F471110

General Info

Members Datasets Scaffolds Average Seq Length
633 295 625 68

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_1584025|Ga0496104_1584025_82_327
Length 81
Sequence VPKSEKGPPDLMLMSNRDRPARLHYMAYSFRVLQAGDHVVCAVTGQKIPLEDLRYWSIARQEPYATAEASAQAELKARGLK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
6 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
7 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
8 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
9 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
10 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
11 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
12 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
22 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
23 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
24 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
125 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
210 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
211 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
212 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
213 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
216 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
217 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
218 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
219 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
220 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
221 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
222 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
223 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
226 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
232 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
233 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
234 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
252 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
253 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
254 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
266 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
267 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
268 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
269 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
270 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
271 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
281 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
282 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
283 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
286 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
287 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
288 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
291 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
292 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
293 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
294 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
295 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0.32
Isolates 1.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.95
Nodule 0.16
Rhizoplane 5.21
Rhizosphere 76.94
Stem 0
Stem Tuber 0
Unclassified 4.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1064096 2162886007 Bacteria 5102
2 ARcpr5oldR_c000401 3300000041 Bacteria 5960
3 ARcpr5yngRDRAFT_c004387 3300000043 Bacteria 1337
4 ARCol0yngRDRAFT_1011645 3300000652 Bacteria 647
5 JGI24736J21556_1001450 3300001904 Bacteria 4343
6 JGI24741J21665_1000048 3300001915 Bacteria 29528
7 JGI24740J21852_10004476 3300001979 Bacteria 6015
8 JGI24740J21852_10184056 3300001979 Bacteria 518
9 JGI24739J22299_10011462 3300001989 Bacteria 3272
10 JGI24739J22299_10032373 3300001989 Bacteria 1799
11 JGI24737J22298_10012215 3300001990 Bacteria 2800
12 JGI24735J21928_10008818 3300002067 Bacteria 3253
13 JGI24735J21928_10010559 3300002067 Bacteria 2942
14 JGI24748J21848_1011742 3300002074 Bacteria 1032
15 JGI24748J21848_1013527 3300002074 Bacteria 965
16 JGI24738J21930_10000964 3300002075 Bacteria 8253
17 JGI25152J39213_1044289 3300002773 Bacteria 607
18 JGI25150J39212_1000419 3300002774 Bacteria 19558
19 JGI25151J46595_10026619 3300003187 Bacteria 2331
20 JGI25153J46596_10000183 3300003215 Bacteria 61802
21 JGI25153J46596_10024391 3300003215 Bacteria 2182
22 rootH1_10107370 3300003316 Bacteria 3953
23 rootL2_10077278 3300003322 Bacteria 1262
24 Ga0055526_1003689 3300003771 Bacteria 9576
25 Ga0055537_1002241 3300003773 Bacteria 6668
26 Ga0055537_1002809 3300003773 Bacteria 5589
27 Ga0055524_1000601 3300003775 Bacteria 25841
28 Ga0055536_1013194 3300003781 Bacteria 3002
29 Ga0055530_10016579 3300003791 Bacteria 2347
30 Ga0055530_10029152 3300003791 Bacteria 1479
31 Ga0055530_10045513 3300003791 Bacteria 1047
32 Ga0055530_10084637 3300003791 Bacteria 660
33 Ga0055540_1002521 3300003792 Bacteria 9564
34 Ga0055531_10001719 3300003794 Bacteria 15691
35 Ga0055531_10037337 3300003794 Bacteria 1480
36 Ga0055531_10037353 3300003794 Bacteria 1479
37 Ga0065165_1001302 3300005262 Bacteria 27888
38 Ga0065165_1002417 3300005262 Bacteria 15922
39 Ga0065165_1003514 3300005262 Bacteria 10872
40 Ga0065704_10071561 3300005289 Bacteria 10699
41 Ga0065704_10224427 3300005289 Bacteria 1063
42 Ga0065704_10475945 3300005289 Bacteria 685
43 Ga0065707_10435928 3300005295 Bacteria 815
44 Ga0070658_10119367 3300005327 Bacteria 2190
45 Ga0070676_10016276 3300005328 Bacteria 4110
46 Ga0070676_10073682 3300005328 Bacteria 2055
47 Ga0070683_100795447 3300005329 Bacteria 906
48 Ga0070683_100990539 3300005329 Bacteria 807
49 Ga0070690_100005002 3300005330 Bacteria 7420
50 Ga0070670_100016756 3300005331 Bacteria 6289
51 Ga0070670_100048407 3300005331 Bacteria 3658
52 Ga0070670_100062326 3300005331 Bacteria 3202
53 Ga0070670_100089272 3300005331 Bacteria 2649
54 Ga0070677_10004853 3300005333 Bacteria 4414
55 Ga0068869_100001204 3300005334 Bacteria 15210
56 Ga0070666_10010255 3300005335 Bacteria 5856
57 Ga0070666_10037119 3300005335 Bacteria 3238
58 Ga0070680_100162804 3300005336 Bacteria 1875
59 Ga0068868_100032967 3300005338 Bacteria 3989
60 Ga0068868_100327438 3300005338 Bacteria 1307
61 Ga0068868_101707046 3300005338 Bacteria 593
62 Ga0070660_100002605 3300005339 Bacteria 12382
63 Ga0070660_100411818 3300005339 Bacteria 1119
64 Ga0070660_100659291 3300005339 Bacteria 876
65 Ga0070691_10098825 3300005341 Bacteria 1447
66 Ga0070661_100161516 3300005344 Bacteria 1697
67 Ga0070661_100237820 3300005344 Bacteria 1401
68 Ga0070661_101178265 3300005344 Unclassified 640
69 Ga0070668_100006950 3300005347 Bacteria 8380
70 Ga0070668_100015614 3300005347 Bacteria 5676
71 Ga0070668_100089449 3300005347 Bacteria 2425
72 Ga0070669_100000586 3300005353 Bacteria 27126
73 Ga0070669_100031265 3300005353 Bacteria 3846
74 Ga0070669_100080662 3300005353 Bacteria 2422
75 Ga0070669_100090315 3300005353 Bacteria 2296
76 Ga0070669_101635692 3300005353 Bacteria 561
77 Ga0070675_100058843 3300005354 Bacteria 3170
78 Ga0070671_100049452 3300005355 Bacteria 3498
79 Ga0070671_100065334 3300005355 Bacteria 3030
80 Ga0070671_100366954 3300005355 Unclassified 1229
81 Ga0070674_100158762 3300005356 Bacteria 1714
82 Ga0070673_100114233 3300005364 Bacteria 2243
83 Ga0070673_100147695 3300005364 Bacteria 1988
84 Ga0070688_100259962 3300005365 Bacteria 1239
85 Ga0070659_100001641 3300005366 Bacteria 16121
86 Ga0070659_100030484 3300005366 Bacteria 4174
87 Ga0070667_100000130 3300005367 Bacteria 95182
88 Ga0070667_100012215 3300005367 Bacteria 7104
89 Ga0070667_100077737 3300005367 Bacteria 2834
90 Ga0070667_100192283 3300005367 Bacteria 1808
91 Ga0070667_100301868 3300005367 Bacteria 1442
92 Ga0070667_101007376 3300005367 Archaea 777
93 Ga0070667_101936277 3300005367 Bacteria 555
94 Ga0070663_100004277 3300005455 Bacteria 8356
95 Ga0070663_100230969 3300005455 Archaea 1457
96 Ga0070663_100409478 3300005455 Bacteria 1110
97 Ga0070663_101359929 3300005455 Bacteria 628
98 Ga0070678_100131791 3300005456 Bacteria 1987
99 Ga0070662_100002851 3300005457 Bacteria 10717
100 Ga0070662_100299508 3300005457 Bacteria 1306
101 Ga0070662_100363157 3300005457 Bacteria 1188
102 Ga0070662_101671252 3300005457 Bacteria 550
103 Ga0068867_100001360 3300005459 Bacteria 16886
104 Ga0068867_100014025 3300005459 Bacteria 5677
105 Ga0070685_10143247 3300005466 Bacteria 1507
106 Ga0068853_100002189 3300005539 Bacteria 14573
107 Ga0068853_100096888 3300005539 Bacteria 2603
108 Ga0068853_100572237 3300005539 Bacteria 1071
109 Ga0070672_100001067 3300005543 Bacteria 16705
110 Ga0070686_101467642 3300005544 Bacteria 574
111 Ga0070696_100205269 3300005546 Bacteria 1473
112 Ga0070665_100001939 3300005548 Bacteria 23328
113 Ga0070665_100034741 3300005548 Bacteria 5070
114 Ga0070665_100149426 3300005548 Bacteria 2339
115 Ga0070665_100892516 3300005548 Bacteria 902
116 Ga0070665_101816852 3300005548 Bacteria 616
117 Ga0068855_100002788 3300005563 Bacteria 21511
118 Ga0068855_100049500 3300005563 Bacteria 4956
119 Ga0068855_100060984 3300005563 Bacteria 4407
120 Ga0068855_100731055 3300005563 Bacteria 1057
