga0268265_10127819 3300028380 Archaea 2106
299 Ga0268265_10144301 3300028380 Archaea 1997
300 Ga0265326_10000188 3300028558 Archaea 31057
301 Ga0265326_10000240 3300028558 Archaea 26544
302 Ga0265334_10002133 3300028573 Archaea 9329
303 Ga0265322_10000019 3300028654 Archaea 109865
304 Ga0265336_10000540 3300028666 Archaea 21657
305 Ga0265336_10000613 3300028666 Archaea 19805
306 Ga0265338_10000136 3300028800 Archaea 135731
307 Ga0265338_10000455 3300028800 Archaea 73112
308 Ga0265324_10000111 3300029957 Archaea 64458
309 Ga0265324_10000509 3300029957 Archaea 26693
310 Ga0265332_10008361 3300031238 Archaea 4651
311 Ga0265325_10003077 3300031241 Archaea 11023
312 Ga0265329_10003526 3300031242 Archaea 6779
313 Ga0265340_10000695 3300031247 Archaea 18935
314 Ga0265340_10000698 3300031247 Archaea 18917
315 Ga0265339_10001261 3300031249 Archaea 18990
316 Ga0265339_10012894 3300031249 Archaea 5082
317 Ga0265331_10000071 3300031250 Archaea 150739
318 Ga0265331_10000475 3300031250 Archaea 38511
319 Ga0265316_10006746 3300031344 Archaea 10945
320 Ga0265314_10017600 3300031711 Archaea 5603
321 Ga0265314_10165014 3300031711 Archaea 1343
322 Ga0265342_10008704 3300031712 Archaea 7240
323 Ga0265342_10178407 3300031712 Archaea 1164
324 Ga0307413_10006870 3300031824 Archaea 5237
325 Ga0307413_10008491 3300031824 Archaea 4854
326 Ga0307410_10000131 3300031852 Archaea 26995
327 Ga0307410_10009271 3300031852 Archaea 5511
328 Ga0307410_10015433 3300031852 Archaea 4531
329 Ga0307406_10003274 3300031901 Archaea 8827
330 Ga0307406_10019990 3300031901 Archaea 3936
331 Ga0307407_10007775 3300031903 Archaea 4876
332 Ga0307407_10020650 3300031903 Archaea 3379
333 Ga0307412_10157431 3300031911 Archaea 1683
334 Ga0307412_10250263 3300031911 Archaea 1375
335 Ga0307409_100002940 3300031995 Archaea 9060
336 Ga0307409_100206419 3300031995 Archaea 1762
337 Ga0307409_100378896 3300031995 Archaea 1344
338 Ga0307409_100493861 3300031995 Archaea 1190
339 Ga0307416_100001691 3300032002 Archaea 12214
340 Ga0307416_100534399 3300032002 Archaea 1243
341 Ga0307416_100587928 3300032002 Archaea 1191
342 Ga0307414_10004626 3300032004 Archaea 7489
343 Ga0307414_10013662 3300032004 Archaea 4842
344 Ga0307414_10067110 3300032004 Archaea 2568
345 Ga0307414_10424753 3300032004 Archaea 1160
346 Ga0307411_10002437 3300032005 Archaea 8228
347 Ga0307411_10143766 3300032005 Archaea 1762
348 Ga0307415_100000601 3300032126 Archaea 15755
349 Ga0307415_100034436 3300032126 Archaea 3298
350 Ga0307415_100097157 3300032126 Archaea 2149
351 Ga0307415_100169182 3300032126 Archaea 1702
352 Ga0373959_0023025 3300034820 Archaea 1208
353 Ga0373923_0001990 3300035111 Bacteria 6139
354 Ga0373932_0075466 3300035112 Archaea 1054
355 Ga0373945_0099049 3300035116 Archaea 1139
356 Ga0373953_0000612 3300035117 Archaea 9876
357 Ga0373954_0000126 3300035118 Archaea 26049
358 Ga0373956_0024353 3300035119 Bacteria 2607
359 Ga0373957_0011289 3300035120 Bacteria 2978
360 Ga0373960_0002388 3300035121 Archaea 4215
361 Ga0373960_0013858 3300035121 Archaea 2031
362 Ga0373955_0002378 3300035172 Bacteria 8197
363 Ga0373942_0009544 3300035207 Archaea 2274
364 Ga0373942_0013034 3300035207 Archaea 1993
365 Ga0373961_0004025 3300035241 Archaea 3580
366 Ga0316574_0103157 3300035398 Unclassified 1826
367 Ga0373933_0000094 3300035724 Archaea 55815
368 Ga0373937_0000064 3300036401 Archaea 95743
369 Ga0316582_0164678 3300036647 Unclassified 1503
370 Ga0242419_000097 3300038698 Unclassified 4247
371 Ga0242420_019475 3300038996 Bacteria 1202
372 Ga0436362_0785534 3300039453 Archaea 6046
373 Ga0439439_0005152 3300041406 Archaea 2974
374 Ga0439453_0000140 3300041408 Bacteria 6341
375 Ga0439453_0020197 3300041408 Archaea 1192
376 Ga0439431_0016884 3300041997 Archaea 1712
377 Ga0439442_042673 3300042002 Archaea 954
378 Ga0450906_002468 3300042145 Archaea 4044
379 Ga0439446_0004148 3300042156 Archaea 3653
380 Ga0439434_0016848 3300042435 Unclassified 2184
381 Ga0439464_0038788 3300042439 Unclassified 1353
382 Ga0439460_0005792 3300042461 Archaea 3044
383 Ga0450893_0035821 3300042532 Archaea 896
384 Ga0439440_0000679 3300042993 Bacteria 5815
