F471110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 295 | 625 | 68 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_1584025|Ga0496104_1584025_82_327 |
| Length | 81 |
| Sequence | VPKSEKGPPDLMLMSNRDRPARLHYMAYSFRVLQAGDHVVCAVTGQKIPLEDLRYWSIARQEPYATAEASAQAELKARGLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 5 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 6 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 7 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 8 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 9 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 10 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 11 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 12 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 13 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 14 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 22 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 23 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 24 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 25 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 26 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 27 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 28 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 31 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 32 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 63 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 194 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 195 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 198 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 200 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 201 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 202 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 203 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 204 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 210 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 211 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 212 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 213 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 214 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 215 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 216 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 217 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 218 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 219 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 220 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 221 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 222 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 223 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 252 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 253 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 254 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 257 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 260 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 261 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 266 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 270 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 277 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 280 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 282 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 283 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 284 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 285 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 287 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 288 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 290 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 291 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 292 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 293 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 295 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.42 |
| Metatranscriptomes | 0.32 |
| Isolates | 1.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.95 |
| Nodule | 0.16 |
| Rhizoplane | 5.21 |
| Rhizosphere | 76.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1064096 | 2162886007 | Bacteria | 5102 |
| 2 | ARcpr5oldR_c000401 | 3300000041 | Bacteria | 5960 |
| 3 | ARcpr5yngRDRAFT_c004387 | 3300000043 | Bacteria | 1337 |
| 4 | ARCol0yngRDRAFT_1011645 | 3300000652 | Bacteria | 647 |
| 5 | JGI24736J21556_1001450 | 3300001904 | Bacteria | 4343 |
| 6 | JGI24741J21665_1000048 | 3300001915 | Bacteria | 29528 |
| 7 | JGI24740J21852_10004476 | 3300001979 | Bacteria | 6015 |
| 8 | JGI24740J21852_10184056 | 3300001979 | Bacteria | 518 |
| 9 | JGI24739J22299_10011462 | 3300001989 | Bacteria | 3272 |
| 10 | JGI24739J22299_10032373 | 3300001989 | Bacteria | 1799 |
| 11 | JGI24737J22298_10012215 | 3300001990 | Bacteria | 2800 |
| 12 | JGI24735J21928_10008818 | 3300002067 | Bacteria | 3253 |
| 13 | JGI24735J21928_10010559 | 3300002067 | Bacteria | 2942 |
| 14 | JGI24748J21848_1011742 | 3300002074 | Bacteria | 1032 |
| 15 | JGI24748J21848_1013527 | 3300002074 | Bacteria | 965 |
| 16 | JGI24738J21930_10000964 | 3300002075 | Bacteria | 8253 |
| 17 | JGI25152J39213_1044289 | 3300002773 | Bacteria | 607 |
| 18 | JGI25150J39212_1000419 | 3300002774 | Bacteria | 19558 |
| 19 | JGI25151J46595_10026619 | 3300003187 | Bacteria | 2331 |
| 20 | JGI25153J46596_10000183 | 3300003215 | Bacteria | 61802 |
| 21 | JGI25153J46596_10024391 | 3300003215 | Bacteria | 2182 |
| 22 | rootH1_10107370 | 3300003316 | Bacteria | 3953 |
| 23 | rootL2_10077278 | 3300003322 | Bacteria | 1262 |
| 24 | Ga0055526_1003689 | 3300003771 | Bacteria | 9576 |
| 25 | Ga0055537_1002241 | 3300003773 | Bacteria | 6668 |
| 26 | Ga0055537_1002809 | 3300003773 | Bacteria | 5589 |
| 27 | Ga0055524_1000601 | 3300003775 | Bacteria | 25841 |
| 28 | Ga0055536_1013194 | 3300003781 | Bacteria | 3002 |
| 29 | Ga0055530_10016579 | 3300003791 | Bacteria | 2347 |
| 30 | Ga0055530_10029152 | 3300003791 | Bacteria | 1479 |
| 31 | Ga0055530_10045513 | 3300003791 | Bacteria | 1047 |
| 32 | Ga0055530_10084637 | 3300003791 | Bacteria | 660 |
| 33 | Ga0055540_1002521 | 3300003792 | Bacteria | 9564 |
| 34 | Ga0055531_10001719 | 3300003794 | Bacteria | 15691 |
| 35 | Ga0055531_10037337 | 3300003794 | Bacteria | 1480 |
| 36 | Ga0055531_10037353 | 3300003794 | Bacteria | 1479 |
| 37 | Ga0065165_1001302 | 3300005262 | Bacteria | 27888 |
| 38 | Ga0065165_1002417 | 3300005262 | Bacteria | 15922 |
| 39 | Ga0065165_1003514 | 3300005262 | Bacteria | 10872 |
| 40 | Ga0065704_10071561 | 3300005289 | Bacteria | 10699 |
| 41 | Ga0065704_10224427 | 3300005289 | Bacteria | 1063 |
| 42 | Ga0065704_10475945 | 3300005289 | Bacteria | 685 |
| 43 | Ga0065707_10435928 | 3300005295 | Bacteria | 815 |
| 44 | Ga0070658_10119367 | 3300005327 | Bacteria | 2190 |
| 45 | Ga0070676_10016276 | 3300005328 | Bacteria | 4110 |
| 46 | Ga0070676_10073682 | 3300005328 | Bacteria | 2055 |
| 47 | Ga0070683_100795447 | 3300005329 | Bacteria | 906 |
| 48 | Ga0070683_100990539 | 3300005329 | Bacteria | 807 |
| 49 | Ga0070690_100005002 | 3300005330 | Bacteria | 7420 |
| 50 | Ga0070670_100016756 | 3300005331 | Bacteria | 6289 |
| 51 | Ga0070670_100048407 | 3300005331 | Bacteria | 3658 |
| 52 | Ga0070670_100062326 | 3300005331 | Bacteria | 3202 |
| 53 | Ga0070670_100089272 | 3300005331 | Bacteria | 2649 |
| 54 | Ga0070677_10004853 | 3300005333 | Bacteria | 4414 |
| 55 | Ga0068869_100001204 | 3300005334 | Bacteria | 15210 |
| 56 | Ga0070666_10010255 | 3300005335 | Bacteria | 5856 |
| 57 | Ga0070666_10037119 | 3300005335 | Bacteria | 3238 |
| 58 | Ga0070680_100162804 | 3300005336 | Bacteria | 1875 |
| 59 | Ga0068868_100032967 | 3300005338 | Bacteria | 3989 |
| 60 | Ga0068868_100327438 | 3300005338 | Bacteria | 1307 |
| 61 | Ga0068868_101707046 | 3300005338 | Bacteria | 593 |