121 Ga0070664_100013862 3300005564 Bacteria 6571
122 Ga0070664_100025064 3300005564 Bacteria 4942
123 Ga0070664_100965169 3300005564 Bacteria 800
124 Ga0068857_100000338 3300005577 Bacteria 32330
125 Ga0068857_100168745 3300005577 Bacteria 1988
126 Ga0068857_100409683 3300005577 Bacteria 1262
127 Ga0068857_100568473 3300005577 Bacteria 1069
128 Ga0068854_100003108 3300005578 Bacteria 10326
129 Ga0068854_100004123 3300005578 Bacteria 9131
130 Ga0068854_100152741 3300005578 Bacteria 1782
131 Ga0068854_100272574 3300005578 Bacteria 1359
132 Ga0068854_100297526 3300005578 Bacteria 1304
133 Ga0068854_102140268 3300005578 Unclassified 517
134 Ga0068856_100032072 3300005614 Bacteria 5142
135 Ga0068856_100591645 3300005614 Bacteria 1131
136 Ga0068856_101225306 3300005614 Bacteria 767
137 Ga0068852_100054882 3300005616 Bacteria 3436
138 Ga0068852_100067713 3300005616 Bacteria 3122
139 Ga0068852_100280756 3300005616 Bacteria 1605
140 Ga0068852_100724799 3300005616 Bacteria 1005
141 Ga0068859_100028239 3300005617 Bacteria 5624
142 Ga0068864_100003779 3300005618 Bacteria 12491
143 Ga0068864_100025224 3300005618 Bacteria 5004
144 Ga0068864_100443236 3300005618 Bacteria 1241
145 Ga0068861_100049236 3300005719 Bacteria 3189
146 Ga0068851_10050930 3300005834 Bacteria 2103
147 Ga0068851_11091719 3300005834 Unclassified 506
148 Ga0068870_10124172 3300005840 Bacteria 1491
149 Ga0068863_100000029 3300005841 Bacteria 177191
150 Ga0068863_100004975 3300005841 Bacteria 13100
151 Ga0068863_100019197 3300005841 Bacteria 6544
152 Ga0068858_100020405 3300005842 Bacteria 6196
153 Ga0068858_100082141 3300005842 Bacteria 2995
154 Ga0068858_100118087 3300005842 Bacteria 2479
155 Ga0068860_100008094 3300005843 Bacteria 10470
156 Ga0068860_101443162 3300005843 Bacteria 709
157 Ga0068862_100309571 3300005844 Bacteria 1455
158 Ga0081540_1125772 3300005983 Bacteria 1055
159 Ga0075363_100193889 3300006048 Bacteria 1159
160 Ga0075367_10000211 3300006178 Bacteria 19490
161 Ga0075367_11129412 3300006178 Bacteria 501
162 Ga0097621_100289919 3300006237 Bacteria 1443
163 Ga0097621_100600984 3300006237 Bacteria 1005
164 Ga0075370_10022844 3300006353 Bacteria 3440
165 Ga0068871_100142408 3300006358 Bacteria 2039
166 Ga0068871_100204537 3300006358 Bacteria 1706
167 Ga0068865_100050928 3300006881 Bacteria 2863
168 Ga0068865_100220003 3300006881 Bacteria 1484
169 Ga0097620_100028239 3300006931 Bacteria 5624
170 Ga0099826_10241748 3300006948 Bacteria 957
171 Ga0075435_100284593 3300007076 Bacteria 1412
172 Ga0105251_10002522 3300009011 Bacteria 14291
173 Ga0105250_10264678 3300009092 Bacteria 737
174 Ga0105240_10022129 3300009093 Bacteria 8435
175 Ga0105240_10570939 3300009093 Bacteria 1249
176 Ga0105240_10570991 3300009093 Bacteria 1249
177 Ga0105245_10000128 3300009098 Bacteria 72249
178 Ga0105245_11744492 3300009098 Unclassified 675
179 Ga0105245_12275370 3300009098 Bacteria 596
180 Ga0105243_10030306 3300009148 Bacteria 4164
181 Ga0105241_10007549 3300009174 Bacteria 7995
182 Ga0105241_10108086 3300009174 Bacteria 2223
183 Ga0105242_10062500 3300009176 Bacteria 3064
184 Ga0105242_10619308 3300009176 Bacteria 1048
185 Ga0105248_10047934 3300009177 Bacteria 4792
186 Ga0105248_10735082 3300009177 Bacteria 1113
187 Ga0105248_12134565 3300009177 Bacteria 637
188 Ga0105237_10021289 3300009545 Bacteria 6668
189 Ga0105237_11825889 3300009545 Bacteria 616
190 Ga0105238_10119076 3300009551 Bacteria 2621
191 Ga0105238_10690144 3300009551 Bacteria 1033
192 Ga0105238_10786317 3300009551 Bacteria 967
193 Ga0105238_12408248 3300009551 Bacteria 562
194 Ga0105249_10050027 3300009553 Bacteria 3811
195 Ga0105249_12439722 3300009553 Bacteria 595
196 Ga0105148_100102 3300009978 Bacteria 13611
197 Ga0105239_10037864 3300010375 Bacteria 5284
198 Ga0105239_10580040 3300010375 Bacteria 1278
199 Ga0105239_11431155 3300010375 Bacteria 798
200 Ga0105239_11951219 3300010375 Bacteria 681
201 Ga0105246_10071272 3300011119 Bacteria 2446
202 Ga0157327_1019348 3300012512 Bacteria 752
203 Ga0157373_10032258 3300013100 Bacteria 3771
204 Ga0157373_10209238 3300013100 Bacteria 1375
205 Ga0157373_10743236 3300013100 Bacteria 721
206 Ga0157371_10053361 3300013102 Bacteria 2870
207 Ga0157371_10103257 3300013102 Bacteria 2023
208 Ga0157371_10468351 3300013102 Unclassified 928
209 Ga0157371_11481587 3300013102 Bacteria 529
210 Ga0157370_10134035 3300013104 Bacteria 2309
211 Ga0157369_10627049 3300013105 Bacteria 1109
212 Ga0157374_12922650 3300013296 Unclassified 505
213 Ga0157378_10143488 3300013297 Bacteria 2219
214 Ga0157378_12778230 3300013297 Bacteria 542
215 Ga0163162_10268927 3300013306 Bacteria 1836
216 Ga0157372_10159887 3300013307 Bacteria 2603
217 Ga0157372_10286768 3300013307 Bacteria 1915
218 Ga0157372_10554200 3300013307 Bacteria 1340
219 Ga0157375_10071557 3300013308 Bacteria 3482
220 Ga0157375_10316477 3300013308 Bacteria 1725
221 Ga0163163_10350906 3300014325 Bacteria 1531
222 Ga0163163_10477718 3300014325 Bacteria 1307
223 Ga0157380_10067298 3300014326 Bacteria 2884
224 Ga0157380_12619649 3300014326 Bacteria 570
225 Ga0157377_10243962 3300014745 Bacteria 1161
226 Ga0163161_10108094 3300017792 Bacteria 2076
227 Ga0224712_10423413 3300022467 Bacteria 637
228 Ga0207425_1000005 3300025245 Bacteria 900502
229 Ga0207425_1029763 3300025245 Bacteria 1099
230 Ga0209129_1003227 3300025258 Bacteria 7266
231 Ga0209565_1000007 3300025263 Bacteria 784361
232 Ga0209565_1000044 3300025263 Bacteria 229969
233 Ga0209673_1040734 3300025273 Bacteria 1326
234 Ga0209673_1059972 3300025273 Bacteria 956
235 Ga0209675_1001749 3300025291 Bacteria 11928
236 Ga0209676_1003557 3300025292 Bacteria 9419
237 Ga0209676_1023233 3300025292 Bacteria 2033
238 Ga0209025_1000128 3300025294 Bacteria 198859
239 Ga0209564_1002861 3300025295 Bacteria 12666
240 Ga0209564_1026884 3300025295 Bacteria 1886
241 Ga0209564_1028991 3300025295 Bacteria 1753
242 Ga0209758_1000002 3300025297 Bacteria 1400310
243 Ga0209758_1006895 3300025297 Bacteria 7934
244 Ga0209758_1025394 3300025297 Bacteria 2602
245 Ga0209050_1000001 3300025298 Bacteria 3563507
246 Ga0209050_1004003 3300025298 Bacteria 10389
247 Ga0209050_1023703 3300025298 Bacteria 2149
248 Ga0209050_1034796 3300025298 Bacteria 1500
249 Ga0209256_1000008 3300025299 Bacteria 975723
250 Ga0207426_1033753 3300025302 Bacteria 1647
251 Ga0209051_1002757 3300025303 Bacteria 12133
252 Ga0209051_1073616 3300025303 Bacteria 1017
253 Ga0209257_1000500 3300025304 Bacteria 70060
254 Ga0209257_1001441 3300025304 Bacteria 28096
255 Ga0209257_1002589 3300025304 Bacteria 17568
256 Ga0209257_1030774 3300025304 Bacteria 1727
257 Ga0207697_10139343 3300025315 Archaea 1051
258 Ga0207656_10050907 3300025321 Bacteria 1790
259 Ga0207656_10061607 3300025321 Bacteria 1647
260 Ga0207656_10191557 3300025321 Bacteria 985
261 Ga0207713_1005766 3300025735 Bacteria 7671
262 Ga0207688_10000063 3300025901 Bacteria 38711
263 Ga0207680_10038339 3300025903 Bacteria 2773
264 Ga0207680_10052002 3300025903 Bacteria 2452
265 Ga0207680_10135842 3300025903 Bacteria 1625
266 Ga0207647_10000227 3300025904 Bacteria 46631
267 Ga0207647_10014707 3300025904 Bacteria 5389
268 Ga0207647_10039549 3300025904 Bacteria 2974
269 Ga0207647_10786521 3300025904 Bacteria 513
270 Ga0207645_10017225 3300025907 Bacteria 4772
271 Ga0207645_10225028 3300025907 Archaea 1237
272 Ga0207705_10005148 3300025909 Bacteria 9800
273 Ga0207705_10066990 3300025909 Bacteria 2598
274 Ga0207705_10105306 3300025909 Bacteria 2079
275 Ga0207705_10776297 3300025909 Bacteria 744
276 Ga0207654_10052235 3300025911 Bacteria 2355
277 Ga0207654_10199285 3300025911 Bacteria 1317
278 Ga0207707_10007957 3300025912 Bacteria 9215
279 Ga0207707_10415075 3300025912 Bacteria 1155
280 Ga0207695_10026017 3300025913 Bacteria 6537
281 Ga0207695_10041232 3300025913 Bacteria 4942
282 Ga0207695_10570135 3300025913 Bacteria 1013
283 Ga0207671_11175992 3300025914 Bacteria 601
284 Ga0207660_10001967 3300025917 Bacteria 13698
285 Ga0207660_11239553 3300025917 Bacteria 606
286 Ga0207657_10002137 3300025919 Bacteria 21415
287 Ga0207657_10012153 3300025919 Bacteria 8507
288 Ga0207657_10032461 3300025919 Bacteria 4717
289 Ga0207657_10190977 3300025919 Bacteria 1652
290 Ga0207649_10002828 3300025920 Bacteria 9569
291 Ga0207649_10131100 3300025920 Bacteria 1703
292 Ga0207649_10172155 3300025920 Bacteria 1509
293 Ga0207649_11471647 3300025920 Unclassified 539
294 Ga0207652_10009257 3300025921 Bacteria 7922
295 Ga0207652_10802743 3300025921 Bacteria 836
296 Ga0207681_10025632 3300025923 Bacteria 3795
297 Ga0207681_10032023 3300025923 Bacteria 3439
298 Ga0207681_10040966 3300025923 Bacteria 3085
299 Ga0207681_10131469 3300025923 Bacteria 1851
300 Ga0207681_10237884 3300025923 Bacteria 1416
301 Ga0207694_10053099 3300025924 Bacteria 3142
302 Ga0207694_10110636 3300025924 Bacteria 2185
303 Ga0207694_10175059 3300025924 Bacteria 1739
304 Ga0207694_10247294 3300025924 Bacteria 1458
305 Ga0207650_10052852 3300025925 Bacteria 3010
306 Ga0207650_10082142 3300025925 Bacteria 2445
307 Ga0207650_10172515 3300025925 Unclassified 1720