385 Ga0495592_0008843 3300046454 Archaea 7566
386 Ga0495651_0002145 3300046462 Archaea 15273
387 Ga0495653_0019375 3300046463 Archaea 5519
388 Ga0495652_0006570 3300046529 Archaea 10804
389 Ga0495640_0271902 3300046533 Unclassified 1057
390 Ga0495587_0008195 3300046536 Archaea 6732
391 Ga0495598_0079797 3300046537 Unclassified 1048
392 Ga0495657_0020695 3300046675 Bacteria 4730
393 Ga0495599_0173090 3300046678 Unclassified 1331
394 Ga0495600_0023748 3300046809 Unclassified 3945
395 Ga0495604_0011906 3300047317 Archaea 6918
396 Ga0495675_0060627 3300047444 Bacteria 2398
397 Ga0495602_0000154 3300048088 Archaea 63570
398 Ga0496101_0079506 3300048904 Archaea 2421
399 Ga0496103_0054029 3300048906 Archaea 2490
400 Ga0496104_0104478 3300048907 Archaea 2714
401 Ga0496106_0068990 3300048909 Archaea 2697
402 Ga0496107_0045147 3300048910 Archaea 3169
403 Ga0496107_0174331 3300048910 Archaea 1596
404 Ga0496108_0037490 3300048911 Bacteria 4038
405 Ga0496110_0014023 3300048913 Archaea 6642
406 Ga0496110_0055626 3300048913 Archaea 3482
407 Ga0496111_0114572 3300048914 Unclassified 1987
408 Ga0496112_0035965 3300048915 Archaea 4827
409 Ga0496112_0187968 3300048915 Archaea 2028
410 Ga0496113_0213232 3300048916 Archaea 1537
411 Ga0496114_0520880 3300048917 Archaea 1051
412 Ga0496115_0401026 3300048918 Archaea 1113
413 Ga0501290_002730 3300049513 Archaea 2261
414 Ga0501290_018948 3300049513 Archaea 931
415 Ga0501291_000078 3300049514 Archaea 11680
416 Ga0501291_002219 3300049514 Archaea 2309
417 Ga0501293_000131 3300049516 Archaea 5132
418 Ga0501299_001821 3300049522 Archaea 2849
419 Ga0501300_013406 3300049523 Archaea 1195
420 Ga0501031_0002039 3300049568 Archaea 12711
421 Ga0501031_0019942 3300049568 Archaea 4371
422 Ga0501031_0311819 3300049568 Archaea 1019
423 Ga0501032_0010707 3300049569 Archaea 6599
424 Ga0501033_0034012 3300049570 Archaea 3825
425 Ga0501034_0022064 3300049571 Archaea 6486
426 Ga0501036_0004595 3300049572 Archaea 11151
427 Ga0501036_0008050 3300049572 Bacteria 8633
428 Ga0501036_0014918 3300049572 Archaea 6482
429 Ga0501036_0016501 3300049572 Archaea 6168
430 Ga0501036_0507563 3300049572 Archaea 1003
431 Ga0501037_0003243 3300049573 Archaea 11795
432 Ga0501037_0028171 3300049573 Archaea 4150
433 Ga0501037_0028374 3300049573 Archaea 4133
434 Ga0501037_0047658 3300049573 Archaea 3140
435 Ga0501037_0121810 3300049573 Archaea 1875
436 Ga0501037_0173685 3300049573 Archaea 1531
437 Ga0501038_0029291 3300049574 Archaea 4880
438 Ga0501038_0104284 3300049574 Unclassified 2356
439 Ga0501038_0148095 3300049574 Archaea 1915
440 Ga0501038_0150619 3300049574 Archaea 1897
441 Ga0501039_0000729 3300049575 Archaea 23757
442 Ga0501039_0004928 3300049575 Bacteria 10117
443 Ga0501039_0005847 3300049575 Archaea 9316
444 Ga0501039_0066952 3300049575 Archaea 2789
445 Ga0501039_0146275 3300049575 Archaea 1857
446 Ga0501039_0173480 3300049575 Archaea 1695
447 Ga0501040_0000100 3300049576 Archaea 43458
448 Ga0501040_0003165 3300049576 Archaea 10661
449 Ga0501040_0016125 3300049576 Archaea 4941
450 Ga0501040_0139323 3300049576 Archaea 1708
451 Ga0501041_0001362 3300049577 Archaea 13470
452 Ga0501041_0004468 3300049577 Archaea 8099
453 Ga0501041_0015900 3300049577 Archaea 4472
454 Ga0501041_0022800 3300049577 Archaea 3751
455 Ga0501041_0041947 3300049577 Archaea 2780
456 Ga0501041_0042233 3300049577 Archaea 2771
457 Ga0501041_0064572 3300049577 Archaea 2242
458 Ga0501041_0389495 3300049577 Archaea 882
459 Ga0501042_0005507 3300049578 Archaea 8161
460 Ga0501042_0020474 3300049578 Archaea 4604
461 Ga0501042_0029880 3300049578 Archaea 3844
462 Ga0501042_0156004 3300049578 Archaea 1646
463 Ga0501042_0255688 3300049578 Archaea 1264
464 Ga0501042_0276188 3300049578 Archaea 1213
465 Ga0501043_0013562 3300049579 Archaea 6376
466 Ga0501043_0020647 3300049579 Bacteria 5168
467 Ga0501043_0261123 3300049579 Archaea 1332
468 Ga0501046_0003727 3300049580 Archaea 13949
469 Ga0501046_0121934 3300049580 Archaea 1983
470 Ga0501046_0205678 3300049580 Archaea 1463
471 Ga0501046_0381245 3300049580 Archaea 1020
472 Ga0501047_0268900 3300049581 Archaea 1551