| 62 | Ga0070660_100002605 | 3300005339 | Bacteria | 12382 |
| 63 | Ga0070660_100411818 | 3300005339 | Bacteria | 1119 |
| 64 | Ga0070660_100659291 | 3300005339 | Bacteria | 876 |
| 65 | Ga0070691_10098825 | 3300005341 | Bacteria | 1447 |
| 66 | Ga0070661_100161516 | 3300005344 | Bacteria | 1697 |
| 67 | Ga0070661_100237820 | 3300005344 | Bacteria | 1401 |
| 68 | Ga0070661_101178265 | 3300005344 | Unclassified | 640 |
| 69 | Ga0070668_100006950 | 3300005347 | Bacteria | 8380 |
| 70 | Ga0070668_100015614 | 3300005347 | Bacteria | 5676 |
| 71 | Ga0070668_100089449 | 3300005347 | Bacteria | 2425 |
| 72 | Ga0070669_100000586 | 3300005353 | Bacteria | 27126 |
| 73 | Ga0070669_100031265 | 3300005353 | Bacteria | 3846 |
| 74 | Ga0070669_100080662 | 3300005353 | Bacteria | 2422 |
| 75 | Ga0070669_100090315 | 3300005353 | Bacteria | 2296 |
| 76 | Ga0070669_101635692 | 3300005353 | Bacteria | 561 |
| 77 | Ga0070675_100058843 | 3300005354 | Bacteria | 3170 |
| 78 | Ga0070671_100049452 | 3300005355 | Bacteria | 3498 |
| 79 | Ga0070671_100065334 | 3300005355 | Bacteria | 3030 |
| 80 | Ga0070671_100366954 | 3300005355 | Unclassified | 1229 |
| 81 | Ga0070674_100158762 | 3300005356 | Bacteria | 1714 |
| 82 | Ga0070673_100114233 | 3300005364 | Bacteria | 2243 |
| 83 | Ga0070673_100147695 | 3300005364 | Bacteria | 1988 |
| 84 | Ga0070688_100259962 | 3300005365 | Bacteria | 1239 |
| 85 | Ga0070659_100001641 | 3300005366 | Bacteria | 16121 |
| 86 | Ga0070659_100030484 | 3300005366 | Bacteria | 4174 |
| 87 | Ga0070667_100000130 | 3300005367 | Bacteria | 95182 |
| 88 | Ga0070667_100012215 | 3300005367 | Bacteria | 7104 |
| 89 | Ga0070667_100077737 | 3300005367 | Bacteria | 2834 |
| 90 | Ga0070667_100192283 | 3300005367 | Bacteria | 1808 |
| 91 | Ga0070667_100301868 | 3300005367 | Bacteria | 1442 |
| 92 | Ga0070667_101007376 | 3300005367 | Archaea | 777 |
| 93 | Ga0070667_101936277 | 3300005367 | Bacteria | 555 |
| 94 | Ga0070663_100004277 | 3300005455 | Bacteria | 8356 |
| 95 | Ga0070663_100230969 | 3300005455 | Archaea | 1457 |
| 96 | Ga0070663_100409478 | 3300005455 | Bacteria | 1110 |
| 97 | Ga0070663_101359929 | 3300005455 | Bacteria | 628 |
| 98 | Ga0070678_100131791 | 3300005456 | Bacteria | 1987 |
| 99 | Ga0070662_100002851 | 3300005457 | Bacteria | 10717 |
| 100 | Ga0070662_100299508 | 3300005457 | Bacteria | 1306 |
| 101 | Ga0070662_100363157 | 3300005457 | Bacteria | 1188 |
| 102 | Ga0070662_101671252 | 3300005457 | Bacteria | 550 |
| 103 | Ga0068867_100001360 | 3300005459 | Bacteria | 16886 |
| 104 | Ga0068867_100014025 | 3300005459 | Bacteria | 5677 |
| 105 | Ga0070685_10143247 | 3300005466 | Bacteria | 1507 |
| 106 | Ga0068853_100002189 | 3300005539 | Bacteria | 14573 |
| 107 | Ga0068853_100096888 | 3300005539 | Bacteria | 2603 |
| 108 | Ga0068853_100572237 | 3300005539 | Bacteria | 1071 |
| 109 | Ga0070672_100001067 | 3300005543 | Bacteria | 16705 |
| 110 | Ga0070686_101467642 | 3300005544 | Bacteria | 574 |
| 111 | Ga0070696_100205269 | 3300005546 | Bacteria | 1473 |
| 112 | Ga0070665_100001939 | 3300005548 | Bacteria | 23328 |
| 113 | Ga0070665_100034741 | 3300005548 | Bacteria | 5070 |
| 114 | Ga0070665_100149426 | 3300005548 | Bacteria | 2339 |
| 115 | Ga0070665_100892516 | 3300005548 | Bacteria | 902 |
| 116 | Ga0070665_101816852 | 3300005548 | Bacteria | 616 |
| 117 | Ga0068855_100002788 | 3300005563 | Bacteria | 21511 |
| 118 | Ga0068855_100049500 | 3300005563 | Bacteria | 4956 |
| 119 | Ga0068855_100060984 | 3300005563 | Bacteria | 4407 |
| 120 | Ga0068855_100731055 | 3300005563 | Bacteria | 1057 |
| 121 | Ga0070664_100013862 | 3300005564 | Bacteria | 6571 |
| 122 | Ga0070664_100025064 | 3300005564 | Bacteria | 4942 |
| 123 | Ga0070664_100965169 | 3300005564 | Bacteria | 800 |
| 124 | Ga0068857_100000338 | 3300005577 | Bacteria | 32330 |
| 125 | Ga0068857_100168745 | 3300005577 | Bacteria | 1988 |
| 126 | Ga0068857_100409683 | 3300005577 | Bacteria | 1262 |
| 127 | Ga0068857_100568473 | 3300005577 | Bacteria | 1069 |
| 128 | Ga0068854_100003108 | 3300005578 | Bacteria | 10326 |
| 129 | Ga0068854_100004123 | 3300005578 | Bacteria | 9131 |
| 130 | Ga0068854_100152741 | 3300005578 | Bacteria | 1782 |
| 131 | Ga0068854_100272574 | 3300005578 | Bacteria | 1359 |
| 132 | Ga0068854_100297526 | 3300005578 | Bacteria | 1304 |
| 133 | Ga0068854_102140268 | 3300005578 | Unclassified | 517 |
| 134 | Ga0068856_100032072 | 3300005614 | Bacteria | 5142 |
| 135 | Ga0068856_100591645 | 3300005614 | Bacteria | 1131 |
| 136 | Ga0068856_101225306 | 3300005614 | Bacteria | 767 |
| 137 | Ga0068852_100054882 | 3300005616 | Bacteria | 3436 |
| 138 | Ga0068852_100067713 | 3300005616 | Bacteria | 3122 |
| 139 | Ga0068852_100280756 | 3300005616 | Bacteria | 1605 |
| 140 | Ga0068852_100724799 | 3300005616 | Bacteria | 1005 |
| 141 | Ga0068859_100028239 | 3300005617 | Bacteria | 5624 |
| 142 | Ga0068864_100003779 | 3300005618 | Bacteria | 12491 |
| 143 | Ga0068864_100025224 | 3300005618 | Bacteria | 5004 |
| 144 | Ga0068864_100443236 | 3300005618 | Bacteria | 1241 |
| 145 | Ga0068861_100049236 | 3300005719 | Bacteria | 3189 |
| 146 | Ga0068851_10050930 | 3300005834 | Bacteria | 2103 |
| 147 | Ga0068851_11091719 | 3300005834 | Unclassified | 506 |
| 148 | Ga0068870_10124172 | 3300005840 | Bacteria | 1491 |
| 149 | Ga0068863_100000029 | 3300005841 | Bacteria | 177191 |
| 150 | Ga0068863_100004975 | 3300005841 | Bacteria | 13100 |
| 151 | Ga0068863_100019197 | 3300005841 | Bacteria | 6544 |
| 152 | Ga0068858_100020405 | 3300005842 | Bacteria | 6196 |
| 153 | Ga0068858_100082141 | 3300005842 | Bacteria | 2995 |
| 154 | Ga0068858_100118087 | 3300005842 | Bacteria | 2479 |
| 155 | Ga0068860_100008094 | 3300005843 | Bacteria | 10470 |
| 156 | Ga0068860_101443162 | 3300005843 | Bacteria | 709 |
| 157 | Ga0068862_100309571 | 3300005844 | Bacteria | 1455 |
| 158 | Ga0081540_1125772 | 3300005983 | Bacteria | 1055 |
| 159 | Ga0075363_100193889 | 3300006048 | Bacteria | 1159 |
| 160 | Ga0075367_10000211 | 3300006178 | Bacteria | 19490 |
| 161 | Ga0075367_11129412 | 3300006178 | Bacteria | 501 |
| 162 | Ga0097621_100289919 | 3300006237 | Bacteria | 1443 |
| 163 | Ga0097621_100600984 | 3300006237 | Bacteria | 1005 |
| 164 | Ga0075370_10022844 | 3300006353 | Bacteria | 3440 |
| 165 | Ga0068871_100142408 | 3300006358 | Bacteria | 2039 |
| 166 | Ga0068871_100204537 | 3300006358 | Bacteria | 1706 |
| 167 | Ga0068865_100050928 | 3300006881 | Bacteria | 2863 |
| 168 | Ga0068865_100220003 | 3300006881 | Bacteria | 1484 |
| 169 | Ga0097620_100028239 | 3300006931 | Bacteria | 5624 |
| 170 | Ga0099826_10241748 | 3300006948 | Bacteria | 957 |
| 171 | Ga0075435_100284593 | 3300007076 | Bacteria | 1412 |
| 172 | Ga0105251_10002522 | 3300009011 | Bacteria | 14291 |
| 173 | Ga0105250_10264678 | 3300009092 | Bacteria | 737 |
| 174 | Ga0105240_10022129 | 3300009093 | Bacteria | 8435 |
| 175 | Ga0105240_10570939 | 3300009093 | Bacteria | 1249 |
| 176 | Ga0105240_10570991 | 3300009093 | Bacteria | 1249 |
| 177 | Ga0105245_10000128 | 3300009098 | Bacteria | 72249 |
| 178 | Ga0105245_11744492 | 3300009098 | Unclassified | 675 |
| 179 | Ga0105245_12275370 | 3300009098 | Bacteria | 596 |
| 180 | Ga0105243_10030306 | 3300009148 | Bacteria | 4164 |
| 181 | Ga0105241_10007549 | 3300009174 | Bacteria | 7995 |
| 182 | Ga0105241_10108086 | 3300009174 | Bacteria | 2223 |
| 183 | Ga0105242_10062500 | 3300009176 | Bacteria | 3064 |
| 184 | Ga0105242_10619308 | 3300009176 | Bacteria | 1048 |
| 185 | Ga0105248_10047934 | 3300009177 | Bacteria | 4792 |
| 186 | Ga0105248_10735082 | 3300009177 | Bacteria | 1113 |
| 187 | Ga0105248_12134565 | 3300009177 | Bacteria | 637 |
| 188 | Ga0105237_10021289 | 3300009545 | Bacteria | 6668 |
| 189 | Ga0105237_11825889 | 3300009545 | Bacteria | 616 |
| 190 | Ga0105238_10119076 | 3300009551 | Bacteria | 2621 |
| 191 | Ga0105238_10690144 | 3300009551 | Bacteria | 1033 |