308 Ga0207650_10204198 3300025925 Bacteria 1584
309 Ga0207650_10724241 3300025925 Bacteria 841
310 Ga0207659_10037839 3300025926 Bacteria 3353
311 Ga0207687_10030679 3300025927 Bacteria 3626
312 Ga0207644_10001293 3300025931 Bacteria 16115
313 Ga0207644_10010767 3300025931 Bacteria 6033
314 Ga0207644_10048860 3300025931 Bacteria 3027
315 Ga0207644_10129545 3300025931 Bacteria 1930
316 Ga0207644_10145733 3300025931 Bacteria 1828
317 Ga0207644_10475598 3300025931 Bacteria 1028
318 Ga0207690_10002642 3300025932 Bacteria 10794
319 Ga0207690_10043892 3300025932 Bacteria 2945
320 Ga0207690_10171761 3300025932 Bacteria 1625
321 Ga0207690_10433697 3300025932 Bacteria 1053
322 Ga0207690_11533811 3300025932 Unclassified 557
323 Ga0207706_10002393 3300025933 Bacteria 18312
324 Ga0207706_10009958 3300025933 Bacteria 8711
325 Ga0207706_10192807 3300025933 Bacteria 1788
326 Ga0207706_10424368 3300025933 Bacteria 1152
327 Ga0207706_10557374 3300025933 Bacteria 986
328 Ga0207706_11131152 3300025933 Bacteria 653
329 Ga0207709_10015536 3300025935 Bacteria 4221
330 Ga0207669_10585091 3300025937 Bacteria 905
331 Ga0207669_10619866 3300025937 Bacteria 881
332 Ga0207704_10225114 3300025938 Bacteria 1391
333 Ga0207704_10242394 3300025938 Bacteria 1348
334 Ga0207691_10000447 3300025940 Bacteria 40805
335 Ga0207711_10004395 3300025941 Bacteria 12014
336 Ga0207711_10004550 3300025941 Bacteria 11798
337 Ga0207711_10056137 3300025941 Bacteria 3383
338 Ga0207711_11150112 3300025941 Unclassified 717
339 Ga0207689_10001047 3300025942 Bacteria 26563
340 Ga0207661_10088172 3300025944 Bacteria 2578
341 Ga0207661_10197444 3300025944 Bacteria 1767
342 Ga0207661_11832004 3300025944 Bacteria 552
343 Ga0207679_10010434 3300025945 Bacteria 5982
344 Ga0207679_10011770 3300025945 Bacteria 5683
345 Ga0207679_10537436 3300025945 Unclassified 1047
346 Ga0207679_10700292 3300025945 Bacteria 919
347 Ga0207679_11147775 3300025945 Unclassified 713
348 Ga0207667_10069521 3300025949 Bacteria 3664
349 Ga0207667_10099561 3300025949 Bacteria 2999
350 Ga0207667_10328634 3300025949 Bacteria 1561
351 Ga0207667_10371111 3300025949 Bacteria 1458
352 Ga0207667_10836801 3300025949 Bacteria 915
353 Ga0207651_10026380 3300025960 Bacteria 3628
354 Ga0207651_10042226 3300025960 Bacteria 3033
355 Ga0207651_10090128 3300025960 Bacteria 2241
356 Ga0207651_11056686 3300025960 Bacteria 727
357 Ga0207712_10041216 3300025961 Bacteria 3172
358 Ga0207668_10006665 3300025972 Bacteria 6828
359 Ga0207668_10015365 3300025972 Bacteria 4755
360 Ga0207640_10005003 3300025981 Bacteria 7206
361 Ga0207640_10008286 3300025981 Bacteria 5768
362 Ga0207640_10009446 3300025981 Bacteria 5463
363 Ga0207640_10010121 3300025981 Bacteria 5302
364 Ga0207640_10434932 3300025981 Bacteria 1077
365 Ga0207640_10775219 3300025981 Bacteria 829
366 Ga0207640_11473521 3300025981 Unclassified 611
367 Ga0207658_10000100 3300025986 Bacteria 95179
368 Ga0207658_10026044 3300025986 Bacteria 4098
369 Ga0207658_10033892 3300025986 Bacteria 3645
370 Ga0207658_10643766 3300025986 Unclassified 955
371 Ga0207658_11200803 3300025986 Bacteria 693
372 Ga0207677_10017509 3300026023 Bacteria 4275
373 Ga0207677_10270282 3300026023 Bacteria 1390
374 Ga0207677_10722817 3300026023 Bacteria 885
375 Ga0207703_10002385 3300026035 Bacteria 16335
376 Ga0207703_10264408 3300026035 Bacteria 1556
377 Ga0207639_10004964 3300026041 Bacteria 8962
378 Ga0207639_10016956 3300026041 Bacteria 5161
379 Ga0207639_10097715 3300026041 Bacteria 2365
380 Ga0207639_10378702 3300026041 Bacteria 1270
381 Ga0207678_10000995 3300026067 Bacteria 25820
382 Ga0207678_10001466 3300026067 Bacteria 21650
383 Ga0207678_10002287 3300026067 Bacteria 17343
384 Ga0207678_10136755 3300026067 Bacteria 2091
385 Ga0207678_11268246 3300026067 Bacteria 652
386 Ga0207678_11500747 3300026067 Bacteria 595
387 Ga0207678_11556602 3300026067 Unclassified 583
388 Ga0207702_10001194 3300026078 Bacteria 26369
389 Ga0207702_10328911 3300026078 Bacteria 1457
390 Ga0207702_10340804 3300026078 Bacteria 1432
391 Ga0207702_11099897 3300026078 Unclassified 789
392 Ga0207641_10000049 3300026088 Bacteria 177222
393 Ga0207641_10443474 3300026088 Unclassified 1253
394 Ga0207641_10693430 3300026088 Bacteria 1002
395 Ga0207648_10010576 3300026089 Bacteria 8730
396 Ga0207648_10063142 3300026089 Bacteria 3229
397 Ga0207676_10003397 3300026095 Bacteria 11248
398 Ga0207676_10094858 3300026095 Bacteria 2459
399 Ga0207676_11287119 3300026095 Bacteria 726
400 Ga0207674_10001201 3300026116 Bacteria 33701
401 Ga0207674_10004331 3300026116 Bacteria 17119
402 Ga0207674_10023799 3300026116 Bacteria 6554
403 Ga0207674_10687159 3300026116 Bacteria 988
404 Ga0207674_10687160 3300026116 Bacteria 988
405 Ga0207675_100037082 3300026118 Bacteria 4548
406 Ga0207683_10003436 3300026121 Bacteria 13804
407 Ga0207683_10112258 3300026121 Bacteria 2441
408 Ga0207698_10008695 3300026142 Bacteria 6436
409 Ga0207698_10020595 3300026142 Bacteria 4543
410 Ga0207698_10098379 3300026142 Bacteria 2417
411 Ga0207698_10139888 3300026142 Bacteria 2083
412 Ga0207698_10617769 3300026142 Bacteria 1070
413 Ga0207698_10939988 3300026142 Bacteria 873
414 Ga0209813_10000033 3300027866 Bacteria 61945
415 Ga0268266_10000919 3300028379 Bacteria 37886
416 Ga0268266_10019470 3300028379 Bacteria 5782
417 Ga0268266_10023554 3300028379 Bacteria 5240
418 Ga0268266_10124016 3300028379 Bacteria 2302
419 Ga0268266_10198237 3300028379 Bacteria 1836
420 Ga0268266_10435017 3300028379 Bacteria 1245
421 Ga0268266_10685492 3300028379 Bacteria 987
422 Ga0268265_10730531 3300028380 Bacteria 959
423 Ga0268264_10018222 3300028381 Bacteria 5743
424 Ga0268264_10037976 3300028381 Bacteria 3972
425 Ga0314311_1054629 3300030733 Bacteria 704
426 Ga0307408_100155056 3300031548 Bacteria 1812
427 Ga0307408_100254688 3300031548 Bacteria 1449
428 Ga0307408_101098651 3300031548 Bacteria 737
429 Ga0307408_101887596 3300031548 Bacteria 572
430 Ga0307405_10071896 3300031731 Bacteria 2227
431 Ga0307405_10095155 3300031731 Bacteria 1982
432 Ga0307405_10219742 3300031731 Bacteria 1393
433 Ga0307405_10394398 3300031731 Bacteria 1081
434 Ga0307405_10572723 3300031731 Bacteria 917
435 Ga0307405_12006214 3300031731 Bacteria 518
436 Ga0307413_10003719 3300031824 Bacteria 6491
437 Ga0307413_10024136 3300031824 Bacteria 3309
438 Ga0307413_11082354 3300031824 Bacteria 691
439 Ga0307410_10001623 3300031852 Bacteria 10326
440 Ga0307410_10138469 3300031852 Bacteria 1797
441 Ga0307410_10198141 3300031852 Bacteria 1531
442 Ga0307410_10311723 3300031852 Bacteria 1245
443 Ga0307406_10327401 3300031901 Bacteria 1188
444 Ga0307406_10361135 3300031901 Bacteria 1138
445 Ga0307406_10751797 3300031901 Bacteria 818
446 Ga0307406_11267009 3300031901 Bacteria 642
447 Ga0307407_10001698 3300031903 Bacteria 8185
448 Ga0307407_10607213 3300031903 Bacteria 815
449 Ga0307407_11472246 3300031903 Bacteria 538
450 Ga0307412_10008913 3300031911 Bacteria 5746
451 Ga0307412_10029915 3300031911 Bacteria 3422
452 Ga0307412_10081422 3300031911 Bacteria 2239
453 Ga0307412_10082195 3300031911 Bacteria 2230
454 Ga0307412_10167883 3300031911 Bacteria 1638
455 Ga0307412_11184068 3300031911 Bacteria 683
456 Ga0307409_100053055 3300031995 Bacteria 3113
457 Ga0307409_100369752 3300031995 Bacteria 1359
458 Ga0307409_100543605 3300031995 Bacteria 1139
459 Ga0307409_101174427 3300031995 Bacteria 790
460 Ga0307409_102111262 3300031995 Bacteria 593
461 Ga0307416_100077154 3300032002 Bacteria 2797
462 Ga0307416_100118153 3300032002 Bacteria 2355
463 Ga0307416_100447567 3300032002 Bacteria 1343
464 Ga0307416_100934364 3300032002 Bacteria 969
465 Ga0307416_101924443 3300032002 Bacteria 694
466 Ga0307414_10000308 3300032004 Bacteria 28338
467 Ga0307414_10150645 3300032004 Bacteria 1835
468 Ga0307414_10184595 3300032004 Bacteria 1681
469 Ga0307414_10186102 3300032004 Bacteria 1675
470 Ga0307414_10345990 3300032004 Bacteria 1274
471 Ga0307411_10371224 3300032005 Bacteria 1173
472 Ga0307411_10405960 3300032005 Bacteria 1127
473 Ga0307415_100092412 3300032126 Bacteria 2194
474 Ga0307415_100833659 3300032126 Bacteria 845
475 Ga0307415_101674188 3300032126 Unclassified 613
476 Ga0307415_101744374 3300032126 Bacteria 601
477 Ga0373959_0166889 3300034820 Bacteria 565
478 Ga0373931_1084413 3300035691 Bacteria 545
479 Ga0395900_0021537 3300037418 Bacteria 6591
480 Ga0395900_0222187 3300037418 Bacteria 1903
481 Ga0395900_0728396 3300037418 Bacteria 923
482 Ga0395900_0918455 3300037418 Bacteria 798
483 Ga0395905_0112293 3300037471 Bacteria 2559
484 Ga0395905_0724727 3300037471 Bacteria 897
485 Ga0395901_1590879 3300038443 Bacteria 607
486 Ga0395901_2127808 3300038443 Bacteria 506
487 Ga0237819_01210 3300038705 Bacteria 7195
488 Ga0439436_0028397 3300041404 Bacteria 1632
489 Ga0439461_0000284 3300041410 Bacteria 7303
490 Ga0439461_0008485 3300041410 Bacteria 1842
491 Ga0439465_0001061 3300041413 Bacteria 8773
492 Ga0439465_0066369 3300041413 Bacteria 1202
493 Ga0451837_1801820 3300041494 Bacteria 722
494 Ga0451843_1564869 3300041509 Bacteria 609