473 Ga0501048_0001104 3300049582 Archaea 20267
474 Ga0501048_0001700 3300049582 Archaea 16777
475 Ga0501048_0052089 3300049582 Archaea 2912
476 Ga0501048_0073402 3300049582 Archaea 2415
477 Ga0501048_0167159 3300049582 Archaea 1558
478 Ga0501048_0174612 3300049582 Archaea 1523
479 Ga0501048_0243999 3300049582 Archaea 1275
480 Ga0501068_0025314 3300049584 Archaea 3490
481 Ga0501069_0234111 3300049585 Archaea 1070
482 Ga0501069_0254919 3300049585 Bacteria 1024
483 Ga0501070_0230715 3300049586 Archaea 1517
484 Ga0501070_0287356 3300049586 Archaea 1341
485 Ga0501071_0000246 3300049587 Archaea 25068
486 Ga0501071_0004536 3300049587 Archaea 8806
487 Ga0501071_0022484 3300049587 Archaea 4395
488 Ga0501071_0024873 3300049587 Archaea 4190
489 Ga0501071_0414414 3300049587 Archaea 1029
490 Ga0501072_0000097 3300049588 Archaea 64924
491 Ga0501072_0002056 3300049588 Archaea 14959
492 Ga0501072_0004684 3300049588 Archaea 10421
493 Ga0501072_0009601 3300049588 Bacteria 7358
494 Ga0501072_0100124 3300049588 Archaea 2303
495 Ga0501072_0168931 3300049588 Archaea 1745
496 Ga0501073_0074655 3300049589 Archaea 2361
497 Ga0501073_0130622 3300049589 Archaea 1741
498 Ga0501074_0018107 3300049590 Archaea 5117
499 Ga0501074_0053453 3300049590 Archaea 2913
500 Ga0501075_0001552 3300049591 Archaea 14973
501 Ga0501075_0003728 3300049591 Archaea 10242
502 Ga0501075_0005319 3300049591 Bacteria 8806
503 Ga0501075_0011314 3300049591 Archaea 6312
504 Ga0501075_0015299 3300049591 Archaea 5503
505 Ga0501075_0031728 3300049591 Archaea 3923
506 Ga0501076_0000315 3300049592 Archaea 29867
507 Ga0501076_0044360 3300049592 Archaea 3506
508 Ga0501076_0066755 3300049592 Archaea 2872
509 Ga0501076_0215997 3300049592 Unclassified 1567
510 Ga0501076_0308116 3300049592 Archaea 1299
511 Ga0501076_0396727 3300049592 Archaea 1134
512 Ga0501077_0000550 3300049593 Archaea 22759
513 Ga0501077_0008372 3300049593 Archaea 6404
514 Ga0501077_0064575 3300049593 Archaea 2322
515 Ga0501198_000271 3300049649 Archaea 6530
516 Ga0501199_000477 3300049650 Archaea 3600
517 Ga0501202_001443 3300049652 Archaea 3813
518 Ga0501207_000969 3300049654 Archaea 3478
519 Ga0501208_000388 3300049655 Archaea 3399
520 Ga0501209_002953 3300049656 Archaea 2723
521 Ga0501211_001567 3300049658 Archaea 2447
522 Ga0501214_000083 3300049659 Archaea 5211
523 Ga0501217_010092 3300049661 Archaea 2063
524 Ga0501223_003684 3300049663 Archaea 3314
525 Ga0501224_000202 3300049664 Archaea 6819
526 Ga0501227_002968 3300049665 Archaea 3710
527 Ga0501228_000166 3300049666 Archaea 3743
528 Ga0501235_001216 3300049669 Archaea 5417
529 Ga0501238_010377 3300049671 Archaea 1244
530 Ga0501239_010846 3300049672 Archaea 1010
531 Ga0501249_029635 3300049679 Archaea 1217
532 Ga0501250_001686 3300049680 Archaea 1882
533 Ga0501256_000047 3300049685 Archaea 5809
534 Ga0501259_000609 3300049688 Archaea 5728
535 Ga0501261_000304 3300049690 Archaea 6748
536 Ga0501221_005894 3300049704 Archaea 2059
537 Ga0501225_0000341 3300049705 Archaea 14700
538 Ga0501229_001088 3300049706 Archaea 3132
539 Ga0501234_001309 3300049707 Archaea 3891
540 Ga0501245_000297 3300049708 Archaea 5794
541 Ga0501245_006558 3300049708 Archaea 1629
542 Ga0501079_0007227 3300049741 Bacteria 8382
543 Ga0501079_0009347 3300049741 Archaea 7429
544 Ga0501079_0101099 3300049741 Archaea 2235
545 Ga0501079_0164167 3300049741 Archaea 1732
546 Ga0501080_0005933 3300049742 Archaea 10947
547 Ga0501080_0047042 3300049742 Archaea 4016
548 Ga0501080_0111198 3300049742 Archaea 2539
549 Ga0501081_0000623 3300049743 Archaea 20189
550 Ga0501081_0001133 3300049743 Bacteria 16070
551 Ga0501081_0003300 3300049743 Archaea 10258
552 Ga0501081_0012208 3300049743 Archaea 5635
553 Ga0501081_0057213 3300049743 Archaea 2696
554 Ga0501081_0124113 3300049743 Archaea 1841
555 Ga0501083_0109161 3300049744 Archaea 1820
556 Ga0501241_002905 3300049758 Archaea 3277
557 Ga0501265_000661 3300049762 Archaea 3749
558 Ga0501265_030607 3300049762 Bacteria 773
559 Ga0501266_001123 3300049763 Archaea 3442
560 Ga0501268_022633 3300049765 Archaea 1086
561 Ga0501270_000669 3300049767 Archaea 3012
562 Ga0501274_000277 3300049771 Archaea 3454