| 192 | Ga0105238_10786317 | 3300009551 | Bacteria | 967 |
| 193 | Ga0105238_12408248 | 3300009551 | Bacteria | 562 |
| 194 | Ga0105249_10050027 | 3300009553 | Bacteria | 3811 |
| 195 | Ga0105249_12439722 | 3300009553 | Bacteria | 595 |
| 196 | Ga0105148_100102 | 3300009978 | Bacteria | 13611 |
| 197 | Ga0105239_10037864 | 3300010375 | Bacteria | 5284 |
| 198 | Ga0105239_10580040 | 3300010375 | Bacteria | 1278 |
| 199 | Ga0105239_11431155 | 3300010375 | Bacteria | 798 |
| 200 | Ga0105239_11951219 | 3300010375 | Bacteria | 681 |
| 201 | Ga0105246_10071272 | 3300011119 | Bacteria | 2446 |
| 202 | Ga0157327_1019348 | 3300012512 | Bacteria | 752 |
| 203 | Ga0157373_10032258 | 3300013100 | Bacteria | 3771 |
| 204 | Ga0157373_10209238 | 3300013100 | Bacteria | 1375 |
| 205 | Ga0157373_10743236 | 3300013100 | Bacteria | 721 |
| 206 | Ga0157371_10053361 | 3300013102 | Bacteria | 2870 |
| 207 | Ga0157371_10103257 | 3300013102 | Bacteria | 2023 |
| 208 | Ga0157371_10468351 | 3300013102 | Unclassified | 928 |
| 209 | Ga0157371_11481587 | 3300013102 | Bacteria | 529 |
| 210 | Ga0157370_10134035 | 3300013104 | Bacteria | 2309 |
| 211 | Ga0157369_10627049 | 3300013105 | Bacteria | 1109 |
| 212 | Ga0157374_12922650 | 3300013296 | Unclassified | 505 |
| 213 | Ga0157378_10143488 | 3300013297 | Bacteria | 2219 |
| 214 | Ga0157378_12778230 | 3300013297 | Bacteria | 542 |
| 215 | Ga0163162_10268927 | 3300013306 | Bacteria | 1836 |
| 216 | Ga0157372_10159887 | 3300013307 | Bacteria | 2603 |
| 217 | Ga0157372_10286768 | 3300013307 | Bacteria | 1915 |
| 218 | Ga0157372_10554200 | 3300013307 | Bacteria | 1340 |
| 219 | Ga0157375_10071557 | 3300013308 | Bacteria | 3482 |
| 220 | Ga0157375_10316477 | 3300013308 | Bacteria | 1725 |
| 221 | Ga0163163_10350906 | 3300014325 | Bacteria | 1531 |
| 222 | Ga0163163_10477718 | 3300014325 | Bacteria | 1307 |
| 223 | Ga0157380_10067298 | 3300014326 | Bacteria | 2884 |
| 224 | Ga0157380_12619649 | 3300014326 | Bacteria | 570 |
| 225 | Ga0157377_10243962 | 3300014745 | Bacteria | 1161 |
| 226 | Ga0163161_10108094 | 3300017792 | Bacteria | 2076 |
| 227 | Ga0224712_10423413 | 3300022467 | Bacteria | 637 |
| 228 | Ga0207425_1000005 | 3300025245 | Bacteria | 900502 |
| 229 | Ga0207425_1029763 | 3300025245 | Bacteria | 1099 |
| 230 | Ga0209129_1003227 | 3300025258 | Bacteria | 7266 |
| 231 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 232 | Ga0209565_1000044 | 3300025263 | Bacteria | 229969 |
| 233 | Ga0209673_1040734 | 3300025273 | Bacteria | 1326 |
| 234 | Ga0209673_1059972 | 3300025273 | Bacteria | 956 |
| 235 | Ga0209675_1001749 | 3300025291 | Bacteria | 11928 |
| 236 | Ga0209676_1003557 | 3300025292 | Bacteria | 9419 |
| 237 | Ga0209676_1023233 | 3300025292 | Bacteria | 2033 |
| 238 | Ga0209025_1000128 | 3300025294 | Bacteria | 198859 |
| 239 | Ga0209564_1002861 | 3300025295 | Bacteria | 12666 |
| 240 | Ga0209564_1026884 | 3300025295 | Bacteria | 1886 |
| 241 | Ga0209564_1028991 | 3300025295 | Bacteria | 1753 |
| 242 | Ga0209758_1000002 | 3300025297 | Bacteria | 1400310 |
| 243 | Ga0209758_1006895 | 3300025297 | Bacteria | 7934 |
| 244 | Ga0209758_1025394 | 3300025297 | Bacteria | 2602 |
| 245 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 246 | Ga0209050_1004003 | 3300025298 | Bacteria | 10389 |
| 247 | Ga0209050_1023703 | 3300025298 | Bacteria | 2149 |
| 248 | Ga0209050_1034796 | 3300025298 | Bacteria | 1500 |
| 249 | Ga0209256_1000008 | 3300025299 | Bacteria | 975723 |
| 250 | Ga0207426_1033753 | 3300025302 | Bacteria | 1647 |
| 251 | Ga0209051_1002757 | 3300025303 | Bacteria | 12133 |
| 252 | Ga0209051_1073616 | 3300025303 | Bacteria | 1017 |
| 253 | Ga0209257_1000500 | 3300025304 | Bacteria | 70060 |
| 254 | Ga0209257_1001441 | 3300025304 | Bacteria | 28096 |
| 255 | Ga0209257_1002589 | 3300025304 | Bacteria | 17568 |
| 256 | Ga0209257_1030774 | 3300025304 | Bacteria | 1727 |
| 257 | Ga0207697_10139343 | 3300025315 | Archaea | 1051 |
| 258 | Ga0207656_10050907 | 3300025321 | Bacteria | 1790 |
| 259 | Ga0207656_10061607 | 3300025321 | Bacteria | 1647 |
| 260 | Ga0207656_10191557 | 3300025321 | Bacteria | 985 |
| 261 | Ga0207713_1005766 | 3300025735 | Bacteria | 7671 |
| 262 | Ga0207688_10000063 | 3300025901 | Bacteria | 38711 |
| 263 | Ga0207680_10038339 | 3300025903 | Bacteria | 2773 |
| 264 | Ga0207680_10052002 | 3300025903 | Bacteria | 2452 |
| 265 | Ga0207680_10135842 | 3300025903 | Bacteria | 1625 |
| 266 | Ga0207647_10000227 | 3300025904 | Bacteria | 46631 |
| 267 | Ga0207647_10014707 | 3300025904 | Bacteria | 5389 |
| 268 | Ga0207647_10039549 | 3300025904 | Bacteria | 2974 |
| 269 | Ga0207647_10786521 | 3300025904 | Bacteria | 513 |
| 270 | Ga0207645_10017225 | 3300025907 | Bacteria | 4772 |
| 271 | Ga0207645_10225028 | 3300025907 | Archaea | 1237 |
| 272 | Ga0207705_10005148 | 3300025909 | Bacteria | 9800 |
| 273 | Ga0207705_10066990 | 3300025909 | Bacteria | 2598 |
| 274 | Ga0207705_10105306 | 3300025909 | Bacteria | 2079 |
| 275 | Ga0207705_10776297 | 3300025909 | Bacteria | 744 |
| 276 | Ga0207654_10052235 | 3300025911 | Bacteria | 2355 |
| 277 | Ga0207654_10199285 | 3300025911 | Bacteria | 1317 |
| 278 | Ga0207707_10007957 | 3300025912 | Bacteria | 9215 |
| 279 | Ga0207707_10415075 | 3300025912 | Bacteria | 1155 |
| 280 | Ga0207695_10026017 | 3300025913 | Bacteria | 6537 |
| 281 | Ga0207695_10041232 | 3300025913 | Bacteria | 4942 |
| 282 | Ga0207695_10570135 | 3300025913 | Bacteria | 1013 |
| 283 | Ga0207671_11175992 | 3300025914 | Bacteria | 601 |
| 284 | Ga0207660_10001967 | 3300025917 | Bacteria | 13698 |
| 285 | Ga0207660_11239553 | 3300025917 | Bacteria | 606 |
| 286 | Ga0207657_10002137 | 3300025919 | Bacteria | 21415 |
| 287 | Ga0207657_10012153 | 3300025919 | Bacteria | 8507 |
| 288 | Ga0207657_10032461 | 3300025919 | Bacteria | 4717 |
| 289 | Ga0207657_10190977 | 3300025919 | Bacteria | 1652 |
| 290 | Ga0207649_10002828 | 3300025920 | Bacteria | 9569 |
| 291 | Ga0207649_10131100 | 3300025920 | Bacteria | 1703 |
| 292 | Ga0207649_10172155 | 3300025920 | Bacteria | 1509 |
| 293 | Ga0207649_11471647 | 3300025920 | Unclassified | 539 |
| 294 | Ga0207652_10009257 | 3300025921 | Bacteria | 7922 |
| 295 | Ga0207652_10802743 | 3300025921 | Bacteria | 836 |
| 296 | Ga0207681_10025632 | 3300025923 | Bacteria | 3795 |
| 297 | Ga0207681_10032023 | 3300025923 | Bacteria | 3439 |
| 298 | Ga0207681_10040966 | 3300025923 | Bacteria | 3085 |
| 299 | Ga0207681_10131469 | 3300025923 | Bacteria | 1851 |
| 300 | Ga0207681_10237884 | 3300025923 | Bacteria | 1416 |
| 301 | Ga0207694_10053099 | 3300025924 | Bacteria | 3142 |
| 302 | Ga0207694_10110636 | 3300025924 | Bacteria | 2185 |
| 303 | Ga0207694_10175059 | 3300025924 | Bacteria | 1739 |
| 304 | Ga0207694_10247294 | 3300025924 | Bacteria | 1458 |
| 305 | Ga0207650_10052852 | 3300025925 | Bacteria | 3010 |
| 306 | Ga0207650_10082142 | 3300025925 | Bacteria | 2445 |
| 307 | Ga0207650_10172515 | 3300025925 | Unclassified | 1720 |
| 308 | Ga0207650_10204198 | 3300025925 | Bacteria | 1584 |
| 309 | Ga0207650_10724241 | 3300025925 | Bacteria | 841 |
| 310 | Ga0207659_10037839 | 3300025926 | Bacteria | 3353 |
| 311 | Ga0207687_10030679 | 3300025927 | Bacteria | 3626 |
| 312 | Ga0207644_10001293 | 3300025931 | Bacteria | 16115 |
| 313 | Ga0207644_10010767 | 3300025931 | Bacteria | 6033 |
| 314 | Ga0207644_10048860 | 3300025931 | Bacteria | 3027 |
| 315 | Ga0207644_10129545 | 3300025931 | Bacteria | 1930 |
| 316 | Ga0207644_10145733 | 3300025931 | Bacteria | 1828 |
| 317 | Ga0207644_10475598 | 3300025931 | Bacteria | 1028 |
| 318 | Ga0207690_10002642 | 3300025932 | Bacteria | 10794 |
| 319 | Ga0207690_10043892 | 3300025932 | Bacteria | 2945 |
| 320 | Ga0207690_10171761 | 3300025932 | Bacteria | 1625 |
| 321 | Ga0207690_10433697 | 3300025932 | Bacteria | 1053 |
| 322 | Ga0207690_11533811 | 3300025932 | Unclassified | 557 |
| 323 | Ga0207706_10002393 | 3300025933 | Bacteria | 18312 |