495 Ga0439431_0000617 3300041997 Bacteria 7566
496 Ga0439431_0052479 3300041997 Bacteria 1059
497 Ga0439442_000789 3300042002 Bacteria 6584
498 Ga0439442_017362 3300042002 Bacteria 1485
499 Ga0439445_0002604 3300042004 Bacteria 4017
500 Ga0439445_0004965 3300042004 Bacteria 3021
501 Ga0439445_0039084 3300042004 Bacteria 1256
502 Ga0439432_000379 3300042006 Bacteria 16426
503 Ga0439432_029024 3300042006 Bacteria 1800
504 Ga0439457_071500 3300042014 Bacteria 791
505 Ga0439462_0010528 3300042015 Bacteria 2343
506 Ga0439462_0016569 3300042015 Bacteria 1904
507 Ga0450910_022284 3300042147 Bacteria 963
508 Ga0439446_0053975 3300042156 Bacteria 1204
509 Ga0439446_0075898 3300042156 Bacteria 1034
510 Ga0450909_011190 3300042185 Bacteria 1314
511 Ga0439434_0000379 3300042435 Bacteria 12648
512 Ga0495617_010630 3300046452 Bacteria 3153
513 Ga0495627_097551 3300046453 Bacteria 841
514 Ga0495638_0000051 3300046460 Bacteria 206003
515 Ga0495583_0000582 3300046506 Bacteria 50059
516 Ga0495632_0000356 3300046519 Bacteria 43508
517 Ga0495648_0000032 3300046524 Bacteria 205970
518 Ga0495633_0009727 3300046558 Bacteria 5284
519 Ga0495633_0031761 3300046558 Bacteria 2556
520 Ga0495671_0000020 3300046692 Bacteria 268306
521 Ga0495677_0360121 3300047445 Unclassified 574
522 Ga0495673_0000076 3300047469 Bacteria 205985
523 Ga0495681_0019121 3300047470 Bacteria 3750
524 Ga0495615_0274371 3300048090 Bacteria 540
525 Ga0496100_0008338 3300048903 Bacteria 5773
526 Ga0496101_0000925 3300048904 Bacteria 17314
527 Ga0496102_0023470 3300048905 Bacteria 5480
528 Ga0496102_0395853 3300048905 Bacteria 1299
529 Ga0496104_1584025 3300048907 Bacteria 558
530 Ga0496105_0050298 3300048908 Bacteria 3442
531 Ga0496106_0019762 3300048909 Bacteria 4995
532 Ga0496107_0004578 3300048910 Bacteria 9375
533 Ga0496108_0001130 3300048911 Bacteria 20859
534 Ga0496108_0003458 3300048911 Bacteria 12670
535 Ga0496108_0048187 3300048911 Bacteria 3562
536 Ga0496108_0054812 3300048911 Bacteria 3346
537 Ga0496108_0072387 3300048911 Bacteria 2909
538 Ga0496108_0199336 3300048911 Bacteria 1737
539 Ga0496109_0039921 3300048912 Bacteria 4250
540 Ga0496109_0107971 3300048912 Bacteria 2586
541 Ga0496109_0504844 3300048912 Bacteria 1141
542 Ga0496109_1106035 3300048912 Unclassified 729
543 Ga0496109_1778071 3300048912 Bacteria 550
544 Ga0496110_0134224 3300048913 Bacteria 2236
545 Ga0496110_0417791 3300048913 Unclassified 1223
546 Ga0496110_0883574 3300048913 Bacteria 799
547 Ga0496111_0005412 3300048914 Bacteria 8178
548 Ga0496111_0036948 3300048914 Bacteria 3494
549 Ga0496111_0327753 3300048914 Bacteria 1134
550 Ga0496111_0379346 3300048914 Bacteria 1046
551 Ga0496112_0006800 3300048915 Bacteria 10078
552 Ga0496112_0172174 3300048915 Unclassified 2130
553 Ga0496112_0725029 3300048915 Bacteria 921
554 Ga0496113_0019059 3300048916 Bacteria 4793
555 Ga0496113_0023727 3300048916 Bacteria 4352
556 Ga0496113_1494603 3300048916 Bacteria 521
557 Ga0496115_0000906 3300048918 Bacteria 21502
558 Ga0496116_0088550 3300048919 Bacteria 1891
559 Ga0496117_0064871 3300048920 Bacteria 2486
560 Ga0496117_0140933 3300048920 Bacteria 1444
561 Ga0496117_0575768 3300048920 Bacteria 531
562 Ga0496118_0069140 3300048921 Bacteria 2560
563 Ga0496118_0124616 3300048921 Bacteria 1671
564 Ga0496118_0133474 3300048921 Bacteria 1588
565 Ga0496119_0091487 3300048922 Bacteria 1728
566 Ga0496121_0000472 3300048924 Bacteria 78334
567 Ga0496121_0263204 3300048924 Bacteria 1189
568 Ga0496122_0026332 3300048925 Bacteria 5017
569 Ga0496122_0114436 3300048925 Bacteria 1760
570 Ga0496122_0207715 3300048925 Bacteria 1138
571 Ga0496123_0073319 3300048926 Bacteria 2124
572 Ga0496123_0118019 3300048926 Bacteria 1499
573 Ga0496124_0005716 3300048927 Bacteria 13859
574 Ga0496124_0008647 3300048927 Bacteria 10604
575 Ga0496124_0264410 3300048927 Bacteria 1264
576 Ga0496125_0011375 3300048928 Bacteria 8907
577 Ga0496125_0034223 3300048928 Bacteria 4482
578 Ga0496125_0195103 3300048928 Bacteria 1332
579 Ga0496126_0029630 3300048929 Bacteria 5197
580 Ga0496126_0218046 3300048929 Bacteria 1604
581 Ga0501314_023729 3300049530 Bacteria 652
582 Ga0501034_0184820 3300049571 Bacteria 2048
583 Ga0501047_0564995 3300049581 Bacteria 961
584 Ga0501069_0760492 3300049585 Bacteria 586
585 Ga0501223_003443 3300049663 Bacteria 3443
586 Ga0501224_000006 3300049664 Bacteria 149611
587 Ga0501233_001517 3300049668 Bacteria 3963
588 Ga0501235_001207 3300049669 Bacteria 5436
589 Ga0501235_003472 3300049669 Bacteria 3411
590 Ga0501221_141109 3300049704 Bacteria 631
591 Ga0501221_178131 3300049704 Bacteria 579
592 Ga0501225_0004467 3300049705 Bacteria 4164
593 Ga0501225_0006416 3300049705 Bacteria 3434
594 Ga0501225_0044509 3300049705 Bacteria 1228
595 Ga0501267_000984 3300049764 Bacteria 2351
596 Ga0501044_1540091 3300049823 Unclassified 530
597 Ga0501226_000051 3300049853 Bacteria 49149
598 nmdc:mga03n38_154012_c1 3300050490 Bacteria 1159
599 nmdc:mga06z11_1037182_c1 3300050494 Bacteria 500
600 nmdc:mga06z11_67_c1 3300050494 Bacteria 42818
601 nmdc:mga04h51_55_c1 3300050495 Bacteria 36672
602 nmdc:mga07m45_40831_c1 3300050496 Bacteria 2597
603 nmdc:mga0rr50_191476_c1 3300050513 Bacteria 1676
604 Ga0500643_001599 3300053087 Bacteria 12766
605 Ga0500643_001608 3300053087 Bacteria 12679
606 Ga0500643_013772 3300053087 Bacteria 2839
607 Ga0500644_0157730 3300053088 Bacteria 915
608 Ga0500647_0237847 3300053091 Bacteria 807
609 Ga0500566_0001569 3300053094 Bacteria 13434
610 Ga0500562_014381 3300053108 Bacteria 2026
611 Ga0500562_064434 3300053108 Bacteria 986
612 Ga0500595_078176 3300053119 Bacteria 972
613 Ga0500597_009180 3300053120 Bacteria 3464
614 Ga0500626_315703 3300053128 Bacteria 543
615 Ga0500655_058377 3300053133 Bacteria 775
616 Ga0500658_0000613 3300053134 Bacteria 14781
617 Ga0500658_0004776 3300053134 Bacteria 5049
618 Ga0500568_0054307 3300053139 Bacteria 1567
619 Ga0500573_0001894 3300053140 Bacteria 10212
620 Ga0500604_0051999 3300053151 Bacteria 1267
621 Ga0500624_000004 3300053157 Bacteria 196921
622 Ga0500624_000031 3300053157 Bacteria 104703
623 Ga0500627_0005512 3300053158 Bacteria 4209
624 Ga0500633_0272934 3300053160 Bacteria 626
625 Ga0500637_0000064 3300053178 Bacteria 37882

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002773 JGI25152J39213_1044289 JGI25152J39213_10442892 65
2 3300002774 JGI25150J39212_1000419 JGI25150J39212_10004197 65
3 3300003187 JGI25151J46595_10026619 JGI25151J46595_100266193 65
4 3300003215 JGI25153J46596_10000183 JGI25153J46596_1000018337 65
5 3300003316 rootH1_10107370 rootH1_101073703 65
6 3300003322 rootL2_10077278 rootL2_100772782 65
7 3300003771 Ga0055526_1003689 Ga0055526_10036896 65
8 3300003773 Ga0055537_1002241 Ga0055537_10022413 65
9 3300003781 Ga0055536_1013194 Ga0055536_10131942 65
10 3300003791 Ga0055530_10029152 Ga0055530_100291522 65
11 3300003791 Ga0055530_10045513 Ga0055530_100455132 65
12 3300003791 Ga0055530_10084637 Ga0055530_100846372 65
13 3300003792 Ga0055540_1002521 Ga0055540_10025215 65
14 3300003794 Ga0055531_10037337 Ga0055531_100373372 65
15 3300003794 Ga0055531_10037353 Ga0055531_100373532 65
16 3300005336 Ga0070680_100162804 Ga0070680_1001628042 65
17 3300005338 Ga0068868_101707046 Ga0068868_1017070461 65
18 3300005341 Ga0070691_10098825 Ga0070691_100988252 65
19 3300005344 Ga0070661_100161516 Ga0070661_1001615163 65
20 3300005455 Ga0070663_101359929 Ga0070663_1013599292 65
21 3300005457 Ga0070662_100299508 Ga0070662_1002995082 65
22 3300005539 Ga0068853_100096888 Ga0068853_1000968883 65
23 3300005563 Ga0068855_100060984 Ga0068855_1000609847 65
24 3300005577 Ga0068857_100568473 Ga0068857_1005684732 65
25 3300005578 Ga0068854_100152741 Ga0068854_1001527412 65
26 3300005578 Ga0068854_102140268 Ga0068854_1021402682 65
27 3300005614 Ga0068856_100591645 Ga0068856_1005916452 65
28 3300006881 Ga0068865_100220003 Ga0068865_1002200032 65
29 3300009093 Ga0105240_10022129 Ga0105240_100221293 65
30 3300009098 Ga0105245_12275370 Ga0105245_122753701 65
31 3300009551 Ga0105238_12408248 Ga0105238_124082482 65
32 3300010375 Ga0105239_11951219 Ga0105239_119512191 65
33 3300013297 Ga0157378_12778230 Ga0157378_127782302 65
34 3300014325 Ga0163163_10477718 Ga0163163_104777183 65
35 3300025245 Ga0207425_1000005 Ga0207425_1000005447 65
36 3300025258 Ga0209129_1003227 Ga0209129_10032275 65
37 3300025263 Ga0209565_1000044 Ga0209565_100004429 65
38 3300025273 Ga0209673_1040734 Ga0209673_10407342 65
39 3300025292 Ga0209676_1003557 Ga0209676_10035574 65
40 3300025292 Ga0209676_1023233 Ga0209676_10232332 65
41 3300025294 Ga0209025_1000128 Ga0209025_1000128135 65
42 3300025295 Ga0209564_1002861 Ga0209564_10028612 65
43 3300025295 Ga0209564_1028991 Ga0209564_10289912 65
44 3300025297 Ga0209758_1000002 Ga0209758_1000002897 65
45 3300025297 Ga0209758_1025394 Ga0209758_10253943 65
46 3300025298 Ga0209050_1000001 Ga0209050_1000001890 65
47 3300025298 Ga0209050_1023703 Ga0209050_10237032 65
48 3300025298 Ga0209050_1034796 Ga0209050_10347962 65
49 3300025302 Ga0207426_1033753 Ga0207426_10337532 65
50 3300025303 Ga0209051_1002757 Ga0209051_10027577 65