563 Ga0501275_000217 3300049772 Archaea 6684
564 Ga0501278_000169 3300049774 Archaea 5002
565 Ga0501279_016323 3300049775 Archaea 1033
566 Ga0501282_001584 3300049778 Archaea 2519
567 Ga0501283_001803 3300049779 Archaea 2776
568 Ga0501035_0112122 3300049822 Archaea 2389
569 Ga0501035_0202053 3300049822 Unclassified 1704
570 Ga0501044_0049797 3300049823 Archaea 4324
571 Ga0501044_0225815 3300049823 Archaea 1822
572 Ga0501045_0010513 3300049824 Bacteria 6482
573 Ga0501045_0012857 3300049824 Archaea 5900
574 Ga0501045_0015681 3300049824 Archaea 5375
575 Ga0501045_0060570 3300049824 Archaea 2775
576 Ga0501045_0074417 3300049824 Archaea 2501
577 Ga0501045_0113065 3300049824 Archaea 2014
578 Ga0501204_000369 3300049850 Archaea 3837
579 Ga0501212_000123 3300049851 Archaea 6162
580 Ga0501226_001128 3300049853 Archaea 3458
581 nmdc:mga05p37_173005_c1 3300050507 Archaea 2633
582 nmdc:mga05p37_3232_c1 3300050507 Archaea 18976
583 nmdc:mga05p37_4165_c1 3300050507 Archaea 16893
584 nmdc:mga05p37_6018_c1 3300050507 Archaea 14280
585 nmdc:mga05p37_676950_c1 3300050507 Archaea 1151
586 nmdc:mga05p37_9050_c1 3300050507 Bacteria 11772
587 nmdc:mga09592_101506_c1 3300050508 Archaea 1704
588 nmdc:mga09592_142064_c1 3300050508 Archaea 2070
589 nmdc:mga09592_15619_c1 3300050508 Archaea 6203
590 nmdc:mga09592_2726_c2 3300050508 Archaea 12972
591 nmdc:mga09592_51099_c1 3300050508 Archaea 3487
592 nmdc:mga09592_62238_c1 3300050508 Archaea 3157
593 nmdc:mga0qj67_110262_c1 3300050509 Archaea 2221
594 nmdc:mga0qj67_12901_c1 3300050509 Archaea 6305
595 nmdc:mga0qj67_203935_c1 3300050509 Archaea 1606
596 nmdc:mga0qj67_2554_c1 3300050509 Archaea 13005
597 nmdc:mga06r32_92136_c1 3300050510 Archaea 2963
598 nmdc:mga06r32_94422_c1 3300050510 Archaea 2927
599 nmdc:mga08y16_1443_c1 3300050511 Bacteria 23812
600 nmdc:mga08y16_173286_c1 3300050511 Archaea 2241
601 nmdc:mga08y16_226192_c1 3300050511 Archaea 1936
602 nmdc:mga08y16_35190_c1 3300050511 Archaea 5261
603 nmdc:mga08y16_744514_c1 3300050511 Archaea 977
604 nmdc:mga0n895_170284_c1 3300050512 Archaea 2210
605 nmdc:mga0n895_19565_c1 3300050512 Archaea 6296
606 nmdc:mga0n895_5933_c1 3300050512 Bacteria 10273
607 nmdc:mga0rr50_151092_c1 3300050513 Archaea 1877
608 nmdc:mga08x19_40292_c1 3300050514 Archaea 2972
609 nmdc:mga08x19_40553_c1 3300050514 Archaea 2963
610 nmdc:mga0a205_14265_c1 3300050515 Archaea 7409
611 nmdc:mga0a205_313368_c1 3300050515 Archaea 1441
612 Ga0495601_0172227 3300053077 Unclassified 1415
613 Ga0495612_0007963 3300053078 Archaea 4319
614 Ga0495595_0004130 3300053084 Archaea 5827
615 Ga0495619_0000565 3300053085 Archaea 24547
616 Ga0495619_0252525 3300053085 Archaea 1222
617 Ga0501084_0001241 3300054114 Archaea 20082
618 Ga0501084_0002219 3300054114 Archaea 15587
619 Ga0501084_0059790 3300054114 Archaea 3190
620 Ga0590077_010972 3300059426 Archaea 1867
621 Ga0590077_020056 3300059426 Archaea 1418
622 Ga0501082_0003938 3300060353 Archaea 12956
623 Ga0501082_0005698 3300060353 Archaea 10808
624 Ga0501082_0010655 3300060353 Bacteria 7914
625 Ga0501082_0020533 3300060353 Archaea 5693
626 Ga0501082_0029359 3300060353 Archaea 4737
627 Ga0501082_0042452 3300060353 Archaea 3921
628 Ga0501082_0141267 3300060353 Archaea 2090
629 Ga0501082_0312606 3300060353 Archaea 1368
630 Ga0501082_0592398 3300060353 Archaea 970
631 Ga0530510_0002847 3300061734 Archaea 11899
632 Ga0530510_0009811 3300061734 Archaea 6719
633 Ga0530510_0020646 3300061734 Bacteria 4683
634 Ga0530510_0031108 3300061734 Archaea 3837
635 Ga0182008_10020435
636 SwRhRL3b_contig_681274
637 SwRhRL2b_contig_1613685
638 SwRhRL2b_contig_722707
639 MRS1b_contig_23994
640 JGI24737J22298_10006557
641 JGI24743J22301_10024950
642 JGI24744J21845_10004131
643 JGI24033J26618_1004191
644 JGI24742J22300_10013406
645 rootH1_10187853
646 JGI25407J50210_10000178
647 Ga0058861_10150217
648 Ga0065704_10001129
649 Ga0065704_10012315
650 Ga0065704_10087136
651 Ga0065712_10000822
652 Ga0065715_10000273
653 Ga0065707_10085330
654 Ga0070676_10003895
655 Ga0070676_10058153
656 Ga0070676_10067855
657 Ga0070683_100016315
658 Ga0070683_100055521
659 Ga0070683_100196148