| 324 | Ga0207706_10009958 | 3300025933 | Bacteria | 8711 |
| 325 | Ga0207706_10192807 | 3300025933 | Bacteria | 1788 |
| 326 | Ga0207706_10424368 | 3300025933 | Bacteria | 1152 |
| 327 | Ga0207706_10557374 | 3300025933 | Bacteria | 986 |
| 328 | Ga0207706_11131152 | 3300025933 | Bacteria | 653 |
| 329 | Ga0207709_10015536 | 3300025935 | Bacteria | 4221 |
| 330 | Ga0207669_10585091 | 3300025937 | Bacteria | 905 |
| 331 | Ga0207669_10619866 | 3300025937 | Bacteria | 881 |
| 332 | Ga0207704_10225114 | 3300025938 | Bacteria | 1391 |
| 333 | Ga0207704_10242394 | 3300025938 | Bacteria | 1348 |
| 334 | Ga0207691_10000447 | 3300025940 | Bacteria | 40805 |
| 335 | Ga0207711_10004395 | 3300025941 | Bacteria | 12014 |
| 336 | Ga0207711_10004550 | 3300025941 | Bacteria | 11798 |
| 337 | Ga0207711_10056137 | 3300025941 | Bacteria | 3383 |
| 338 | Ga0207711_11150112 | 3300025941 | Unclassified | 717 |
| 339 | Ga0207689_10001047 | 3300025942 | Bacteria | 26563 |
| 340 | Ga0207661_10088172 | 3300025944 | Bacteria | 2578 |
| 341 | Ga0207661_10197444 | 3300025944 | Bacteria | 1767 |
| 342 | Ga0207661_11832004 | 3300025944 | Bacteria | 552 |
| 343 | Ga0207679_10010434 | 3300025945 | Bacteria | 5982 |
| 344 | Ga0207679_10011770 | 3300025945 | Bacteria | 5683 |
| 345 | Ga0207679_10537436 | 3300025945 | Unclassified | 1047 |
| 346 | Ga0207679_10700292 | 3300025945 | Bacteria | 919 |
| 347 | Ga0207679_11147775 | 3300025945 | Unclassified | 713 |
| 348 | Ga0207667_10069521 | 3300025949 | Bacteria | 3664 |
| 349 | Ga0207667_10099561 | 3300025949 | Bacteria | 2999 |
| 350 | Ga0207667_10328634 | 3300025949 | Bacteria | 1561 |
| 351 | Ga0207667_10371111 | 3300025949 | Bacteria | 1458 |
| 352 | Ga0207667_10836801 | 3300025949 | Bacteria | 915 |
| 353 | Ga0207651_10026380 | 3300025960 | Bacteria | 3628 |
| 354 | Ga0207651_10042226 | 3300025960 | Bacteria | 3033 |
| 355 | Ga0207651_10090128 | 3300025960 | Bacteria | 2241 |
| 356 | Ga0207651_11056686 | 3300025960 | Bacteria | 727 |
| 357 | Ga0207712_10041216 | 3300025961 | Bacteria | 3172 |
| 358 | Ga0207668_10006665 | 3300025972 | Bacteria | 6828 |
| 359 | Ga0207668_10015365 | 3300025972 | Bacteria | 4755 |
| 360 | Ga0207640_10005003 | 3300025981 | Bacteria | 7206 |
| 361 | Ga0207640_10008286 | 3300025981 | Bacteria | 5768 |
| 362 | Ga0207640_10009446 | 3300025981 | Bacteria | 5463 |
| 363 | Ga0207640_10010121 | 3300025981 | Bacteria | 5302 |
| 364 | Ga0207640_10434932 | 3300025981 | Bacteria | 1077 |
| 365 | Ga0207640_10775219 | 3300025981 | Bacteria | 829 |
| 366 | Ga0207640_11473521 | 3300025981 | Unclassified | 611 |
| 367 | Ga0207658_10000100 | 3300025986 | Bacteria | 95179 |
| 368 | Ga0207658_10026044 | 3300025986 | Bacteria | 4098 |
| 369 | Ga0207658_10033892 | 3300025986 | Bacteria | 3645 |
| 370 | Ga0207658_10643766 | 3300025986 | Unclassified | 955 |
| 371 | Ga0207658_11200803 | 3300025986 | Bacteria | 693 |
| 372 | Ga0207677_10017509 | 3300026023 | Bacteria | 4275 |
| 373 | Ga0207677_10270282 | 3300026023 | Bacteria | 1390 |
| 374 | Ga0207677_10722817 | 3300026023 | Bacteria | 885 |
| 375 | Ga0207703_10002385 | 3300026035 | Bacteria | 16335 |
| 376 | Ga0207703_10264408 | 3300026035 | Bacteria | 1556 |
| 377 | Ga0207639_10004964 | 3300026041 | Bacteria | 8962 |
| 378 | Ga0207639_10016956 | 3300026041 | Bacteria | 5161 |
| 379 | Ga0207639_10097715 | 3300026041 | Bacteria | 2365 |
| 380 | Ga0207639_10378702 | 3300026041 | Bacteria | 1270 |
| 381 | Ga0207678_10000995 | 3300026067 | Bacteria | 25820 |
| 382 | Ga0207678_10001466 | 3300026067 | Bacteria | 21650 |
| 383 | Ga0207678_10002287 | 3300026067 | Bacteria | 17343 |
| 384 | Ga0207678_10136755 | 3300026067 | Bacteria | 2091 |
| 385 | Ga0207678_11268246 | 3300026067 | Bacteria | 652 |
| 386 | Ga0207678_11500747 | 3300026067 | Bacteria | 595 |
| 387 | Ga0207678_11556602 | 3300026067 | Unclassified | 583 |
| 388 | Ga0207702_10001194 | 3300026078 | Bacteria | 26369 |
| 389 | Ga0207702_10328911 | 3300026078 | Bacteria | 1457 |
| 390 | Ga0207702_10340804 | 3300026078 | Bacteria | 1432 |
| 391 | Ga0207702_11099897 | 3300026078 | Unclassified | 789 |
| 392 | Ga0207641_10000049 | 3300026088 | Bacteria | 177222 |
| 393 | Ga0207641_10443474 | 3300026088 | Unclassified | 1253 |
| 394 | Ga0207641_10693430 | 3300026088 | Bacteria | 1002 |
| 395 | Ga0207648_10010576 | 3300026089 | Bacteria | 8730 |
| 396 | Ga0207648_10063142 | 3300026089 | Bacteria | 3229 |
| 397 | Ga0207676_10003397 | 3300026095 | Bacteria | 11248 |
| 398 | Ga0207676_10094858 | 3300026095 | Bacteria | 2459 |
| 399 | Ga0207676_11287119 | 3300026095 | Bacteria | 726 |
| 400 | Ga0207674_10001201 | 3300026116 | Bacteria | 33701 |
| 401 | Ga0207674_10004331 | 3300026116 | Bacteria | 17119 |
| 402 | Ga0207674_10023799 | 3300026116 | Bacteria | 6554 |
| 403 | Ga0207674_10687159 | 3300026116 | Bacteria | 988 |
| 404 | Ga0207674_10687160 | 3300026116 | Bacteria | 988 |
| 405 | Ga0207675_100037082 | 3300026118 | Bacteria | 4548 |
| 406 | Ga0207683_10003436 | 3300026121 | Bacteria | 13804 |
| 407 | Ga0207683_10112258 | 3300026121 | Bacteria | 2441 |
| 408 | Ga0207698_10008695 | 3300026142 | Bacteria | 6436 |
| 409 | Ga0207698_10020595 | 3300026142 | Bacteria | 4543 |
| 410 | Ga0207698_10098379 | 3300026142 | Bacteria | 2417 |
| 411 | Ga0207698_10139888 | 3300026142 | Bacteria | 2083 |
| 412 | Ga0207698_10617769 | 3300026142 | Bacteria | 1070 |
| 413 | Ga0207698_10939988 | 3300026142 | Bacteria | 873 |
| 414 | Ga0209813_10000033 | 3300027866 | Bacteria | 61945 |
| 415 | Ga0268266_10000919 | 3300028379 | Bacteria | 37886 |
| 416 | Ga0268266_10019470 | 3300028379 | Bacteria | 5782 |
| 417 | Ga0268266_10023554 | 3300028379 | Bacteria | 5240 |
| 418 | Ga0268266_10124016 | 3300028379 | Bacteria | 2302 |
| 419 | Ga0268266_10198237 | 3300028379 | Bacteria | 1836 |
| 420 | Ga0268266_10435017 | 3300028379 | Bacteria | 1245 |
| 421 | Ga0268266_10685492 | 3300028379 | Bacteria | 987 |
| 422 | Ga0268265_10730531 | 3300028380 | Bacteria | 959 |
| 423 | Ga0268264_10018222 | 3300028381 | Bacteria | 5743 |
| 424 | Ga0268264_10037976 | 3300028381 | Bacteria | 3972 |
| 425 | Ga0314311_1054629 | 3300030733 | Bacteria | 704 |
| 426 | Ga0307408_100155056 | 3300031548 | Bacteria | 1812 |
| 427 | Ga0307408_100254688 | 3300031548 | Bacteria | 1449 |
| 428 | Ga0307408_101098651 | 3300031548 | Bacteria | 737 |
| 429 | Ga0307408_101887596 | 3300031548 | Bacteria | 572 |
| 430 | Ga0307405_10071896 | 3300031731 | Bacteria | 2227 |
| 431 | Ga0307405_10095155 | 3300031731 | Bacteria | 1982 |
| 432 | Ga0307405_10219742 | 3300031731 | Bacteria | 1393 |
| 433 | Ga0307405_10394398 | 3300031731 | Bacteria | 1081 |
| 434 | Ga0307405_10572723 | 3300031731 | Bacteria | 917 |
| 435 | Ga0307405_12006214 | 3300031731 | Bacteria | 518 |
| 436 | Ga0307413_10003719 | 3300031824 | Bacteria | 6491 |
| 437 | Ga0307413_10024136 | 3300031824 | Bacteria | 3309 |
| 438 | Ga0307413_11082354 | 3300031824 | Bacteria | 691 |
| 439 | Ga0307410_10001623 | 3300031852 | Bacteria | 10326 |
| 440 | Ga0307410_10138469 | 3300031852 | Bacteria | 1797 |
| 441 | Ga0307410_10198141 | 3300031852 | Bacteria | 1531 |
| 442 | Ga0307410_10311723 | 3300031852 | Bacteria | 1245 |
| 443 | Ga0307406_10327401 | 3300031901 | Bacteria | 1188 |
| 444 | Ga0307406_10361135 | 3300031901 | Bacteria | 1138 |
| 445 | Ga0307406_10751797 | 3300031901 | Bacteria | 818 |
| 446 | Ga0307406_11267009 | 3300031901 | Bacteria | 642 |
| 447 | Ga0307407_10001698 | 3300031903 | Bacteria | 8185 |
| 448 | Ga0307407_10607213 | 3300031903 | Bacteria | 815 |
| 449 | Ga0307407_11472246 | 3300031903 | Bacteria | 538 |
| 450 | Ga0307412_10008913 | 3300031911 | Bacteria | 5746 |
| 451 | Ga0307412_10029915 | 3300031911 | Bacteria | 3422 |
| 452 | Ga0307412_10081422 | 3300031911 | Bacteria | 2239 |
| 453 | Ga0307412_10082195 | 3300031911 | Bacteria | 2230 |