51 3300025303 Ga0209051_1073616 Ga0209051_10736162 65
52 3300025304 Ga0209257_1000500 Ga0209257_100050017 65
53 3300025304 Ga0209257_1001441 Ga0209257_10014412 65
54 3300025912 Ga0207707_10415075 Ga0207707_104150752 65
55 3300025913 Ga0207695_10026017 Ga0207695_100260172 65
56 3300025917 Ga0207660_11239553 Ga0207660_112395532 65
57 3300025920 Ga0207649_10131100 Ga0207649_101311003 65
58 3300025924 Ga0207694_10247294 Ga0207694_102472942 65
59 3300025933 Ga0207706_10557374 Ga0207706_105573742 65
60 3300025938 Ga0207704_10242394 Ga0207704_102423942 65
61 3300025949 Ga0207667_10836801 Ga0207667_108368012 65
62 3300025981 Ga0207640_10775219 Ga0207640_107752192 65
63 3300026023 Ga0207677_10722817 Ga0207677_107228172 65
64 3300026041 Ga0207639_10378702 Ga0207639_103787022 65
65 3300026067 Ga0207678_11500747 Ga0207678_115007472 65
66 3300026078 Ga0207702_10328911 Ga0207702_103289112 65
67 3300048918 Ga0496115_0000906 Ga0496115_0000906_4609_4809 65
68 3300048920 Ga0496117_0140933 Ga0496117_0140933_789_989 65
69 3300049823 Ga0501044_1540091 Ga0501044_1540091_252_449 65
70 iso_pu_bacteria 2643221563 2643836100 65
71 iso_pu_bacteria 2643221608 2644052577 65
72 iso_pu_bacteria 2852680915 2852683209 65
73 3300000041 ARcpr5oldR_c000401 ARcpr5oldR_0004014 66
74 3300000043 ARcpr5yngRDRAFT_c004387 ARcpr5yngRDRAFT_0043872 66
75 3300000652 ARCol0yngRDRAFT_1011645 ARCol0yngRDRAFT_10116452 66
76 3300003215 JGI25153J46596_10024391 JGI25153J46596_100243912 66
77 3300003773 Ga0055537_1002809 Ga0055537_10028093 66
78 3300003775 Ga0055524_1000601 Ga0055524_100060115 66
79 3300003791 Ga0055530_10016579 Ga0055530_100165792 66
80 3300003794 Ga0055531_10001719 Ga0055531_100017191 66
81 3300005262 Ga0065165_1001302 Ga0065165_10013029 66
82 3300005262 Ga0065165_1002417 Ga0065165_10024172 66
83 3300005262 Ga0065165_1003514 Ga0065165_10035143 66
84 3300005328 Ga0070676_10016276 Ga0070676_100162762 66
85 3300005328 Ga0070676_10073682 Ga0070676_100736822 66
86 3300005329 Ga0070683_100795447 Ga0070683_1007954472 66
87 3300005330 Ga0070690_100005002 Ga0070690_1000050022 66
88 3300005331 Ga0070670_100048407 Ga0070670_1000484074 66
89 3300005333 Ga0070677_10004853 Ga0070677_100048533 66
90 3300005334 Ga0068869_100001204 Ga0068869_1000012044 66
91 3300005335 Ga0070666_10010255 Ga0070666_100102553 66
92 3300005338 Ga0068868_100032967 Ga0068868_1000329673 66
93 3300005338 Ga0068868_100327438 Ga0068868_1003274381 66
94 3300005339 Ga0070660_100002605 Ga0070660_1000026055 66
95 3300005347 Ga0070668_100015614 Ga0070668_1000156143 66
96 3300005353 Ga0070669_100000586 Ga0070669_10000058629 66
97 3300005354 Ga0070675_100058843 Ga0070675_1000588433 66
98 3300005355 Ga0070671_100065334 Ga0070671_1000653344 66
99 3300005356 Ga0070674_100158762 Ga0070674_1001587623 66
100 3300005364 Ga0070673_100114233 Ga0070673_1001142333 66
101 3300005365 Ga0070688_100259962 Ga0070688_1002599622 66
102 3300005366 Ga0070659_100001641 Ga0070659_1000016419 66
103 3300005367 Ga0070667_100012215 Ga0070667_1000122157 66
104 3300005367 Ga0070667_101007376 Ga0070667_1010073761 66
105 3300005455 Ga0070663_100230969 Ga0070663_1002309693 66
106 3300005455 Ga0070663_100409478 Ga0070663_1004094781 66
107 3300005456 Ga0070678_100131791 Ga0070678_1001317914 66
108 3300005457 Ga0070662_100002851 Ga0070662_1000028513 66
109 3300005459 Ga0068867_100001360 Ga0068867_10000136014 66
110 3300005459 Ga0068867_100014025 Ga0068867_1000140253 66
111 3300005539 Ga0068853_100002189 Ga0068853_10000218917 66
112 3300005543 Ga0070672_100001067 Ga0070672_10000106721 66
113 3300005544 Ga0070686_101467642 Ga0070686_1014676421 66
114 3300005548 Ga0070665_100001939 Ga0070665_10000193926 66
115 3300005548 Ga0070665_100149426 Ga0070665_1001494262 66
116 3300005548 Ga0070665_100892516 Ga0070665_1008925161 66
117 3300005548 Ga0070665_101816852 Ga0070665_1018168522 66
118 3300005563 Ga0068855_100002788 Ga0068855_1000027882 66
119 3300005563 Ga0068855_100731055 Ga0068855_1007310552 66
120 3300005564 Ga0070664_100025064 Ga0070664_1000250646 66
121 3300005564 Ga0070664_100965169 Ga0070664_1009651692 66
122 3300005577 Ga0068857_100000338 Ga0068857_1000003382 66
123 3300005577 Ga0068857_100168745 Ga0068857_1001687452 66
124 3300005578 Ga0068854_100003108 Ga0068854_10000310811 66
125 3300005578 Ga0068854_100004123 Ga0068854_1000041232 66
126 3300005616 Ga0068852_100054882 Ga0068852_1000548824 66
127 3300005616 Ga0068852_100067713 Ga0068852_1000677133 66
128 3300005617 Ga0068859_100028239 Ga0068859_1000282395 66
129 3300005618 Ga0068864_100003779 Ga0068864_1000037793 66
130 3300005618 Ga0068864_100443236 Ga0068864_1004432362 66
131 3300005719 Ga0068861_100049236 Ga0068861_1000492364 66
132 3300005834 Ga0068851_11091719 Ga0068851_110917192 66
133 3300005840 Ga0068870_10124172 Ga0068870_101241722 66
134 3300005841 Ga0068863_100004975 Ga0068863_10000497513 66
135 3300005842 Ga0068858_100020405 Ga0068858_1000204056 66
136 3300005843 Ga0068860_100008094 Ga0068860_10000809412 66
137 3300005983 Ga0081540_1125772 Ga0081540_11257722 66
138 3300006178 Ga0075367_11129412 Ga0075367_111294122 66
139 3300006237 Ga0097621_100289919 Ga0097621_1002899192 66
140 3300006358 Ga0068871_100204537 Ga0068871_1002045372 66
141 3300006881 Ga0068865_100050928 Ga0068865_1000509283 66
142 3300006931 Ga0097620_100028239 Ga0097620_1000282395 66
143 3300006948 Ga0099826_10241748 Ga0099826_102417482 66
144 3300007076 Ga0075435_100284593 Ga0075435_1002845932 66
145 3300009098 Ga0105245_10000128 Ga0105245_1000012871 66
146 3300009098 Ga0105245_11744492 Ga0105245_117444922 66
147 3300009148 Ga0105243_10030306 Ga0105243_100303063 66
148 3300009174 Ga0105241_10108086 Ga0105241_101080862 66
149 3300009176 Ga0105242_10619308 Ga0105242_106193082 66
150 3300009177 Ga0105248_10047934 Ga0105248_100479342 66
151 3300009545 Ga0105237_11825889 Ga0105237_118258892 66
152 3300009551 Ga0105238_10119076 Ga0105238_101190762 66
153 3300009553 Ga0105249_12439722 Ga0105249_124397222 66
154 3300010375 Ga0105239_10580040 Ga0105239_105800402 66
155 3300011119 Ga0105246_10071272 Ga0105246_100712723 66
156 3300012512 Ga0157327_1019348 Ga0157327_10193482 66
157 3300013100 Ga0157373_10032258 Ga0157373_100322583 66
158 3300013102 Ga0157371_10053361 Ga0157371_100533612 66
159 3300013296 Ga0157374_12922650 Ga0157374_129226502 66
160 3300013297 Ga0157378_10143488 Ga0157378_101434883 66
161 3300013306 Ga0163162_10268927 Ga0163162_102689272 66
162 3300013307 Ga0157372_10286768 Ga0157372_102867683 66
163 3300013308 Ga0157375_10071557 Ga0157375_100715572 66
164 3300014745 Ga0157377_10243962 Ga0157377_102439622 66
165 3300025245 Ga0207425_1029763 Ga0207425_10297632 66
166 3300025263 Ga0209565_1000007 Ga0209565_1000007282 66
167 3300025273 Ga0209673_1059972 Ga0209673_10599722 66
168 3300025291 Ga0209675_1001749 Ga0209675_10017494 66
169 3300025295 Ga0209564_1026884 Ga0209564_10268842 66
170 3300025297 Ga0209758_1006895 Ga0209758_10068953 66
171 3300025298 Ga0209050_1004003 Ga0209050_10040032 66
172 3300025299 Ga0209256_1000008 Ga0209256_1000008124 66
173 3300025304 Ga0209257_1002589 Ga0209257_10025894 66
174 3300025304 Ga0209257_1030774 Ga0209257_10307742 66
175 3300025315 Ga0207697_10139343 Ga0207697_101393432 66
176 3300025321 Ga0207656_10050907 Ga0207656_100509072 66
177 3300025321 Ga0207656_10191557 Ga0207656_101915572 66
178 3300025901 Ga0207688_10000063 Ga0207688_1000006343 66
179 3300025903 Ga0207680_10052002 Ga0207680_100520022 66
180 3300025903 Ga0207680_10135842 Ga0207680_101358422 66
181 3300025904 Ga0207647_10000227 Ga0207647_100002273 66
182 3300025904 Ga0207647_10039549 Ga0207647_100395492 66
183 3300025907 Ga0207645_10017225 Ga0207645_100172252 66
184 3300025907 Ga0207645_10225028 Ga0207645_102250282 66
185 3300025909 Ga0207705_10066990 Ga0207705_100669903 66
186 3300025909 Ga0207705_10776297 Ga0207705_107762972 66
187 3300025911 Ga0207654_10052235 Ga0207654_100522353 66
188 3300025919 Ga0207657_10002137 Ga0207657_1000213724 66
189 3300025919 Ga0207657_10012153 Ga0207657_100121533 66
190 3300025920 Ga0207649_10172155 Ga0207649_101721551 66
191 3300025921 Ga0207652_10802743 Ga0207652_108027432 66
192 3300025923 Ga0207681_10025632 Ga0207681_100256323 66
193 3300025924 Ga0207694_10053099 Ga0207694_100530993 66
194 3300025925 Ga0207650_10204198 Ga0207650_102041983 66
195 3300025925 Ga0207650_10724241 Ga0207650_107242412 66
196 3300025926 Ga0207659_10037839 Ga0207659_100378393 66
197 3300025927 Ga0207687_10030679 Ga0207687_100306792 66
198 3300025931 Ga0207644_10048860 Ga0207644_100488603 66
199 3300025931 Ga0207644_10475598 Ga0207644_104755982 66
200 3300025932 Ga0207690_10043892 Ga0207690_100438923 66
201 3300025932 Ga0207690_10171761 Ga0207690_101717612 66
202 3300025932 Ga0207690_10433697 Ga0207690_104336972 66
203 3300025932 Ga0207690_11533811 Ga0207690_115338111 66
204 3300025933 Ga0207706_10009958 Ga0207706_1000995810 66
205 3300025935 Ga0207709_10015536 Ga0207709_100155365 66
206 3300025937 Ga0207669_10585091 Ga0207669_105850912 66
207 3300025938 Ga0207704_10225114 Ga0207704_102251142 66