660 Ga0070683_100377209
661 Ga0070670_100047954
662 Ga0070670_100117515
663 Ga0070670_100291841
664 Ga0070670_100547335
665 Ga0070677_10003471
666 Ga0068869_100009891
667 Ga0070680_100002858
668 Ga0070680_100081965
669 Ga0070682_100003552
670 Ga0070682_100006358
671 Ga0070682_100328026
672 Ga0068868_100013571
673 Ga0068868_100040227
674 Ga0068868_100176412
675 Ga0070689_100506356
676 Ga0070691_10048755
677 Ga0070687_100047843
678 Ga0070661_100176069
679 Ga0070692_10015803
680 Ga0070692_10030474
681 Ga0070692_10049877
682 Ga0070668_100013188
683 Ga0070674_100262754
684 Ga0070673_100020725
685 Ga0070688_100338622
686 Ga0070709_10034722
687 Ga0070709_10096931
688 Ga0070713_100015608
689 Ga0070710_10014860
690 Ga0070710_10100101
691 Ga0070710_10219307
692 Ga0070701_10153551
693 Ga0070711_100001696
694 Ga0070711_100003753
695 Ga0070711_100012425
696 Ga0070711_100063046
697 Ga0070711_100085062
698 Ga0070711_100141701
699 Ga0070711_100148466
700 Ga0070711_100471964
701 Ga0070711_100612967
702 Ga0070705_100001944
703 Ga0070700_100113430
704 Ga0070700_100606461
705 Ga0070694_100000060
706 Ga0070694_100083027
707 Ga0070694_100089726
708 Ga0070663_100046412
709 Ga0070678_100032793
710 Ga0070678_100038951
711 Ga0070681_10004919
712 Ga0070681_10136986
713 Ga0068867_100004493
714 Ga0068867_100071121
715 Ga0070685_10453429
716 Ga0070707_100050874
717 Ga0070698_100000735
718 Ga0070699_100088984
719 Ga0070699_100270459
720 Ga0070679_100150417
721 Ga0070684_100003852
722 Ga0070684_100120724
723 Ga0070684_100196528
724 Ga0070697_100010266
725 Ga0070672_100026374
726 Ga0070672_100502585
727 Ga0070686_100025123
728 Ga0070686_100215081
729 Ga0070696_100003718
730 Ga0070696_100245084
731 Ga0070693_100001547
732 Ga0070693_100005181
733 Ga0070704_100001657
734 Ga0070704_100002035
735 Ga0070664_100043231
736 Ga0068857_100056580
737 Ga0068857_100134827
738 Ga0068857_100196587
739 Ga0068854_100027822
740 Ga0068856_100007306
741 Ga0068856_100186991
742 Ga0070702_100000383
743 Ga0070702_100040256
744 Ga0068852_100246045
745 Ga0068864_100097109
746 Ga0068864_100122218
747 Ga0068851_10031770
748 Ga0068870_10000403
749 Ga0068870_10004337
750 Ga0068870_10017219
751 Ga0068860_100333341
752 Ga0081455_10000259
753 Ga0081455_10015350
754 Ga0081538_10000668
755 Ga0081538_10003642
756 Ga0081538_10009824
757 Ga0081538_10019480
758 Ga0075432_10017963
759 Ga0070715_10010124
760 Ga0070715_10045479
761 Ga0070716_100000162
762 Ga0070712_100000568
763 Ga0070712_100092970
764 Ga0070712_100127515
765 Ga0070712_100214310
766 Ga0070712_100241033
767 Ga0097621_100002430
768 Ga0068871_100029921
769 Ga0075428_100007480
770 Ga0075428_100036624
771 Ga0075428_100078712
772 Ga0075428_100089353
773 Ga0075430_100003474
774 Ga0075430_100022245
775 Ga0075430_100030232
776 Ga0075430_100156997
777 Ga0075430_100203539
778 Ga0075431_100077005
779 Ga0075431_100094808
780 Ga0075431_100188206
781 Ga0075433_10090415
782 Ga0075433_10131933
783 Ga0075434_100019556
784 Ga0075434_100022238
785 Ga0075434_100031590
786 Ga0075434_100091301
787 Ga0075429_100012145
788 Ga0075429_100016708
789 Ga0075429_100026744
790 Ga0075429_100032333
791 Ga0075429_100063293
792 Ga0075429_100258326
793 Ga0068865_100048421
794 Ga0075436_100017636
795 Ga0075436_100038427
796 Ga0075436_100121047
797 Ga0075436_100312559
798 Ga0075435_100045736
799 Ga0075435_100056234
800 Ga0105240_10099339
801 Ga0111539_10103505
802 Ga0111539_10126836
803 Ga0111539_10298986
804 Ga0111539_10345244
805 Ga0105247_10259845
806 Ga0114129_10007943
807 Ga0114129_10008340
808 Ga0114129_10024933
809 Ga0114129_10051515
810 Ga0114129_10067710
811 Ga0114129_10095065
812 Ga0114129_10592913
813 Ga0105241_10031143
814 Ga0105241_10293530
815 Ga0105237_10186477
816 Ga0105249_10010922
817 Ga0105249_10071521
818 Ga0105239_10069283
819 Ga0105239_10296108
820 Ga0105239_10428973
821 Ga0105246_10004514
822 Ga0105246_10005782
823 Ga0105246_10005846
824 Ga0105246_10044322
825 Ga0157373_10135915
826 Ga0157371_10021158
827 Ga0157374_10002338
828 Ga0157378_10008480
829 Ga0163162_10628158
830 Ga0157372_10009575
831 Ga0157372_10564647
832 Ga0157380_10040616
833 Ga0182008_10004391