| 454 | Ga0307412_10167883 | 3300031911 | Bacteria | 1638 |
| 455 | Ga0307412_11184068 | 3300031911 | Bacteria | 683 |
| 456 | Ga0307409_100053055 | 3300031995 | Bacteria | 3113 |
| 457 | Ga0307409_100369752 | 3300031995 | Bacteria | 1359 |
| 458 | Ga0307409_100543605 | 3300031995 | Bacteria | 1139 |
| 459 | Ga0307409_101174427 | 3300031995 | Bacteria | 790 |
| 460 | Ga0307409_102111262 | 3300031995 | Bacteria | 593 |
| 461 | Ga0307416_100077154 | 3300032002 | Bacteria | 2797 |
| 462 | Ga0307416_100118153 | 3300032002 | Bacteria | 2355 |
| 463 | Ga0307416_100447567 | 3300032002 | Bacteria | 1343 |
| 464 | Ga0307416_100934364 | 3300032002 | Bacteria | 969 |
| 465 | Ga0307416_101924443 | 3300032002 | Bacteria | 694 |
| 466 | Ga0307414_10000308 | 3300032004 | Bacteria | 28338 |
| 467 | Ga0307414_10150645 | 3300032004 | Bacteria | 1835 |
| 468 | Ga0307414_10184595 | 3300032004 | Bacteria | 1681 |
| 469 | Ga0307414_10186102 | 3300032004 | Bacteria | 1675 |
| 470 | Ga0307414_10345990 | 3300032004 | Bacteria | 1274 |
| 471 | Ga0307411_10371224 | 3300032005 | Bacteria | 1173 |
| 472 | Ga0307411_10405960 | 3300032005 | Bacteria | 1127 |
| 473 | Ga0307415_100092412 | 3300032126 | Bacteria | 2194 |
| 474 | Ga0307415_100833659 | 3300032126 | Bacteria | 845 |
| 475 | Ga0307415_101674188 | 3300032126 | Unclassified | 613 |
| 476 | Ga0307415_101744374 | 3300032126 | Bacteria | 601 |
| 477 | Ga0373959_0166889 | 3300034820 | Bacteria | 565 |
| 478 | Ga0373931_1084413 | 3300035691 | Bacteria | 545 |
| 479 | Ga0395900_0021537 | 3300037418 | Bacteria | 6591 |
| 480 | Ga0395900_0222187 | 3300037418 | Bacteria | 1903 |
| 481 | Ga0395900_0728396 | 3300037418 | Bacteria | 923 |
| 482 | Ga0395900_0918455 | 3300037418 | Bacteria | 798 |
| 483 | Ga0395905_0112293 | 3300037471 | Bacteria | 2559 |
| 484 | Ga0395905_0724727 | 3300037471 | Bacteria | 897 |
| 485 | Ga0395901_1590879 | 3300038443 | Bacteria | 607 |
| 486 | Ga0395901_2127808 | 3300038443 | Bacteria | 506 |
| 487 | Ga0237819_01210 | 3300038705 | Bacteria | 7195 |
| 488 | Ga0439436_0028397 | 3300041404 | Bacteria | 1632 |
| 489 | Ga0439461_0000284 | 3300041410 | Bacteria | 7303 |
| 490 | Ga0439461_0008485 | 3300041410 | Bacteria | 1842 |
| 491 | Ga0439465_0001061 | 3300041413 | Bacteria | 8773 |
| 492 | Ga0439465_0066369 | 3300041413 | Bacteria | 1202 |
| 493 | Ga0451837_1801820 | 3300041494 | Bacteria | 722 |
| 494 | Ga0451843_1564869 | 3300041509 | Bacteria | 609 |
| 495 | Ga0439431_0000617 | 3300041997 | Bacteria | 7566 |
| 496 | Ga0439431_0052479 | 3300041997 | Bacteria | 1059 |
| 497 | Ga0439442_000789 | 3300042002 | Bacteria | 6584 |
| 498 | Ga0439442_017362 | 3300042002 | Bacteria | 1485 |
| 499 | Ga0439445_0002604 | 3300042004 | Bacteria | 4017 |
| 500 | Ga0439445_0004965 | 3300042004 | Bacteria | 3021 |
| 501 | Ga0439445_0039084 | 3300042004 | Bacteria | 1256 |
| 502 | Ga0439432_000379 | 3300042006 | Bacteria | 16426 |
| 503 | Ga0439432_029024 | 3300042006 | Bacteria | 1800 |
| 504 | Ga0439457_071500 | 3300042014 | Bacteria | 791 |
| 505 | Ga0439462_0010528 | 3300042015 | Bacteria | 2343 |
| 506 | Ga0439462_0016569 | 3300042015 | Bacteria | 1904 |
| 507 | Ga0450910_022284 | 3300042147 | Bacteria | 963 |
| 508 | Ga0439446_0053975 | 3300042156 | Bacteria | 1204 |
| 509 | Ga0439446_0075898 | 3300042156 | Bacteria | 1034 |
| 510 | Ga0450909_011190 | 3300042185 | Bacteria | 1314 |
| 511 | Ga0439434_0000379 | 3300042435 | Bacteria | 12648 |
| 512 | Ga0495617_010630 | 3300046452 | Bacteria | 3153 |
| 513 | Ga0495627_097551 | 3300046453 | Bacteria | 841 |
| 514 | Ga0495638_0000051 | 3300046460 | Bacteria | 206003 |
| 515 | Ga0495583_0000582 | 3300046506 | Bacteria | 50059 |
| 516 | Ga0495632_0000356 | 3300046519 | Bacteria | 43508 |
| 517 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 518 | Ga0495633_0009727 | 3300046558 | Bacteria | 5284 |
| 519 | Ga0495633_0031761 | 3300046558 | Bacteria | 2556 |
| 520 | Ga0495671_0000020 | 3300046692 | Bacteria | 268306 |
| 521 | Ga0495677_0360121 | 3300047445 | Unclassified | 574 |
| 522 | Ga0495673_0000076 | 3300047469 | Bacteria | 205985 |
| 523 | Ga0495681_0019121 | 3300047470 | Bacteria | 3750 |
| 524 | Ga0495615_0274371 | 3300048090 | Bacteria | 540 |
| 525 | Ga0496100_0008338 | 3300048903 | Bacteria | 5773 |
| 526 | Ga0496101_0000925 | 3300048904 | Bacteria | 17314 |
| 527 | Ga0496102_0023470 | 3300048905 | Bacteria | 5480 |
| 528 | Ga0496102_0395853 | 3300048905 | Bacteria | 1299 |
| 529 | Ga0496104_1584025 | 3300048907 | Bacteria | 558 |
| 530 | Ga0496105_0050298 | 3300048908 | Bacteria | 3442 |
| 531 | Ga0496106_0019762 | 3300048909 | Bacteria | 4995 |
| 532 | Ga0496107_0004578 | 3300048910 | Bacteria | 9375 |
| 533 | Ga0496108_0001130 | 3300048911 | Bacteria | 20859 |
| 534 | Ga0496108_0003458 | 3300048911 | Bacteria | 12670 |
| 535 | Ga0496108_0048187 | 3300048911 | Bacteria | 3562 |
| 536 | Ga0496108_0054812 | 3300048911 | Bacteria | 3346 |
| 537 | Ga0496108_0072387 | 3300048911 | Bacteria | 2909 |
| 538 | Ga0496108_0199336 | 3300048911 | Bacteria | 1737 |
| 539 | Ga0496109_0039921 | 3300048912 | Bacteria | 4250 |
| 540 | Ga0496109_0107971 | 3300048912 | Bacteria | 2586 |
| 541 | Ga0496109_0504844 | 3300048912 | Bacteria | 1141 |
| 542 | Ga0496109_1106035 | 3300048912 | Unclassified | 729 |
| 543 | Ga0496109_1778071 | 3300048912 | Bacteria | 550 |
| 544 | Ga0496110_0134224 | 3300048913 | Bacteria | 2236 |
| 545 | Ga0496110_0417791 | 3300048913 | Unclassified | 1223 |
| 546 | Ga0496110_0883574 | 3300048913 | Bacteria | 799 |
| 547 | Ga0496111_0005412 | 3300048914 | Bacteria | 8178 |
| 548 | Ga0496111_0036948 | 3300048914 | Bacteria | 3494 |
| 549 | Ga0496111_0327753 | 3300048914 | Bacteria | 1134 |
| 550 | Ga0496111_0379346 | 3300048914 | Bacteria | 1046 |
| 551 | Ga0496112_0006800 | 3300048915 | Bacteria | 10078 |
| 552 | Ga0496112_0172174 | 3300048915 | Unclassified | 2130 |
| 553 | Ga0496112_0725029 | 3300048915 | Bacteria | 921 |
| 554 | Ga0496113_0019059 | 3300048916 | Bacteria | 4793 |
| 555 | Ga0496113_0023727 | 3300048916 | Bacteria | 4352 |
| 556 | Ga0496113_1494603 | 3300048916 | Bacteria | 521 |
| 557 | Ga0496115_0000906 | 3300048918 | Bacteria | 21502 |
| 558 | Ga0496116_0088550 | 3300048919 | Bacteria | 1891 |
| 559 | Ga0496117_0064871 | 3300048920 | Bacteria | 2486 |
| 560 | Ga0496117_0140933 | 3300048920 | Bacteria | 1444 |
| 561 | Ga0496117_0575768 | 3300048920 | Bacteria | 531 |
| 562 | Ga0496118_0069140 | 3300048921 | Bacteria | 2560 |
| 563 | Ga0496118_0124616 | 3300048921 | Bacteria | 1671 |
| 564 | Ga0496118_0133474 | 3300048921 | Bacteria | 1588 |
| 565 | Ga0496119_0091487 | 3300048922 | Bacteria | 1728 |
| 566 | Ga0496121_0000472 | 3300048924 | Bacteria | 78334 |
| 567 | Ga0496121_0263204 | 3300048924 | Bacteria | 1189 |
| 568 | Ga0496122_0026332 | 3300048925 | Bacteria | 5017 |
| 569 | Ga0496122_0114436 | 3300048925 | Bacteria | 1760 |
| 570 | Ga0496122_0207715 | 3300048925 | Bacteria | 1138 |
| 571 | Ga0496123_0073319 | 3300048926 | Bacteria | 2124 |
| 572 | Ga0496123_0118019 | 3300048926 | Bacteria | 1499 |
| 573 | Ga0496124_0005716 | 3300048927 | Bacteria | 13859 |
| 574 | Ga0496124_0008647 | 3300048927 | Bacteria | 10604 |
| 575 | Ga0496124_0264410 | 3300048927 | Bacteria | 1264 |
| 576 | Ga0496125_0011375 | 3300048928 | Bacteria | 8907 |
| 577 | Ga0496125_0034223 | 3300048928 | Bacteria | 4482 |
| 578 | Ga0496125_0195103 | 3300048928 | Bacteria | 1332 |
| 579 | Ga0496126_0029630 | 3300048929 | Bacteria | 5197 |
| 580 | Ga0496126_0218046 | 3300048929 | Bacteria | 1604 |
| 581 | Ga0501314_023729 | 3300049530 | Bacteria | 652 |
| 582 | Ga0501034_0184820 | 3300049571 | Bacteria | 2048 |
| 583 | Ga0501047_0564995 | 3300049581 | Bacteria | 961 |
| 584 | Ga0501069_0760492 | 3300049585 | Bacteria | 586 |
| 585 | Ga0501223_003443 | 3300049663 | Bacteria | 3443 |
| 586 | Ga0501224_000006 | 3300049664 | Bacteria | 149611 |