208 3300025940 Ga0207691_10000447 Ga0207691_100004473 66
209 3300025941 Ga0207711_10004550 Ga0207711_1000455012 66
210 3300025942 Ga0207689_10001047 Ga0207689_1000104730 66
211 3300025944 Ga0207661_10197444 Ga0207661_101974442 66
212 3300025944 Ga0207661_11832004 Ga0207661_118320041 66
213 3300025945 Ga0207679_10011770 Ga0207679_100117706 66
214 3300025945 Ga0207679_10537436 Ga0207679_105374362 66
215 3300025945 Ga0207679_10700292 Ga0207679_107002922 66
216 3300025949 Ga0207667_10069521 Ga0207667_100695212 66
217 3300025960 Ga0207651_10026380 Ga0207651_100263802 66
218 3300025960 Ga0207651_11056686 Ga0207651_110566862 66
219 3300025981 Ga0207640_10008286 Ga0207640_100082862 66
220 3300025981 Ga0207640_10009446 Ga0207640_100094462 66
221 3300025981 Ga0207640_11473521 Ga0207640_114735212 66
222 3300025986 Ga0207658_10026044 Ga0207658_100260442 66
223 3300025986 Ga0207658_10033892 Ga0207658_100338922 66
224 3300025986 Ga0207658_10643766 Ga0207658_106437661 66
225 3300026023 Ga0207677_10017509 Ga0207677_100175093 66
226 3300026023 Ga0207677_10270282 Ga0207677_102702823 66
227 3300026035 Ga0207703_10002385 Ga0207703_1000238511 66
228 3300026041 Ga0207639_10097715 Ga0207639_100977152 66
229 3300026067 Ga0207678_10000995 Ga0207678_1000099516 66
230 3300026067 Ga0207678_10136755 Ga0207678_101367553 66
231 3300026067 Ga0207678_11268246 Ga0207678_112682462 66
232 3300026067 Ga0207678_11556602 Ga0207678_115566021 66
233 3300026088 Ga0207641_10693430 Ga0207641_106934302 66
234 3300026089 Ga0207648_10010576 Ga0207648_1001057610 66
235 3300026089 Ga0207648_10063142 Ga0207648_100631423 66
236 3300026095 Ga0207676_10003397 Ga0207676_1000339712 66
237 3300026095 Ga0207676_11287119 Ga0207676_112871192 66
238 3300026116 Ga0207674_10001201 Ga0207674_100012013 66
239 3300026116 Ga0207674_10023799 Ga0207674_100237995 66
240 3300026118 Ga0207675_100037082 Ga0207675_1000370823 66
241 3300026121 Ga0207683_10112258 Ga0207683_101122583 66
242 3300026142 Ga0207698_10008695 Ga0207698_100086953 66
243 3300026142 Ga0207698_10098379 Ga0207698_100983792 66
244 3300026142 Ga0207698_10939988 Ga0207698_109399882 66
245 3300028379 Ga0268266_10000919 Ga0268266_100009191 66
246 3300028379 Ga0268266_10023554 Ga0268266_100235542 66
247 3300028379 Ga0268266_10124016 Ga0268266_101240162 66
248 3300028379 Ga0268266_10198237 Ga0268266_101982372 66
249 3300028379 Ga0268266_10435017 Ga0268266_104350173 66
250 3300028379 Ga0268266_10685492 Ga0268266_106854921 66
251 3300028381 Ga0268264_10018222 Ga0268264_100182223 66
252 3300030733 Ga0314311_1054629 Ga0314311_10546292 66
253 3300031548 Ga0307408_100155056 Ga0307408_1001550562 66
254 3300031731 Ga0307405_10071896 Ga0307405_100718962 66
255 3300031731 Ga0307405_10219742 Ga0307405_102197422 66
256 3300031824 Ga0307413_10003719 Ga0307413_100037194 66
257 3300031824 Ga0307413_10024136 Ga0307413_100241362 66
258 3300031852 Ga0307410_10001623 Ga0307410_100016233 66
259 3300031852 Ga0307410_10138469 Ga0307410_101384692 66
260 3300031901 Ga0307406_10327401 Ga0307406_103274012 66
261 3300031901 Ga0307406_10361135 Ga0307406_103611352 66
262 3300031901 Ga0307406_11267009 Ga0307406_112670091 66
263 3300031903 Ga0307407_10001698 Ga0307407_100016983 66
264 3300031903 Ga0307407_11472246 Ga0307407_114722461 66
265 3300031911 Ga0307412_10081422 Ga0307412_100814222 66
266 3300031911 Ga0307412_10082195 Ga0307412_100821953 66
267 3300031911 Ga0307412_10167883 Ga0307412_101678832 66
268 3300031995 Ga0307409_100053055 Ga0307409_1000530552 66
269 3300031995 Ga0307409_100543605 Ga0307409_1005436051 66
270 3300031995 Ga0307409_101174427 Ga0307409_1011744272 66
271 3300031995 Ga0307409_102111262 Ga0307409_1021112621 66
272 3300032002 Ga0307416_100447567 Ga0307416_1004475671 66
273 3300032002 Ga0307416_100934364 Ga0307416_1009343642 66
274 3300032002 Ga0307416_101924443 Ga0307416_1019244432 66
275 3300032004 Ga0307414_10186102 Ga0307414_101861022 66
276 3300032005 Ga0307411_10405960 Ga0307411_104059602 66
277 3300032126 Ga0307415_100092412 Ga0307415_1000924122 66
278 3300032126 Ga0307415_100833659 Ga0307415_1008336592 66
279 3300032126 Ga0307415_101674188 Ga0307415_1016741881 66
280 3300032126 Ga0307415_101744374 Ga0307415_1017443741 66
281 3300035691 Ga0373931_1084413 Ga0373931_1084413_248_457 66
282 3300037418 Ga0395900_0222187 Ga0395900_0222187_848_1057 66
283 3300037471 Ga0395905_0112293 Ga0395905_0112293_1724_1933 66
284 3300037471 Ga0395905_0724727 Ga0395905_0724727_301_507 66
285 3300038705 Ga0237819_01210 Ga0237819_01210_5703_5903 66
286 3300041404 Ga0439436_0028397 Ga0439436_0028397_142_342 66
287 3300041410 Ga0439461_0000284 Ga0439461_0000284_4877_5077 66
288 3300041410 Ga0439461_0008485 Ga0439461_0008485_432_632 66
289 3300041413 Ga0439465_0001061 Ga0439465_0001061_4939_5139 66
290 3300041413 Ga0439465_0066369 Ga0439465_0066369_150_350 66
291 3300041509 Ga0451843_1564869 Ga0451843_1564869_379_579 66
292 3300041997 Ga0439431_0000617 Ga0439431_0000617_5069_5269 66
293 3300041997 Ga0439431_0052479 Ga0439431_0052479_547_747 66
294 3300042002 Ga0439442_000789 Ga0439442_000789_4966_5166 66
295 3300042002 Ga0439442_017362 Ga0439442_017362_17_217 66
296 3300042004 Ga0439445_0002604 Ga0439445_0002604_3163_3363 66
297 3300042004 Ga0439445_0004965 Ga0439445_0004965_2785_2985 66
298 3300042004 Ga0439445_0039084 Ga0439445_0039084_137_337 66
299 3300042006 Ga0439432_000379 Ga0439432_000379_2205_2405 66
300 3300042006 Ga0439432_029024 Ga0439432_029024_39_239 66
301 3300042014 Ga0439457_071500 Ga0439457_071500_161_361 66
302 3300042015 Ga0439462_0010528 Ga0439462_0010528_2124_2324 66
303 3300042015 Ga0439462_0016569 Ga0439462_0016569_158_358 66
304 3300042147 Ga0450910_022284 Ga0450910_022284_658_858 66
305 3300042156 Ga0439446_0053975 Ga0439446_0053975_798_998 66
306 3300042156 Ga0439446_0075898 Ga0439446_0075898_430_630 66
307 3300042185 Ga0450909_011190 Ga0450909_011190_503_703 66
308 3300042435 Ga0439434_0000379 Ga0439434_0000379_5651_5851 66
309 3300046453 Ga0495627_097551 Ga0495627_097551_53_253 66
310 3300047445 Ga0495677_0360121 Ga0495677_0360121_274_477 66
311 3300047470 Ga0495681_0019121 Ga0495681_0019121_2374_2574 66
312 3300048090 Ga0495615_0274371 Ga0495615_0274371_327_527 66
313 3300049581 Ga0501047_0564995 Ga0501047_0564995_723_923 66
314 3300049764 Ga0501267_000984 Ga0501267_000984_311_511 66
315 3300050494 nmdc:mga06z11_1037182_c1 nmdc:mga06z11_1037182_c1_43_252 66
316 3300050513 nmdc:mga0rr50_191476_c1 nmdc:mga0rr50_191476_c1_828_1037 66
317 3300053087 Ga0500643_001599 Ga0500643_001599_11030_11230 66
318 3300053087 Ga0500643_001608 Ga0500643_001608_1369_1569 66
319 3300053087 Ga0500643_013772 Ga0500643_013772_545_745 66
320 3300053094 Ga0500566_0001569 Ga0500566_0001569_8846_9046 66
321 3300053108 Ga0500562_064434 Ga0500562_064434_115_315 66
322 3300053119 Ga0500595_078176 Ga0500595_078176_601_801 66
323 3300053120 Ga0500597_009180 Ga0500597_009180_2753_2953 66
324 3300053128 Ga0500626_315703 Ga0500626_315703_273_473 66
325 3300053133 Ga0500655_058377 Ga0500655_058377_375_575 66
326 3300053134 Ga0500658_0000613 Ga0500658_0000613_3611_3811 66
327 3300053134 Ga0500658_0004776 Ga0500658_0004776_4108_4308 66
328 3300053139 Ga0500568_0054307 Ga0500568_0054307_985_1185 66
329 3300053140 Ga0500573_0001894 Ga0500573_0001894_4858_5058 66
330 3300053157 Ga0500624_000004 Ga0500624_000004_47916_48116 66
331 3300053178 Ga0500637_0000064 Ga0500637_0000064_10904_11104 66
332 iso_pu_bacteria 2512564014 2512642254 66
333 iso_pu_bacteria 2808606401 2809065318 66
334 iso_pu_bacteria 2808606404 2809081290 66
335 iso_pu_bacteria 2808606405 2809085655 66
336 iso_pu_bacteria 2880518877 2880520838 66
337 3300005331 Ga0070670_100016756 Ga0070670_1000167566 67
338 3300005339 Ga0070660_100659291 Ga0070660_1006592911 67
339 3300005353 Ga0070669_101635692 Ga0070669_1016356921 67
340 3300005367 Ga0070667_100077737 Ga0070667_1000777373 67
341 3300005367 Ga0070667_101936277 Ga0070667_1019362771 67
342 3300005457 Ga0070662_101671252 Ga0070662_1016712522 67
343 3300005614 Ga0068856_101225306 Ga0068856_1012253062 67
344 3300005616 Ga0068852_100724799 Ga0068852_1007247992 67
345 3300005842 Ga0068858_100118087 Ga0068858_1001180872 67
346 3300006237 Ga0097621_100600984 Ga0097621_1006009842 67
347 3300006358 Ga0068871_100142408 Ga0068871_1001424082 67
348 3300009176 Ga0105242_10062500 Ga0105242_100625002 67
349 3300009177 Ga0105248_10735082 Ga0105248_107350822 67
350 3300013308 Ga0157375_10316477 Ga0157375_103164772 67
351 3300025925 Ga0207650_10052852 Ga0207650_100528522 67
352 3300025931 Ga0207644_10001293 Ga0207644_100012939 67
353 3300025933 Ga0207706_11131152 Ga0207706_111311522 67
354 3300025937 Ga0207669_10619866 Ga0207669_106198662 67
355 3300025941 Ga0207711_10004395 Ga0207711_100043959 67
356 3300025960 Ga0207651_10042226 Ga0207651_100422262 67
357 3300026078 Ga0207702_10340804 Ga0207702_103408042 67
358 3300026121 Ga0207683_10003436 Ga0207683_1000343617 67
359 3300034820 Ga0373959_0166889 Ga0373959_0166889_238_444 67
360 3300048903 Ga0496100_0008338 Ga0496100_0008338_1405_1611 67