834 Ga0157377_10001945
835 Ga0157377_10005574
836 Ga0157377_10025386
837 Ga0157376_10025790
838 Ga0197907_10724537
839 Ga0206351_10162475
840 Ga0206352_10629570
841 Ga0206350_10042663
842 Ga0206350_10906309
843 Ga0206350_11303573
844 Ga0224712_10003479
845 Ga0207682_10001844
846 Ga0207692_10018720
847 Ga0207692_10227045
848 Ga0207688_10008824
849 Ga0207647_10005234
850 Ga0207685_10010996
851 Ga0207685_10024512
852 Ga0207699_10037084
853 Ga0207699_10084122
854 Ga0207645_10006413
855 Ga0207645_10024045
856 Ga0207645_10103536
857 Ga0207643_10000137
858 Ga0207643_10009429
859 Ga0207643_10029457
860 Ga0207684_10128145
861 Ga0207654_10187850
862 Ga0207707_10004853
863 Ga0207707_10069527
864 Ga0207707_10149856
865 Ga0207695_10125868
866 Ga0207693_10001206
867 Ga0207693_10009497
868 Ga0207693_10018426
869 Ga0207693_10082410
870 Ga0207693_10412509
871 Ga0207663_10007289
872 Ga0207663_10007500
873 Ga0207663_10009574
874 Ga0207663_10020610
875 Ga0207663_10037362
876 Ga0207663_10070152
877 Ga0207663_10077856
878 Ga0207660_10003511
879 Ga0207660_10017442
880 Ga0207660_10047439
881 Ga0207662_10065827
882 Ga0207652_10343948
883 Ga0207646_10005062
884 Ga0207650_10066948
885 Ga0207700_10093457
886 Ga0207700_10126233
887 Ga0207664_10020678
888 Ga0207664_10051937
889 Ga0207664_10484901
890 Ga0207670_10499412
891 Ga0207669_10033385
892 Ga0207665_10000078
893 Ga0207665_10012682
894 Ga0207691_10012482
895 Ga0207691_10070424
896 Ga0207691_10100576
897 Ga0207689_10002489
898 Ga0207661_10011200
899 Ga0207679_10078776
900 Ga0207679_10585450
901 Ga0207651_10037632
902 Ga0207651_10253581
903 Ga0207677_10153594
904 Ga0207678_10066423
905 Ga0207678_10161390
906 Ga0207708_10047677
907 Ga0207708_10261707
908 Ga0207708_10631232
909 Ga0207702_10009299
910 Ga0207648_10004384
911 Ga0207648_10044963
912 Ga0207648_10171322
913 Ga0207648_10469388
914 Ga0207676_10007699
915 Ga0207676_10052340
916 Ga0207674_10007252
917 Ga0207674_10060415
918 Ga0207674_10434170
919 Ga0207675_100323747
920 Ga0207683_10369663
921 Ga0207698_10209675
922 Ga0210000_1004958
923 Ga0209968_1001825
924 Ga0209982_1001054
925 Ga0209970_1002644
926 Ga0209983_1022581
927 Ga0209998_10000984
928 Ga0209974_10001254
929 Ga0207428_10000047
930 Ga0207428_10007614
931 Ga0207428_10238528
932 Ga0268265_10127819
933 Ga0268265_10144301
934 Ga0265326_10000188
935 Ga0265326_10000240
936 Ga0265334_10002133
937 Ga0265322_10000019
938 Ga0265336_10000540
939 Ga0265336_10000613
940 Ga0265338_10000136
941 Ga0265338_10000455
942 Ga0265324_10000111
943 Ga0265324_10000509
944 Ga0265332_10008361
945 Ga0265325_10003077
946 Ga0265329_10003526
947 Ga0265340_10000695
948 Ga0265340_10000698
949 Ga0265339_10001261
950 Ga0265339_10012894
951 Ga0265331_10000071
952 Ga0265331_10000475
953 Ga0265316_10006746
954 Ga0265314_10017600
955 Ga0265314_10165014
956 Ga0265342_10008704
957 Ga0265342_10178407
958 Ga0307413_10006870
959 Ga0307413_10008491
960 Ga0307410_10000131
961 Ga0307410_10009271
962 Ga0307410_10015433
963 Ga0307406_10003274
964 Ga0307406_10019990
965 Ga0307407_10007775
966 Ga0307407_10020650
967 Ga0307412_10157431
968 Ga0307412_10250263
969 Ga0307409_100002940
970 Ga0307409_100206419
971 Ga0307409_100378896
972 Ga0307409_100493861
973 Ga0307416_100001691
974 Ga0307416_100534399
975 Ga0307416_100587928
976 Ga0307414_10004626
977 Ga0307414_10013662
978 Ga0307414_10067110
979 Ga0307414_10424753
980 Ga0307411_10002437
981 Ga0307411_10143766
982 Ga0307415_100000601
983 Ga0307415_100034436
984 Ga0307415_100097157
985 Ga0307415_100169182
986 Ga0373959_0023025
987 Ga0373923_0001990
988 Ga0373932_0075466
989 Ga0373945_0099049
990 Ga0373953_0000612
991 Ga0373954_0000126
992 Ga0373956_0024353
993 Ga0373957_0011289
994 Ga0373960_0002388
995 Ga0373960_0013858
996 Ga0373955_0002378
997 Ga0373942_0009544
998 Ga0373942_0013034
999 Ga0373961_0004025
1000 Ga0316574_0103157
1001 Ga0373933_0000094
1002 Ga0373937_0000064
1003 Ga0316582_0164678
1004 Ga0242419_000097
1005 Ga0242420_019475
1006 Ga0436362_0785534
1007 Ga0439439_0005152
1008 Ga0439453_0000140
1009 Ga0439453_0020197
1010 Ga0439431_0016884
1011 Ga0439442_042673
1012 Ga0450906_002468