| 587 | Ga0501233_001517 | 3300049668 | Bacteria | 3963 |
| 588 | Ga0501235_001207 | 3300049669 | Bacteria | 5436 |
| 589 | Ga0501235_003472 | 3300049669 | Bacteria | 3411 |
| 590 | Ga0501221_141109 | 3300049704 | Bacteria | 631 |
| 591 | Ga0501221_178131 | 3300049704 | Bacteria | 579 |
| 592 | Ga0501225_0004467 | 3300049705 | Bacteria | 4164 |
| 593 | Ga0501225_0006416 | 3300049705 | Bacteria | 3434 |
| 594 | Ga0501225_0044509 | 3300049705 | Bacteria | 1228 |
| 595 | Ga0501267_000984 | 3300049764 | Bacteria | 2351 |
| 596 | Ga0501044_1540091 | 3300049823 | Unclassified | 530 |
| 597 | Ga0501226_000051 | 3300049853 | Bacteria | 49149 |
| 598 | nmdc:mga03n38_154012_c1 | 3300050490 | Bacteria | 1159 |
| 599 | nmdc:mga06z11_1037182_c1 | 3300050494 | Bacteria | 500 |
| 600 | nmdc:mga06z11_67_c1 | 3300050494 | Bacteria | 42818 |
| 601 | nmdc:mga04h51_55_c1 | 3300050495 | Bacteria | 36672 |
| 602 | nmdc:mga07m45_40831_c1 | 3300050496 | Bacteria | 2597 |
| 603 | nmdc:mga0rr50_191476_c1 | 3300050513 | Bacteria | 1676 |
| 604 | Ga0500643_001599 | 3300053087 | Bacteria | 12766 |
| 605 | Ga0500643_001608 | 3300053087 | Bacteria | 12679 |
| 606 | Ga0500643_013772 | 3300053087 | Bacteria | 2839 |
| 607 | Ga0500644_0157730 | 3300053088 | Bacteria | 915 |
| 608 | Ga0500647_0237847 | 3300053091 | Bacteria | 807 |
| 609 | Ga0500566_0001569 | 3300053094 | Bacteria | 13434 |
| 610 | Ga0500562_014381 | 3300053108 | Bacteria | 2026 |
| 611 | Ga0500562_064434 | 3300053108 | Bacteria | 986 |
| 612 | Ga0500595_078176 | 3300053119 | Bacteria | 972 |
| 613 | Ga0500597_009180 | 3300053120 | Bacteria | 3464 |
| 614 | Ga0500626_315703 | 3300053128 | Bacteria | 543 |
| 615 | Ga0500655_058377 | 3300053133 | Bacteria | 775 |
| 616 | Ga0500658_0000613 | 3300053134 | Bacteria | 14781 |
| 617 | Ga0500658_0004776 | 3300053134 | Bacteria | 5049 |
| 618 | Ga0500568_0054307 | 3300053139 | Bacteria | 1567 |
| 619 | Ga0500573_0001894 | 3300053140 | Bacteria | 10212 |
| 620 | Ga0500604_0051999 | 3300053151 | Bacteria | 1267 |
| 621 | Ga0500624_000004 | 3300053157 | Bacteria | 196921 |
| 622 | Ga0500624_000031 | 3300053157 | Bacteria | 104703 |
| 623 | Ga0500627_0005512 | 3300053158 | Bacteria | 4209 |
| 624 | Ga0500633_0272934 | 3300053160 | Bacteria | 626 |
| 625 | Ga0500637_0000064 | 3300053178 | Bacteria | 37882 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300002773 | JGI25152J39213_1044289 | JGI25152J39213_10442892 | 65 |
| 2 | 3300002774 | JGI25150J39212_1000419 | JGI25150J39212_10004197 | 65 |
| 3 | 3300003187 | JGI25151J46595_10026619 | JGI25151J46595_100266193 | 65 |
| 4 | 3300003215 | JGI25153J46596_10000183 | JGI25153J46596_1000018337 | 65 |
| 5 | 3300003316 | rootH1_10107370 | rootH1_101073703 | 65 |
| 6 | 3300003322 | rootL2_10077278 | rootL2_100772782 | 65 |
| 7 | 3300003771 | Ga0055526_1003689 | Ga0055526_10036896 | 65 |
| 8 | 3300003773 | Ga0055537_1002241 | Ga0055537_10022413 | 65 |
| 9 | 3300003781 | Ga0055536_1013194 | Ga0055536_10131942 | 65 |
| 10 | 3300003791 | Ga0055530_10029152 | Ga0055530_100291522 | 65 |
| 11 | 3300003791 | Ga0055530_10045513 | Ga0055530_100455132 | 65 |
| 12 | 3300003791 | Ga0055530_10084637 | Ga0055530_100846372 | 65 |
| 13 | 3300003792 | Ga0055540_1002521 | Ga0055540_10025215 | 65 |
| 14 | 3300003794 | Ga0055531_10037337 | Ga0055531_100373372 | 65 |
| 15 | 3300003794 | Ga0055531_10037353 | Ga0055531_100373532 | 65 |
| 16 | 3300005336 | Ga0070680_100162804 | Ga0070680_1001628042 | 65 |
| 17 | 3300005338 | Ga0068868_101707046 | Ga0068868_1017070461 | 65 |
| 18 | 3300005341 | Ga0070691_10098825 | Ga0070691_100988252 | 65 |
| 19 | 3300005344 | Ga0070661_100161516 | Ga0070661_1001615163 | 65 |
| 20 | 3300005455 | Ga0070663_101359929 | Ga0070663_1013599292 | 65 |
| 21 | 3300005457 | Ga0070662_100299508 | Ga0070662_1002995082 | 65 |
| 22 | 3300005539 | Ga0068853_100096888 | Ga0068853_1000968883 | 65 |
| 23 | 3300005563 | Ga0068855_100060984 | Ga0068855_1000609847 | 65 |
| 24 | 3300005577 | Ga0068857_100568473 | Ga0068857_1005684732 | 65 |
| 25 | 3300005578 | Ga0068854_100152741 | Ga0068854_1001527412 | 65 |
| 26 | 3300005578 | Ga0068854_102140268 | Ga0068854_1021402682 | 65 |
| 27 | 3300005614 | Ga0068856_100591645 | Ga0068856_1005916452 | 65 |
| 28 | 3300006881 | Ga0068865_100220003 | Ga0068865_1002200032 | 65 |
| 29 | 3300009093 | Ga0105240_10022129 | Ga0105240_100221293 | 65 |
| 30 | 3300009098 | Ga0105245_12275370 | Ga0105245_122753701 | 65 |
| 31 | 3300009551 | Ga0105238_12408248 | Ga0105238_124082482 | 65 |
| 32 | 3300010375 | Ga0105239_11951219 | Ga0105239_119512191 | 65 |
| 33 | 3300013297 | Ga0157378_12778230 | Ga0157378_127782302 | 65 |
| 34 | 3300014325 | Ga0163163_10477718 | Ga0163163_104777183 | 65 |
| 35 | 3300025245 | Ga0207425_1000005 | Ga0207425_1000005447 | 65 |
| 36 | 3300025258 | Ga0209129_1003227 | Ga0209129_10032275 | 65 |
| 37 | 3300025263 | Ga0209565_1000044 | Ga0209565_100004429 | 65 |
| 38 | 3300025273 | Ga0209673_1040734 | Ga0209673_10407342 | 65 |
| 39 | 3300025292 | Ga0209676_1003557 | Ga0209676_10035574 | 65 |
| 40 | 3300025292 | Ga0209676_1023233 | Ga0209676_10232332 | 65 |
| 41 | 3300025294 | Ga0209025_1000128 | Ga0209025_1000128135 | 65 |
| 42 | 3300025295 | Ga0209564_1002861 | Ga0209564_10028612 | 65 |
| 43 | 3300025295 | Ga0209564_1028991 | Ga0209564_10289912 | 65 |
| 44 | 3300025297 | Ga0209758_1000002 | Ga0209758_1000002897 | 65 |
| 45 | 3300025297 | Ga0209758_1025394 | Ga0209758_10253943 | 65 |
| 46 | 3300025298 | Ga0209050_1000001 | Ga0209050_1000001890 | 65 |
| 47 | 3300025298 | Ga0209050_1023703 | Ga0209050_10237032 | 65 |
| 48 | 3300025298 | Ga0209050_1034796 | Ga0209050_10347962 | 65 |
| 49 | 3300025302 | Ga0207426_1033753 | Ga0207426_10337532 | 65 |
| 50 | 3300025303 | Ga0209051_1002757 | Ga0209051_10027577 | 65 |
| 51 | 3300025303 | Ga0209051_1073616 | Ga0209051_10736162 | 65 |
| 52 | 3300025304 | Ga0209257_1000500 | Ga0209257_100050017 | 65 |
| 53 | 3300025304 | Ga0209257_1001441 | Ga0209257_10014412 | 65 |
| 54 | 3300025912 | Ga0207707_10415075 | Ga0207707_104150752 | 65 |
| 55 | 3300025913 | Ga0207695_10026017 | Ga0207695_100260172 | 65 |
| 56 | 3300025917 | Ga0207660_11239553 | Ga0207660_112395532 | 65 |
| 57 | 3300025920 | Ga0207649_10131100 | Ga0207649_101311003 | 65 |
| 58 | 3300025924 | Ga0207694_10247294 | Ga0207694_102472942 | 65 |
| 59 | 3300025933 | Ga0207706_10557374 | Ga0207706_105573742 | 65 |
| 60 | 3300025938 | Ga0207704_10242394 | Ga0207704_102423942 | 65 |
| 61 | 3300025949 | Ga0207667_10836801 | Ga0207667_108368012 | 65 |
| 62 | 3300025981 | Ga0207640_10775219 | Ga0207640_107752192 | 65 |
| 63 | 3300026023 | Ga0207677_10722817 | Ga0207677_107228172 | 65 |
| 64 | 3300026041 | Ga0207639_10378702 | Ga0207639_103787022 | 65 |
| 65 | 3300026067 | Ga0207678_11500747 | Ga0207678_115007472 | 65 |
| 66 | 3300026078 | Ga0207702_10328911 | Ga0207702_103289112 | 65 |
| 67 | 3300048918 | Ga0496115_0000906 | Ga0496115_0000906_4609_4809 | 65 |
| 68 | 3300048920 | Ga0496117_0140933 | Ga0496117_0140933_789_989 | 65 |
| 69 | 3300049823 | Ga0501044_1540091 | Ga0501044_1540091_252_449 | 65 |
| 70 | iso_pu_bacteria | 2643221563 | 2643836100 | 65 |
| 71 | iso_pu_bacteria | 2643221608 | 2644052577 | 65 |
| 72 | iso_pu_bacteria | 2852680915 | 2852683209 | 65 |
| 73 | 3300000041 | ARcpr5oldR_c000401 | ARcpr5oldR_0004014 | 66 |
| 74 | 3300000043 | ARcpr5yngRDRAFT_c004387 | ARcpr5yngRDRAFT_0043872 | 66 |
| 75 | 3300000652 | ARCol0yngRDRAFT_1011645 | ARCol0yngRDRAFT_10116452 | 66 |
| 76 | 3300003215 | JGI25153J46596_10024391 | JGI25153J46596_100243912 | 66 |
| 77 | 3300003773 | Ga0055537_1002809 | Ga0055537_10028093 | 66 |
| 78 | 3300003775 | Ga0055524_1000601 | Ga0055524_100060115 | 66 |
| 79 | 3300003791 | Ga0055530_10016579 | Ga0055530_100165792 | 66 |
| 80 | 3300003794 | Ga0055531_10001719 | Ga0055531_100017191 | 66 |
| 81 | 3300005262 | Ga0065165_1001302 | Ga0065165_10013029 | 66 |