361 3300048904 Ga0496101_0000925 Ga0496101_0000925_11882_12088 67
362 3300048905 Ga0496102_0023470 Ga0496102_0023470_2329_2535 67
363 3300048908 Ga0496105_0050298 Ga0496105_0050298_2522_2728 67
364 3300048909 Ga0496106_0019762 Ga0496106_0019762_2859_3065 67
365 3300048910 Ga0496107_0004578 Ga0496107_0004578_2604_2810 67
366 3300048911 Ga0496108_0003458 Ga0496108_0003458_10179_10385 67
367 3300048912 Ga0496109_0504844 Ga0496109_0504844_246_452 67
368 3300048912 Ga0496109_1778071 Ga0496109_1778071_203_409 67
369 3300048914 Ga0496111_0005412 Ga0496111_0005412_6405_6611 67
370 3300048915 Ga0496112_0006800 Ga0496112_0006800_9552_9758 67
371 3300049585 Ga0501069_0760492 Ga0501069_0760492_230_436 67
372 3300013100 Ga0157373_10743236 Ga0157373_107432362 68
373 3300025909 Ga0207705_10005148 Ga0207705_100051486 68
374 3300025912 Ga0207707_10007957 Ga0207707_100079575 68
375 3300025917 Ga0207660_10001967 Ga0207660_100019677 68
376 3300025919 Ga0207657_10032461 Ga0207657_100324615 68
377 3300025920 Ga0207649_10002828 Ga0207649_100028284 68
378 3300025921 Ga0207652_10009257 Ga0207652_100092574 68
379 3300025932 Ga0207690_10002642 Ga0207690_100026423 68
380 3300025933 Ga0207706_10002393 Ga0207706_1000239310 68
381 3300025944 Ga0207661_10088172 Ga0207661_100881723 68
382 3300025945 Ga0207679_10010434 Ga0207679_100104343 68
383 3300025949 Ga0207667_10099561 Ga0207667_100995613 68
384 3300025981 Ga0207640_10010121 Ga0207640_100101214 68
385 3300026041 Ga0207639_10004964 Ga0207639_100049644 68
386 3300026067 Ga0207678_10002287 Ga0207678_1000228710 68
387 3300026078 Ga0207702_11099897 Ga0207702_110998972 68
388 3300026116 Ga0207674_10004331 Ga0207674_1000433113 68
389 3300026142 Ga0207698_10020595 Ga0207698_100205955 68
390 3300037418 Ga0395900_0021537 Ga0395900_0021537_5924_6133 68
391 3300037418 Ga0395900_0918455 Ga0395900_0918455_281_490 68
392 3300038443 Ga0395901_1590879 Ga0395901_1590879_99_308 68
393 3300038443 Ga0395901_2127808 Ga0395901_2127808_254_463 68
394 3300001904 JGI24736J21556_1001450 JGI24736J21556_10014503 69
395 3300001915 JGI24741J21665_1000048 JGI24741J21665_100004826 69
396 3300001979 JGI24740J21852_10004476 JGI24740J21852_100044766 69
397 3300001979 JGI24740J21852_10184056 JGI24740J21852_101840561 69
398 3300001989 JGI24739J22299_10011462 JGI24739J22299_100114622 69
399 3300001989 JGI24739J22299_10032373 JGI24739J22299_100323732 69
400 3300001990 JGI24737J22298_10012215 JGI24737J22298_100122152 69
401 3300002067 JGI24735J21928_10008818 JGI24735J21928_100088182 69
402 3300002067 JGI24735J21928_10010559 JGI24735J21928_100105592 69
403 3300002074 JGI24748J21848_1013527 JGI24748J21848_10135272 69
404 3300002075 JGI24738J21930_10000964 JGI24738J21930_100009643 69
405 3300005289 Ga0065704_10224427 Ga0065704_102244272 69
406 3300005289 Ga0065704_10475945 Ga0065704_104759451 69
407 3300005295 Ga0065707_10435928 Ga0065707_104359282 69
408 3300005327 Ga0070658_10119367 Ga0070658_101193672 69
409 3300005329 Ga0070683_100990539 Ga0070683_1009905392 69
410 3300005331 Ga0070670_100062326 Ga0070670_1000623264 69
411 3300005339 Ga0070660_100411818 Ga0070660_1004118181 69
412 3300005344 Ga0070661_100237820 Ga0070661_1002378202 69
413 3300005344 Ga0070661_101178265 Ga0070661_1011782652 69
414 3300005353 Ga0070669_100090315 Ga0070669_1000903153 69
415 3300005355 Ga0070671_100366954 Ga0070671_1003669542 69
416 3300005364 Ga0070673_100147695 Ga0070673_1001476953 69
417 3300005366 Ga0070659_100030484 Ga0070659_1000304843 69
418 3300005367 Ga0070667_100301868 Ga0070667_1003018682 69
419 3300005455 Ga0070663_100004277 Ga0070663_1000042773 69
420 3300005457 Ga0070662_100363157 Ga0070662_1003631572 69
421 3300005539 Ga0068853_100572237 Ga0068853_1005722372 69
422 3300005563 Ga0068855_100049500 Ga0068855_1000495002 69
423 3300005564 Ga0070664_100013862 Ga0070664_1000138623 69
424 3300005577 Ga0068857_100409683 Ga0068857_1004096832 69
425 3300005578 Ga0068854_100272574 Ga0068854_1002725742 69
426 3300005578 Ga0068854_100297526 Ga0068854_1002975262 69
427 3300005614 Ga0068856_100032072 Ga0068856_1000320723 69
428 3300005616 Ga0068852_100280756 Ga0068852_1002807562 69
429 3300005618 Ga0068864_100025224 Ga0068864_1000252243 69
430 3300005834 Ga0068851_10050930 Ga0068851_100509302 69
431 3300005841 Ga0068863_100019197 Ga0068863_1000191976 69
432 3300009011 Ga0105251_10002522 Ga0105251_100025226 69
433 3300009092 Ga0105250_10264678 Ga0105250_102646781 69
434 3300009093 Ga0105240_10570939 Ga0105240_105709392 69
435 3300009093 Ga0105240_10570991 Ga0105240_105709912 69
436 3300009174 Ga0105241_10007549 Ga0105241_100075492 69
437 3300009545 Ga0105237_10021289 Ga0105237_100212892 69
438 3300009551 Ga0105238_10690144 Ga0105238_106901442 69
439 3300009551 Ga0105238_10786317 Ga0105238_107863172 69
440 3300009553 Ga0105249_10050027 Ga0105249_100500272 69
441 3300009978 Ga0105148_100102 Ga0105148_1001023 69
442 3300010375 Ga0105239_10037864 Ga0105239_100378642 69
443 3300010375 Ga0105239_11431155 Ga0105239_114311552 69
444 3300013100 Ga0157373_10209238 Ga0157373_102092382 69
445 3300013102 Ga0157371_10103257 Ga0157371_101032572 69
446 3300013102 Ga0157371_10468351 Ga0157371_104683512 69
447 3300013102 Ga0157371_11481587 Ga0157371_114815872 69
448 3300013104 Ga0157370_10134035 Ga0157370_101340352 69
449 3300013105 Ga0157369_10627049 Ga0157369_106270492 69
450 3300013307 Ga0157372_10159887 Ga0157372_101598872 69
451 3300013307 Ga0157372_10554200 Ga0157372_105542002 69
452 3300014325 Ga0163163_10350906 Ga0163163_103509062 69
453 3300014326 Ga0157380_10067298 Ga0157380_100672982 69
454 3300014326 Ga0157380_12619649 Ga0157380_126196492 69
455 3300017792 Ga0163161_10108094 Ga0163161_101080942 69
456 3300022467 Ga0224712_10423413 Ga0224712_104234131 69
457 3300025321 Ga0207656_10061607 Ga0207656_100616072 69
458 3300025735 Ga0207713_1005766 Ga0207713_10057663 69
459 3300025904 Ga0207647_10014707 Ga0207647_100147072 69
460 3300025904 Ga0207647_10786521 Ga0207647_107865212 69
461 3300025909 Ga0207705_10105306 Ga0207705_101053062 69
462 3300025911 Ga0207654_10199285 Ga0207654_101992852 69
463 3300025913 Ga0207695_10041232 Ga0207695_100412325 69
464 3300025913 Ga0207695_10570135 Ga0207695_105701352 69
465 3300025914 Ga0207671_11175992 Ga0207671_111759921 69
466 3300025919 Ga0207657_10190977 Ga0207657_101909772 69
467 3300025920 Ga0207649_11471647 Ga0207649_114716472 69
468 3300025923 Ga0207681_10032023 Ga0207681_100320232 69
469 3300025924 Ga0207694_10110636 Ga0207694_101106362 69
470 3300025924 Ga0207694_10175059 Ga0207694_101750592 69
471 3300025925 Ga0207650_10172515 Ga0207650_101725152 69
472 3300025931 Ga0207644_10010767 Ga0207644_100107673 69
473 3300025931 Ga0207644_10145733 Ga0207644_101457332 69
474 3300025933 Ga0207706_10192807 Ga0207706_101928072 69
475 3300025933 Ga0207706_10424368 Ga0207706_104243682 69
476 3300025941 Ga0207711_10056137 Ga0207711_100561372 69
477 3300025941 Ga0207711_11150112 Ga0207711_111501122 69
478 3300025945 Ga0207679_11147775 Ga0207679_111477752 69
479 3300025949 Ga0207667_10328634 Ga0207667_103286342 69
480 3300025949 Ga0207667_10371111 Ga0207667_103711112 69
481 3300025960 Ga0207651_10090128 Ga0207651_100901283 69
482 3300025961 Ga0207712_10041216 Ga0207712_100412162 69
483 3300025981 Ga0207640_10005003 Ga0207640_100050035 69
484 3300025981 Ga0207640_10434932 Ga0207640_104349322 69
485 3300026041 Ga0207639_10016956 Ga0207639_100169562 69
486 3300026067 Ga0207678_10001466 Ga0207678_1000146621 69
487 3300026078 Ga0207702_10001194 Ga0207702_100011943 69
488 3300026088 Ga0207641_10443474 Ga0207641_104434742 69
489 3300026095 Ga0207676_10094858 Ga0207676_100948582 69
490 3300026116 Ga0207674_10687159 Ga0207674_106871592 69
491 3300026116 Ga0207674_10687160 Ga0207674_106871602 69
492 3300026142 Ga0207698_10139888 Ga0207698_101398882 69
493 3300026142 Ga0207698_10617769 Ga0207698_106177692 69
494 3300031548 Ga0307408_100254688 Ga0307408_1002546882 69
495 3300031548 Ga0307408_101098651 Ga0307408_1010986511 69
496 3300031548 Ga0307408_101887596 Ga0307408_1018875961 69
497 3300031731 Ga0307405_10095155 Ga0307405_100951553 69
498 3300031731 Ga0307405_10394398 Ga0307405_103943982 69
499 3300031731 Ga0307405_10572723 Ga0307405_105727232 69
500 3300031731 Ga0307405_12006214 Ga0307405_120062142 69
501 3300031824 Ga0307413_11082354 Ga0307413_110823542 69
502 3300031852 Ga0307410_10198141 Ga0307410_101981412 69
503 3300031852 Ga0307410_10311723 Ga0307410_103117232 69
504 3300031901 Ga0307406_10751797 Ga0307406_107517971 69
505 3300031903 Ga0307407_10607213 Ga0307407_106072132 69
506 3300031911 Ga0307412_10008913 Ga0307412_100089132 69
507 3300031911 Ga0307412_10029915 Ga0307412_100299152 69
508 3300031911 Ga0307412_11184068 Ga0307412_111840682 69
509 3300031995 Ga0307409_100369752 Ga0307409_1003697522 69
510 3300032002 Ga0307416_100077154 Ga0307416_1000771543 69
511 3300032002 Ga0307416_100118153 Ga0307416_1001181532 69
512 3300032004 Ga0307414_10000308 Ga0307414_100003085 69
513 3300032004 Ga0307414_10150645 Ga0307414_101506452 69
514 3300032004 Ga0307414_10184595 Ga0307414_101845952 69