1013 Ga0439446_0004148
1014 Ga0439434_0016848
1015 Ga0439464_0038788
1016 Ga0439460_0005792
1017 Ga0450893_0035821
1018 Ga0439440_0000679
1019 Ga0495592_0008843
1020 Ga0495651_0002145
1021 Ga0495653_0019375
1022 Ga0495652_0006570
1023 Ga0495640_0271902
1024 Ga0495587_0008195
1025 Ga0495598_0079797
1026 Ga0495657_0020695
1027 Ga0495599_0173090
1028 Ga0495600_0023748
1029 Ga0495604_0011906
1030 Ga0495675_0060627
1031 Ga0495602_0000154
1032 Ga0496101_0079506
1033 Ga0496103_0054029
1034 Ga0496104_0104478
1035 Ga0496106_0068990
1036 Ga0496107_0045147
1037 Ga0496107_0174331
1038 Ga0496108_0037490
1039 Ga0496110_0014023
1040 Ga0496110_0055626
1041 Ga0496111_0114572
1042 Ga0496112_0035965
1043 Ga0496112_0187968
1044 Ga0496113_0213232
1045 Ga0496114_0520880
1046 Ga0496115_0401026
1047 Ga0501290_002730
1048 Ga0501290_018948
1049 Ga0501291_000078
1050 Ga0501291_002219
1051 Ga0501293_000131
1052 Ga0501299_001821
1053 Ga0501300_013406
1054 Ga0501031_0002039
1055 Ga0501031_0019942
1056 Ga0501031_0311819
1057 Ga0501032_0010707
1058 Ga0501033_0034012
1059 Ga0501034_0022064
1060 Ga0501036_0004595
1061 Ga0501036_0008050
1062 Ga0501036_0014918
1063 Ga0501036_0016501
1064 Ga0501036_0507563
1065 Ga0501037_0003243
1066 Ga0501037_0028171
1067 Ga0501037_0028374
1068 Ga0501037_0047658
1069 Ga0501037_0121810
1070 Ga0501037_0173685
1071 Ga0501038_0029291
1072 Ga0501038_0104284
1073 Ga0501038_0148095
1074 Ga0501038_0150619
1075 Ga0501039_0000729
1076 Ga0501039_0004928
1077 Ga0501039_0005847
1078 Ga0501039_0066952
1079 Ga0501039_0146275
1080 Ga0501039_0173480
1081 Ga0501040_0000100
1082 Ga0501040_0003165
1083 Ga0501040_0016125
1084 Ga0501040_0139323
1085 Ga0501041_0001362
1086 Ga0501041_0004468
1087 Ga0501041_0015900
1088 Ga0501041_0022800
1089 Ga0501041_0041947
1090 Ga0501041_0042233
1091 Ga0501041_0064572
1092 Ga0501041_0389495
1093 Ga0501042_0005507
1094 Ga0501042_0020474
1095 Ga0501042_0029880
1096 Ga0501042_0156004
1097 Ga0501042_0255688
1098 Ga0501042_0276188
1099 Ga0501043_0013562
1100 Ga0501043_0020647
1101 Ga0501043_0261123
1102 Ga0501046_0003727
1103 Ga0501046_0121934
1104 Ga0501046_0205678
1105 Ga0501046_0381245
1106 Ga0501047_0268900
1107 Ga0501048_0001104
1108 Ga0501048_0001700
1109 Ga0501048_0052089
1110 Ga0501048_0073402
1111 Ga0501048_0167159
1112 Ga0501048_0174612
1113 Ga0501048_0243999
1114 Ga0501068_0025314
1115 Ga0501069_0234111
1116 Ga0501069_0254919
1117 Ga0501070_0230715
1118 Ga0501070_0287356
1119 Ga0501071_0000246
1120 Ga0501071_0004536
1121 Ga0501071_0022484
1122 Ga0501071_0024873
1123 Ga0501071_0414414
1124 Ga0501072_0000097
1125 Ga0501072_0002056
1126 Ga0501072_0004684
1127 Ga0501072_0009601
1128 Ga0501072_0100124
1129 Ga0501072_0168931
1130 Ga0501073_0074655
1131 Ga0501073_0130622
1132 Ga0501074_0018107
1133 Ga0501074_0053453
1134 Ga0501075_0001552
1135 Ga0501075_0003728
1136 Ga0501075_0005319
1137 Ga0501075_0011314
1138 Ga0501075_0015299
1139 Ga0501075_0031728
1140 Ga0501076_0000315
1141 Ga0501076_0044360
1142 Ga0501076_0066755
1143 Ga0501076_0215997
1144 Ga0501076_0308116
1145 Ga0501076_0396727
1146 Ga0501077_0000550
1147 Ga0501077_0008372
1148 Ga0501077_0064575
1149 Ga0501198_000271
1150 Ga0501199_000477
1151 Ga0501202_001443
1152 Ga0501207_000969
1153 Ga0501208_000388
1154 Ga0501209_002953
1155 Ga0501211_001567
1156 Ga0501214_000083
1157 Ga0501217_010092
1158 Ga0501223_003684
1159 Ga0501224_000202
1160 Ga0501227_002968
1161 Ga0501228_000166
1162 Ga0501235_001216
1163 Ga0501238_010377
1164 Ga0501239_010846
1165 Ga0501249_029635
1166 Ga0501250_001686
1167 Ga0501256_000047
1168 Ga0501259_000609
1169 Ga0501261_000304
1170 Ga0501221_005894
1171 Ga0501225_0000341
1172 Ga0501229_001088
1173 Ga0501234_001309
1174 Ga0501245_000297
1175 Ga0501245_006558
1176 Ga0501079_0007227
1177 Ga0501079_0009347
1178 Ga0501079_0101099
1179 Ga0501079_0164167
1180 Ga0501080_0005933
1181 Ga0501080_0047042
1182 Ga0501080_0111198
1183 Ga0501081_0000623
1184 Ga0501081_0001133
1185 Ga0501081_0003300
1186 Ga0501081_0012208
1187 Ga0501081_0057213
1188 Ga0501081_0124113
1189 Ga0501083_0109161
1190 Ga0501241_002905
1191 Ga0501265_000661
1192 Ga0501265_030607