| 82 | 3300005262 | Ga0065165_1002417 | Ga0065165_10024172 | 66 |
| 83 | 3300005262 | Ga0065165_1003514 | Ga0065165_10035143 | 66 |
| 84 | 3300005328 | Ga0070676_10016276 | Ga0070676_100162762 | 66 |
| 85 | 3300005328 | Ga0070676_10073682 | Ga0070676_100736822 | 66 |
| 86 | 3300005329 | Ga0070683_100795447 | Ga0070683_1007954472 | 66 |
| 87 | 3300005330 | Ga0070690_100005002 | Ga0070690_1000050022 | 66 |
| 88 | 3300005331 | Ga0070670_100048407 | Ga0070670_1000484074 | 66 |
| 89 | 3300005333 | Ga0070677_10004853 | Ga0070677_100048533 | 66 |
| 90 | 3300005334 | Ga0068869_100001204 | Ga0068869_1000012044 | 66 |
| 91 | 3300005335 | Ga0070666_10010255 | Ga0070666_100102553 | 66 |
| 92 | 3300005338 | Ga0068868_100032967 | Ga0068868_1000329673 | 66 |
| 93 | 3300005338 | Ga0068868_100327438 | Ga0068868_1003274381 | 66 |
| 94 | 3300005339 | Ga0070660_100002605 | Ga0070660_1000026055 | 66 |
| 95 | 3300005347 | Ga0070668_100015614 | Ga0070668_1000156143 | 66 |
| 96 | 3300005353 | Ga0070669_100000586 | Ga0070669_10000058629 | 66 |
| 97 | 3300005354 | Ga0070675_100058843 | Ga0070675_1000588433 | 66 |
| 98 | 3300005355 | Ga0070671_100065334 | Ga0070671_1000653344 | 66 |
| 99 | 3300005356 | Ga0070674_100158762 | Ga0070674_1001587623 | 66 |
| 100 | 3300005364 | Ga0070673_100114233 | Ga0070673_1001142333 | 66 |
| 101 | 3300005365 | Ga0070688_100259962 | Ga0070688_1002599622 | 66 |
| 102 | 3300005366 | Ga0070659_100001641 | Ga0070659_1000016419 | 66 |
| 103 | 3300005367 | Ga0070667_100012215 | Ga0070667_1000122157 | 66 |
| 104 | 3300005367 | Ga0070667_101007376 | Ga0070667_1010073761 | 66 |
| 105 | 3300005455 | Ga0070663_100230969 | Ga0070663_1002309693 | 66 |
| 106 | 3300005455 | Ga0070663_100409478 | Ga0070663_1004094781 | 66 |
| 107 | 3300005456 | Ga0070678_100131791 | Ga0070678_1001317914 | 66 |
| 108 | 3300005457 | Ga0070662_100002851 | Ga0070662_1000028513 | 66 |
| 109 | 3300005459 | Ga0068867_100001360 | Ga0068867_10000136014 | 66 |
| 110 | 3300005459 | Ga0068867_100014025 | Ga0068867_1000140253 | 66 |
| 111 | 3300005539 | Ga0068853_100002189 | Ga0068853_10000218917 | 66 |
| 112 | 3300005543 | Ga0070672_100001067 | Ga0070672_10000106721 | 66 |
| 113 | 3300005544 | Ga0070686_101467642 | Ga0070686_1014676421 | 66 |
| 114 | 3300005548 | Ga0070665_100001939 | Ga0070665_10000193926 | 66 |
| 115 | 3300005548 | Ga0070665_100149426 | Ga0070665_1001494262 | 66 |
| 116 | 3300005548 | Ga0070665_100892516 | Ga0070665_1008925161 | 66 |
| 117 | 3300005548 | Ga0070665_101816852 | Ga0070665_1018168522 | 66 |
| 118 | 3300005563 | Ga0068855_100002788 | Ga0068855_1000027882 | 66 |
| 119 | 3300005563 | Ga0068855_100731055 | Ga0068855_1007310552 | 66 |
| 120 | 3300005564 | Ga0070664_100025064 | Ga0070664_1000250646 | 66 |
| 121 | 3300005564 | Ga0070664_100965169 | Ga0070664_1009651692 | 66 |
| 122 | 3300005577 | Ga0068857_100000338 | Ga0068857_1000003382 | 66 |
| 123 | 3300005577 | Ga0068857_100168745 | Ga0068857_1001687452 | 66 |
| 124 | 3300005578 | Ga0068854_100003108 | Ga0068854_10000310811 | 66 |
| 125 | 3300005578 | Ga0068854_100004123 | Ga0068854_1000041232 | 66 |
| 126 | 3300005616 | Ga0068852_100054882 | Ga0068852_1000548824 | 66 |
| 127 | 3300005616 | Ga0068852_100067713 | Ga0068852_1000677133 | 66 |
| 128 | 3300005617 | Ga0068859_100028239 | Ga0068859_1000282395 | 66 |
| 129 | 3300005618 | Ga0068864_100003779 | Ga0068864_1000037793 | 66 |
| 130 | 3300005618 | Ga0068864_100443236 | Ga0068864_1004432362 | 66 |
| 131 | 3300005719 | Ga0068861_100049236 | Ga0068861_1000492364 | 66 |
| 132 | 3300005834 | Ga0068851_11091719 | Ga0068851_110917192 | 66 |
| 133 | 3300005840 | Ga0068870_10124172 | Ga0068870_101241722 | 66 |
| 134 | 3300005841 | Ga0068863_100004975 | Ga0068863_10000497513 | 66 |
| 135 | 3300005842 | Ga0068858_100020405 | Ga0068858_1000204056 | 66 |
| 136 | 3300005843 | Ga0068860_100008094 | Ga0068860_10000809412 | 66 |
| 137 | 3300005983 | Ga0081540_1125772 | Ga0081540_11257722 | 66 |
| 138 | 3300006178 | Ga0075367_11129412 | Ga0075367_111294122 | 66 |
| 139 | 3300006237 | Ga0097621_100289919 | Ga0097621_1002899192 | 66 |
| 140 | 3300006358 | Ga0068871_100204537 | Ga0068871_1002045372 | 66 |
| 141 | 3300006881 | Ga0068865_100050928 | Ga0068865_1000509283 | 66 |
| 142 | 3300006931 | Ga0097620_100028239 | Ga0097620_1000282395 | 66 |
| 143 | 3300006948 | Ga0099826_10241748 | Ga0099826_102417482 | 66 |
| 144 | 3300007076 | Ga0075435_100284593 | Ga0075435_1002845932 | 66 |
| 145 | 3300009098 | Ga0105245_10000128 | Ga0105245_1000012871 | 66 |
| 146 | 3300009098 | Ga0105245_11744492 | Ga0105245_117444922 | 66 |
| 147 | 3300009148 | Ga0105243_10030306 | Ga0105243_100303063 | 66 |
| 148 | 3300009174 | Ga0105241_10108086 | Ga0105241_101080862 | 66 |
| 149 | 3300009176 | Ga0105242_10619308 | Ga0105242_106193082 | 66 |
| 150 | 3300009177 | Ga0105248_10047934 | Ga0105248_100479342 | 66 |
| 151 | 3300009545 | Ga0105237_11825889 | Ga0105237_118258892 | 66 |
| 152 | 3300009551 | Ga0105238_10119076 | Ga0105238_101190762 | 66 |
| 153 | 3300009553 | Ga0105249_12439722 | Ga0105249_124397222 | 66 |
| 154 | 3300010375 | Ga0105239_10580040 | Ga0105239_105800402 | 66 |
| 155 | 3300011119 | Ga0105246_10071272 | Ga0105246_100712723 | 66 |
| 156 | 3300012512 | Ga0157327_1019348 | Ga0157327_10193482 | 66 |
| 157 | 3300013100 | Ga0157373_10032258 | Ga0157373_100322583 | 66 |
| 158 | 3300013102 | Ga0157371_10053361 | Ga0157371_100533612 | 66 |
| 159 | 3300013296 | Ga0157374_12922650 | Ga0157374_129226502 | 66 |
| 160 | 3300013297 | Ga0157378_10143488 | Ga0157378_101434883 | 66 |
| 161 | 3300013306 | Ga0163162_10268927 | Ga0163162_102689272 | 66 |
| 162 | 3300013307 | Ga0157372_10286768 | Ga0157372_102867683 | 66 |
| 163 | 3300013308 | Ga0157375_10071557 | Ga0157375_100715572 | 66 |
| 164 | 3300014745 | Ga0157377_10243962 | Ga0157377_102439622 | 66 |
| 165 | 3300025245 | Ga0207425_1029763 | Ga0207425_10297632 | 66 |
| 166 | 3300025263 | Ga0209565_1000007 | Ga0209565_1000007282 | 66 |
| 167 | 3300025273 | Ga0209673_1059972 | Ga0209673_10599722 | 66 |
| 168 | 3300025291 | Ga0209675_1001749 | Ga0209675_10017494 | 66 |
| 169 | 3300025295 | Ga0209564_1026884 | Ga0209564_10268842 | 66 |
| 170 | 3300025297 | Ga0209758_1006895 | Ga0209758_10068953 | 66 |
| 171 | 3300025298 | Ga0209050_1004003 | Ga0209050_10040032 | 66 |
| 172 | 3300025299 | Ga0209256_1000008 | Ga0209256_1000008124 | 66 |
| 173 | 3300025304 | Ga0209257_1002589 | Ga0209257_10025894 | 66 |
| 174 | 3300025304 | Ga0209257_1030774 | Ga0209257_10307742 | 66 |
| 175 | 3300025315 | Ga0207697_10139343 | Ga0207697_101393432 | 66 |
| 176 | 3300025321 | Ga0207656_10050907 | Ga0207656_100509072 | 66 |
| 177 | 3300025321 | Ga0207656_10191557 | Ga0207656_101915572 | 66 |
| 178 | 3300025901 | Ga0207688_10000063 | Ga0207688_1000006343 | 66 |
| 179 | 3300025903 | Ga0207680_10052002 | Ga0207680_100520022 | 66 |
| 180 | 3300025903 | Ga0207680_10135842 | Ga0207680_101358422 | 66 |
| 181 | 3300025904 | Ga0207647_10000227 | Ga0207647_100002273 | 66 |
| 182 | 3300025904 | Ga0207647_10039549 | Ga0207647_100395492 | 66 |
| 183 | 3300025907 | Ga0207645_10017225 | Ga0207645_100172252 | 66 |
| 184 | 3300025907 | Ga0207645_10225028 | Ga0207645_102250282 | 66 |
| 185 | 3300025909 | Ga0207705_10066990 | Ga0207705_100669903 | 66 |
| 186 | 3300025909 | Ga0207705_10776297 | Ga0207705_107762972 | 66 |
| 187 | 3300025911 | Ga0207654_10052235 | Ga0207654_100522353 | 66 |
| 188 | 3300025919 | Ga0207657_10002137 | Ga0207657_1000213724 | 66 |
| 189 | 3300025919 | Ga0207657_10012153 | Ga0207657_100121533 | 66 |
| 190 | 3300025920 | Ga0207649_10172155 | Ga0207649_101721551 | 66 |
| 191 | 3300025921 | Ga0207652_10802743 | Ga0207652_108027432 | 66 |
| 192 | 3300025923 | Ga0207681_10025632 | Ga0207681_100256323 | 66 |
| 193 | 3300025924 | Ga0207694_10053099 | Ga0207694_100530993 | 66 |
| 194 | 3300025925 | Ga0207650_10204198 | Ga0207650_102041983 | 66 |