515 3300032004 Ga0307414_10345990 Ga0307414_103459902 69
516 3300032005 Ga0307411_10371224 Ga0307411_103712242 69
517 3300037418 Ga0395900_0728396 Ga0395900_0728396_506_718 69
518 3300041494 Ga0451837_1801820 Ga0451837_1801820_32_298 69
519 3300048911 Ga0496108_0072387 Ga0496108_0072387_1389_1601 69
520 3300048911 Ga0496108_0199336 Ga0496108_0199336_104_313 69
521 3300048912 Ga0496109_0107971 Ga0496109_0107971_1200_1412 69
522 3300048912 Ga0496109_1106035 Ga0496109_1106035_221_433 69
523 3300048913 Ga0496110_0134224 Ga0496110_0134224_1968_2177 69
524 3300048913 Ga0496110_0417791 Ga0496110_0417791_663_875 69
525 3300048914 Ga0496111_0036948 Ga0496111_0036948_1645_1854 69
526 3300048915 Ga0496112_0172174 Ga0496112_0172174_863_1075 69
527 3300048916 Ga0496113_0023727 Ga0496113_0023727_3927_4139 69
528 3300048916 Ga0496113_1494603 Ga0496113_1494603_233_445 69
529 3300048921 Ga0496118_0133474 Ga0496118_0133474_278_487 69
530 3300048924 Ga0496121_0263204 Ga0496121_0263204_789_998 69
531 3300048925 Ga0496122_0026332 Ga0496122_0026332_2896_3105 69
532 3300048926 Ga0496123_0073319 Ga0496123_0073319_1067_1276 69
533 3300048927 Ga0496124_0005716 Ga0496124_0005716_11434_11643 69
534 3300048928 Ga0496125_0011375 Ga0496125_0011375_5329_5538 69
535 3300048929 Ga0496126_0218046 Ga0496126_0218046_976_1185 69
536 3300049530 Ga0501314_023729 Ga0501314_023729_349_558 69
537 3300049571 Ga0501034_0184820 Ga0501034_0184820_1336_1545 69
538 3300049663 Ga0501223_003443 Ga0501223_003443_2891_3100 69
539 3300049664 Ga0501224_000006 Ga0501224_000006_2880_3089 69
540 3300049668 Ga0501233_001517 Ga0501233_001517_2733_2942 69
541 3300049669 Ga0501235_001207 Ga0501235_001207_2871_3080 69
542 3300049705 Ga0501225_0004467 Ga0501225_0004467_3210_3419 69
543 3300049705 Ga0501225_0006416 Ga0501225_0006416_486_695 69
544 3300049853 Ga0501226_000051 Ga0501226_000051_2879_3088 69
545 3300053091 Ga0500647_0237847 Ga0500647_0237847_138_347 69
546 3300053108 Ga0500562_014381 Ga0500562_014381_1180_1389 69
547 3300053160 Ga0500633_0272934 Ga0500633_0272934_153_362 69
548 2162886007 SwRhRL2b_contig_1064096 SwRhRL2b_0425.00003890 70
549 3300002074 JGI24748J21848_1011742 JGI24748J21848_10117422 70
550 3300005289 Ga0065704_10071561 Ga0065704_100715614 70
551 3300005331 Ga0070670_100089272 Ga0070670_1000892723 70
552 3300005335 Ga0070666_10037119 Ga0070666_100371194 70
553 3300005347 Ga0070668_100006950 Ga0070668_1000069504 70
554 3300005347 Ga0070668_100089449 Ga0070668_1000894492 70
555 3300005353 Ga0070669_100031265 Ga0070669_1000312653 70
556 3300005353 Ga0070669_100080662 Ga0070669_1000806622 70
557 3300005355 Ga0070671_100049452 Ga0070671_1000494522 70
558 3300005367 Ga0070667_100000130 Ga0070667_10000013021 70
559 3300005367 Ga0070667_100192283 Ga0070667_1001922832 70
560 3300005466 Ga0070685_10143247 Ga0070685_101432472 70
561 3300005546 Ga0070696_100205269 Ga0070696_1002052692 70
562 3300005548 Ga0070665_100034741 Ga0070665_1000347413 70
563 3300005841 Ga0068863_100000029 Ga0068863_10000002991 70
564 3300005842 Ga0068858_100082141 Ga0068858_1000821413 70
565 3300005843 Ga0068860_101443162 Ga0068860_1014431622 70
566 3300005844 Ga0068862_100309571 Ga0068862_1003095712 70
567 3300006048 Ga0075363_100193889 Ga0075363_1001938892 70
568 3300006178 Ga0075367_10000211 Ga0075367_100002114 70
569 3300006353 Ga0075370_10022844 Ga0075370_100228444 70
570 3300009177 Ga0105248_12134565 Ga0105248_121345652 70
571 3300025903 Ga0207680_10038339 Ga0207680_100383393 70
572 3300025923 Ga0207681_10040966 Ga0207681_100409663 70
573 3300025923 Ga0207681_10131469 Ga0207681_101314693 70
574 3300025923 Ga0207681_10237884 Ga0207681_102378841 70
575 3300025925 Ga0207650_10082142 Ga0207650_100821422 70
576 3300025931 Ga0207644_10129545 Ga0207644_101295452 70
577 3300025972 Ga0207668_10006665 Ga0207668_100066652 70
578 3300025972 Ga0207668_10015365 Ga0207668_100153652 70
579 3300025986 Ga0207658_10000100 Ga0207658_1000010073 70
580 3300025986 Ga0207658_11200803 Ga0207658_112008031 70
581 3300026035 Ga0207703_10264408 Ga0207703_102644082 70
582 3300026088 Ga0207641_10000049 Ga0207641_1000004991 70
583 3300027866 Ga0209813_10000033 Ga0209813_1000003334 70
584 3300028379 Ga0268266_10019470 Ga0268266_100194706 70
585 3300028380 Ga0268265_10730531 Ga0268265_107305312 70
586 3300028381 Ga0268264_10037976 Ga0268264_100379762 70
587 3300046452 Ga0495617_010630 Ga0495617_010630_15_239 70
588 3300046460 Ga0495638_0000051 Ga0495638_0000051_161827_162051 70
589 3300046506 Ga0495583_0000582 Ga0495583_0000582_43873_44097 70
590 3300046519 Ga0495632_0000356 Ga0495632_0000356_30564_30788 70
591 3300046524 Ga0495648_0000032 Ga0495648_0000032_43933_44157 70
592 3300046558 Ga0495633_0009727 Ga0495633_0009727_372_590 70
593 3300046558 Ga0495633_0031761 Ga0495633_0031761_41_265 70
594 3300046692 Ga0495671_0000020 Ga0495671_0000020_161195_161419 70
595 3300047469 Ga0495673_0000076 Ga0495673_0000076_44054_44278 70
596 3300048905 Ga0496102_0395853 Ga0496102_0395853_161_373 70
597 3300048907 Ga0496104_1584025 Ga0496104_1584025_82_327 70
598 3300048911 Ga0496108_0001130 Ga0496108_0001130_5769_5981 70
599 3300048911 Ga0496108_0048187 Ga0496108_0048187_93_305 70
600 3300048911 Ga0496108_0054812 Ga0496108_0054812_3075_3287 70
601 3300048912 Ga0496109_0039921 Ga0496109_0039921_179_391 70
602 3300048913 Ga0496110_0883574 Ga0496110_0883574_508_720 70
603 3300048914 Ga0496111_0327753 Ga0496111_0327753_707_919 70
604 3300048914 Ga0496111_0379346 Ga0496111_0379346_737_949 70
605 3300048915 Ga0496112_0725029 Ga0496112_0725029_489_701 70
606 3300048916 Ga0496113_0019059 Ga0496113_0019059_1723_1935 70
607 3300048919 Ga0496116_0088550 Ga0496116_0088550_157_369 70
608 3300048920 Ga0496117_0064871 Ga0496117_0064871_1092_1304 70
609 3300048920 Ga0496117_0575768 Ga0496117_0575768_98_310 70
610 3300048921 Ga0496118_0069140 Ga0496118_0069140_169_381 70
611 3300048921 Ga0496118_0124616 Ga0496118_0124616_987_1199 70
612 3300048922 Ga0496119_0091487 Ga0496119_0091487_591_803 70
613 3300048924 Ga0496121_0000472 Ga0496121_0000472_72485_72697 70
614 3300048925 Ga0496122_0114436 Ga0496122_0114436_225_437 70
615 3300048925 Ga0496122_0207715 Ga0496122_0207715_672_884 70
616 3300048926 Ga0496123_0118019 Ga0496123_0118019_537_749 70
617 3300048927 Ga0496124_0008647 Ga0496124_0008647_5486_5698 70
618 3300048927 Ga0496124_0264410 Ga0496124_0264410_1033_1245 70
619 3300048928 Ga0496125_0034223 Ga0496125_0034223_945_1157 70
620 3300048928 Ga0496125_0195103 Ga0496125_0195103_915_1127 70
621 3300048929 Ga0496126_0029630 Ga0496126_0029630_4886_5098 70
622 3300049669 Ga0501235_003472 Ga0501235_003472_584_796 70
623 3300049704 Ga0501221_141109 Ga0501221_141109_269_481 70
624 3300049704 Ga0501221_178131 Ga0501221_178131_18_230 70
625 3300049705 Ga0501225_0044509 Ga0501225_0044509_227_439 70
626 3300050490 nmdc:mga03n38_154012_c1 nmdc:mga03n38_154012_c1_381_593 70
627 3300050494 nmdc:mga06z11_67_c1 nmdc:mga06z11_67_c1_28921_29133 70
628 3300050495 nmdc:mga04h51_55_c1 nmdc:mga04h51_55_c1_13669_13881 70
629 3300050496 nmdc:mga07m45_40831_c1 nmdc:mga07m45_40831_c1_443_655 70
630 3300053088 Ga0500644_0157730 Ga0500644_0157730_116_340 70
631 3300053151 Ga0500604_0051999 Ga0500604_0051999_885_1112 70
632 3300053157 Ga0500624_000031 Ga0500624_000031_54018_54236 70
633 3300053158 Ga0500627_0005512 Ga0500627_0005512_638_865 70

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09866

DUF2093

Uncharacterized protein conserved in bacteria (DUF2093)

32

73

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nfx-assembly1.cif.gz_W mammalian ribosome nascent chain complex with srp and srp receptor in early state a 0.7986 26 65
7qgg-assembly1.cif.gz_X neuronal rna granules are ribosome complexes stalled at the pre-translocation state 0.7874 26 65
6sgc-assembly1.cif.gz_W2 rabbit 80s ribosome stalled on a poly(a) tail 0.7842 26 65
7oyd-assembly1.cif.gz_W cryo-em structure of a rabbit 80s ribosome with zebrafish dap1b 0.7822 26 65
6lqm-assembly1.cif.gz_f cryo-em structure of a pre-60s ribosomal subunit - state c 0.7811 26 65
ID Description Score Start End Superfamily
af_A0A0P0WE20_22_65_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8047 29 67 3.30.40.10
af_Q69L67_45_94_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7737 29 67 3.30.40.10
af_Q8JGR4_1_63_2.30.170.20 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L24 0.7604 26 65 2.30.170.20
4a17T00 Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L24 0.7419 26 65 2.30.170.20
af_A0A1D6Q9G1_17_63_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7285 25 67 3.30.40.10
ID Description Score Start End GO Terms
AF-G6EBD0-F1-model_v4 DUF2093 domain-containing protein 0.9226 22 65
AF-A0A839H290-F1-model_v4 deleted 0.914 22 66
AF-A0A2N7SDV4-F1-model_v4 deleted 0.9087 22 68
AF-A0A0Q7E0B1-F1-model_v4 DUF2093 domain-containing protein 0.8748 20 68
AF-G6EBD0-F1-model_v4 DUF2093 domain-containing protein 0.8461 22 65

Feature Viewer

pLDDT pTM Quality
89.55 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map