1193 Ga0501266_001123
1194 Ga0501268_022633
1195 Ga0501270_000669
1196 Ga0501274_000277
1197 Ga0501275_000217
1198 Ga0501278_000169
1199 Ga0501279_016323
1200 Ga0501282_001584
1201 Ga0501283_001803
1202 Ga0501035_0112122
1203 Ga0501035_0202053
1204 Ga0501044_0049797
1205 Ga0501044_0225815
1206 Ga0501045_0010513
1207 Ga0501045_0012857
1208 Ga0501045_0015681
1209 Ga0501045_0060570
1210 Ga0501045_0074417
1211 Ga0501045_0113065
1212 Ga0501204_000369
1213 Ga0501212_000123
1214 Ga0501226_001128
1215 nmdc:mga05p37_173005_c1
1216 nmdc:mga05p37_3232_c1
1217 nmdc:mga05p37_4165_c1
1218 nmdc:mga05p37_6018_c1
1219 nmdc:mga05p37_676950_c1
1220 nmdc:mga05p37_9050_c1
1221 nmdc:mga09592_101506_c1
1222 nmdc:mga09592_142064_c1
1223 nmdc:mga09592_15619_c1
1224 nmdc:mga09592_2726_c2
1225 nmdc:mga09592_51099_c1
1226 nmdc:mga09592_62238_c1
1227 nmdc:mga0qj67_110262_c1
1228 nmdc:mga0qj67_12901_c1
1229 nmdc:mga0qj67_203935_c1
1230 nmdc:mga0qj67_2554_c1
1231 nmdc:mga06r32_92136_c1
1232 nmdc:mga06r32_94422_c1
1233 nmdc:mga08y16_1443_c1
1234 nmdc:mga08y16_173286_c1
1235 nmdc:mga08y16_226192_c1
1236 nmdc:mga08y16_35190_c1
1237 nmdc:mga08y16_744514_c1
1238 nmdc:mga0n895_170284_c1
1239 nmdc:mga0n895_19565_c1
1240 nmdc:mga0n895_5933_c1
1241 nmdc:mga0rr50_151092_c1
1242 nmdc:mga08x19_40292_c1
1243 nmdc:mga08x19_40553_c1
1244 nmdc:mga0a205_14265_c1
1245 nmdc:mga0a205_313368_c1
1246 Ga0495601_0172227
1247 Ga0495612_0007963
1248 Ga0495595_0004130
1249 Ga0495619_0000565
1250 Ga0495619_0252525
1251 Ga0501084_0001241
1252 Ga0501084_0002219
1253 Ga0501084_0059790
1254 Ga0590077_010972
1255 Ga0590077_020056
1256 Ga0501082_0003938
1257 Ga0501082_0005698
1258 Ga0501082_0010655
1259 Ga0501082_0020533
1260 Ga0501082_0029359
1261 Ga0501082_0042452
1262 Ga0501082_0141267
1263 Ga0501082_0312606
1264 Ga0501082_0592398
1265 Ga0530510_0002847
1266 Ga0530510_0009811
1267 Ga0530510_0020646
1268 Ga0530510_0031108

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00731

AIRC

AIR carboxylase

128

268

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8std-assembly1.cif.gz_A s127a variant of larb, a carboxylase/hydrolase involved in synthesis of the cofactor for lactate racemase, in complex with authentic substrate naad and soaked with cs2 0.8965 46 251
7mj1-assembly2.cif.gz_C larb, a carboxylase/hydrolase involved in synthesis of the cofactor for lactate racemase, in complex with nad 0.8912 50 250
7mj0-assembly1.cif.gz_A larb, a carboxylase/hydrolase involved in synthesis of the cofactor for lactate racemase, in complex with adenosine monophosphate amp 0.8887 46 251
8std-assembly2.cif.gz_D s127a variant of larb, a carboxylase/hydrolase involved in synthesis of the cofactor for lactate racemase, in complex with authentic substrate naad and soaked with cs2 0.8878 47 251
7mj0-assembly1.cif.gz_B larb, a carboxylase/hydrolase involved in synthesis of the cofactor for lactate racemase, in complex with adenosine monophosphate amp 0.886 46 252
ID Description Score Start End Superfamily
af_Q57629_127_256_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9573 125 254 3.40.50.1970
af_Q57629_127_256_3.40.50.1970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9288 125 254 3.40.50.1970
af_Q6Z695_396_486_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8128 119 184 3.40.50.800
af_A0A0R0F3H3_60_174_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8074 120 182 3.40.50.10860
af_Q54J66_607_710_3.40.50.800 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Anticodon-binding domain 0.8065 122 182 3.40.50.800
ID Description Score Start End GO Terms
AF-A0A535ST76-F1-model_v4 Nickel pincer cofactor biosynthesis protein LarB 0.9567 33 264 GO:0006189
GO:0016787
AF-A0A843DP85-F1-model_v4 Nickel pincer cofactor biosynthesis protein LarB 0.9518 120 258 GO:0006189
GO:0016787
AF-A0A7K4FAV7-F1-model_v4 PurE domain-containing protein 0.949 133 258 GO:0006189
GO:0016787
AF-A0A3L7VQP1-F1-model_v4 Nickel pincer cofactor biosynthesis protein LarB 0.947 28 261 GO:0006189
GO:0016787
AF-A0A7V9N7B4-F1-model_v4 Nickel pincer cofactor biosynthesis protein LarB 0.944 37 259 GO:0006189
GO:0016787

Map