| 195 | 3300025925 | Ga0207650_10724241 | Ga0207650_107242412 | 66 |
| 196 | 3300025926 | Ga0207659_10037839 | Ga0207659_100378393 | 66 |
| 197 | 3300025927 | Ga0207687_10030679 | Ga0207687_100306792 | 66 |
| 198 | 3300025931 | Ga0207644_10048860 | Ga0207644_100488603 | 66 |
| 199 | 3300025931 | Ga0207644_10475598 | Ga0207644_104755982 | 66 |
| 200 | 3300025932 | Ga0207690_10043892 | Ga0207690_100438923 | 66 |
| 201 | 3300025932 | Ga0207690_10171761 | Ga0207690_101717612 | 66 |
| 202 | 3300025932 | Ga0207690_10433697 | Ga0207690_104336972 | 66 |
| 203 | 3300025932 | Ga0207690_11533811 | Ga0207690_115338111 | 66 |
| 204 | 3300025933 | Ga0207706_10009958 | Ga0207706_1000995810 | 66 |
| 205 | 3300025935 | Ga0207709_10015536 | Ga0207709_100155365 | 66 |
| 206 | 3300025937 | Ga0207669_10585091 | Ga0207669_105850912 | 66 |
| 207 | 3300025938 | Ga0207704_10225114 | Ga0207704_102251142 | 66 |
| 208 | 3300025940 | Ga0207691_10000447 | Ga0207691_100004473 | 66 |
| 209 | 3300025941 | Ga0207711_10004550 | Ga0207711_1000455012 | 66 |
| 210 | 3300025942 | Ga0207689_10001047 | Ga0207689_1000104730 | 66 |
| 211 | 3300025944 | Ga0207661_10197444 | Ga0207661_101974442 | 66 |
| 212 | 3300025944 | Ga0207661_11832004 | Ga0207661_118320041 | 66 |
| 213 | 3300025945 | Ga0207679_10011770 | Ga0207679_100117706 | 66 |
| 214 | 3300025945 | Ga0207679_10537436 | Ga0207679_105374362 | 66 |
| 215 | 3300025945 | Ga0207679_10700292 | Ga0207679_107002922 | 66 |
| 216 | 3300025949 | Ga0207667_10069521 | Ga0207667_100695212 | 66 |
| 217 | 3300025960 | Ga0207651_10026380 | Ga0207651_100263802 | 66 |
| 218 | 3300025960 | Ga0207651_11056686 | Ga0207651_110566862 | 66 |
| 219 | 3300025981 | Ga0207640_10008286 | Ga0207640_100082862 | 66 |
| 220 | 3300025981 | Ga0207640_10009446 | Ga0207640_100094462 | 66 |
| 221 | 3300025981 | Ga0207640_11473521 | Ga0207640_114735212 | 66 |
| 222 | 3300025986 | Ga0207658_10026044 | Ga0207658_100260442 | 66 |
| 223 | 3300025986 | Ga0207658_10033892 | Ga0207658_100338922 | 66 |
| 224 | 3300025986 | Ga0207658_10643766 | Ga0207658_106437661 | 66 |
| 225 | 3300026023 | Ga0207677_10017509 | Ga0207677_100175093 | 66 |
| 226 | 3300026023 | Ga0207677_10270282 | Ga0207677_102702823 | 66 |
| 227 | 3300026035 | Ga0207703_10002385 | Ga0207703_1000238511 | 66 |
| 228 | 3300026041 | Ga0207639_10097715 | Ga0207639_100977152 | 66 |
| 229 | 3300026067 | Ga0207678_10000995 | Ga0207678_1000099516 | 66 |
| 230 | 3300026067 | Ga0207678_10136755 | Ga0207678_101367553 | 66 |
| 231 | 3300026067 | Ga0207678_11268246 | Ga0207678_112682462 | 66 |
| 232 | 3300026067 | Ga0207678_11556602 | Ga0207678_115566021 | 66 |
| 233 | 3300026088 | Ga0207641_10693430 | Ga0207641_106934302 | 66 |
| 234 | 3300026089 | Ga0207648_10010576 | Ga0207648_1001057610 | 66 |
| 235 | 3300026089 | Ga0207648_10063142 | Ga0207648_100631423 | 66 |
| 236 | 3300026095 | Ga0207676_10003397 | Ga0207676_1000339712 | 66 |
| 237 | 3300026095 | Ga0207676_11287119 | Ga0207676_112871192 | 66 |
| 238 | 3300026116 | Ga0207674_10001201 | Ga0207674_100012013 | 66 |
| 239 | 3300026116 | Ga0207674_10023799 | Ga0207674_100237995 | 66 |
| 240 | 3300026118 | Ga0207675_100037082 | Ga0207675_1000370823 | 66 |
| 241 | 3300026121 | Ga0207683_10112258 | Ga0207683_101122583 | 66 |
| 242 | 3300026142 | Ga0207698_10008695 | Ga0207698_100086953 | 66 |
| 243 | 3300026142 | Ga0207698_10098379 | Ga0207698_100983792 | 66 |
| 244 | 3300026142 | Ga0207698_10939988 | Ga0207698_109399882 | 66 |
| 245 | 3300028379 | Ga0268266_10000919 | Ga0268266_100009191 | 66 |
| 246 | 3300028379 | Ga0268266_10023554 | Ga0268266_100235542 | 66 |
| 247 | 3300028379 | Ga0268266_10124016 | Ga0268266_101240162 | 66 |
| 248 | 3300028379 | Ga0268266_10198237 | Ga0268266_101982372 | 66 |
| 249 | 3300028379 | Ga0268266_10435017 | Ga0268266_104350173 | 66 |
| 250 | 3300028379 | Ga0268266_10685492 | Ga0268266_106854921 | 66 |
| 251 | 3300028381 | Ga0268264_10018222 | Ga0268264_100182223 | 66 |
| 252 | 3300030733 | Ga0314311_1054629 | Ga0314311_10546292 | 66 |
| 253 | 3300031548 | Ga0307408_100155056 | Ga0307408_1001550562 | 66 |
| 254 | 3300031731 | Ga0307405_10071896 | Ga0307405_100718962 | 66 |
| 255 | 3300031731 | Ga0307405_10219742 | Ga0307405_102197422 | 66 |
| 256 | 3300031824 | Ga0307413_10003719 | Ga0307413_100037194 | 66 |
| 257 | 3300031824 | Ga0307413_10024136 | Ga0307413_100241362 | 66 |
| 258 | 3300031852 | Ga0307410_10001623 | Ga0307410_100016233 | 66 |
| 259 | 3300031852 | Ga0307410_10138469 | Ga0307410_101384692 | 66 |
| 260 | 3300031901 | Ga0307406_10327401 | Ga0307406_103274012 | 66 |
| 261 | 3300031901 | Ga0307406_10361135 | Ga0307406_103611352 | 66 |
| 262 | 3300031901 | Ga0307406_11267009 | Ga0307406_112670091 | 66 |
| 263 | 3300031903 | Ga0307407_10001698 | Ga0307407_100016983 | 66 |
| 264 | 3300031903 | Ga0307407_11472246 | Ga0307407_114722461 | 66 |
| 265 | 3300031911 | Ga0307412_10081422 | Ga0307412_100814222 | 66 |
| 266 | 3300031911 | Ga0307412_10082195 | Ga0307412_100821953 | 66 |
| 267 | 3300031911 | Ga0307412_10167883 | Ga0307412_101678832 | 66 |
| 268 | 3300031995 | Ga0307409_100053055 | Ga0307409_1000530552 | 66 |
| 269 | 3300031995 | Ga0307409_100543605 | Ga0307409_1005436051 | 66 |
| 270 | 3300031995 | Ga0307409_101174427 | Ga0307409_1011744272 | 66 |
| 271 | 3300031995 | Ga0307409_102111262 | Ga0307409_1021112621 | 66 |
| 272 | 3300032002 | Ga0307416_100447567 | Ga0307416_1004475671 | 66 |
| 273 | 3300032002 | Ga0307416_100934364 | Ga0307416_1009343642 | 66 |
| 274 | 3300032002 | Ga0307416_101924443 | Ga0307416_1019244432 | 66 |
| 275 | 3300032004 | Ga0307414_10186102 | Ga0307414_101861022 | 66 |
| 276 | 3300032005 | Ga0307411_10405960 | Ga0307411_104059602 | 66 |
| 277 | 3300032126 | Ga0307415_100092412 | Ga0307415_1000924122 | 66 |
| 278 | 3300032126 | Ga0307415_100833659 | Ga0307415_1008336592 | 66 |
| 279 | 3300032126 | Ga0307415_101674188 | Ga0307415_1016741881 | 66 |
| 280 | 3300032126 | Ga0307415_101744374 | Ga0307415_1017443741 | 66 |
| 281 | 3300035691 | Ga0373931_1084413 | Ga0373931_1084413_248_457 | 66 |
| 282 | 3300037418 | Ga0395900_0222187 | Ga0395900_0222187_848_1057 | 66 |
| 283 | 3300037471 | Ga0395905_0112293 | Ga0395905_0112293_1724_1933 | 66 |
| 284 | 3300037471 | Ga0395905_0724727 | Ga0395905_0724727_301_507 | 66 |
| 285 | 3300038705 | Ga0237819_01210 | Ga0237819_01210_5703_5903 | 66 |
| 286 | 3300041404 | Ga0439436_0028397 | Ga0439436_0028397_142_342 | 66 |
| 287 | 3300041410 | Ga0439461_0000284 | Ga0439461_0000284_4877_5077 | 66 |
| 288 | 3300041410 | Ga0439461_0008485 | Ga0439461_0008485_432_632 | 66 |
| 289 | 3300041413 | Ga0439465_0001061 | Ga0439465_0001061_4939_5139 | 66 |
| 290 | 3300041413 | Ga0439465_0066369 | Ga0439465_0066369_150_350 | 66 |
| 291 | 3300041509 | Ga0451843_1564869 | Ga0451843_1564869_379_579 | 66 |
| 292 | 3300041997 | Ga0439431_0000617 | Ga0439431_0000617_5069_5269 | 66 |
| 293 | 3300041997 | Ga0439431_0052479 | Ga0439431_0052479_547_747 | 66 |
| 294 | 3300042002 | Ga0439442_000789 | Ga0439442_000789_4966_5166 | 66 |
| 295 | 3300042002 | Ga0439442_017362 | Ga0439442_017362_17_217 | 66 |
| 296 | 3300042004 | Ga0439445_0002604 | Ga0439445_0002604_3163_3363 | 66 |
| 297 | 3300042004 | Ga0439445_0004965 | Ga0439445_0004965_2785_2985 | 66 |
| 298 | 3300042004 | Ga0439445_0039084 | Ga0439445_0039084_137_337 | 66 |
| 299 | 3300042006 | Ga0439432_000379 | Ga0439432_000379_2205_2405 | 66 |
| 300 | 3300042006 | Ga0439432_029024 | Ga0439432_029024_39_239 | 66 |
| 301 | 3300042014 | Ga0439457_071500 | Ga0439457_071500_161_361 | 66 |
| 302 | 3300042015 | Ga0439462_0010528 | Ga0439462_0010528_2124_2324 | 66 |
| 303 | 3300042015 | Ga0439462_0016569 | Ga0439462_0016569_158_358 | 66 |
| 304 | 3300042147 | Ga0450910_022284 | Ga0450910_022284_658_858 | 66 |
| 305 | 3300042156 | Ga0439446_0053975 | Ga0439446_0053975_798_998 | 66 |
| 306 | 3300042156 | Ga0439446_0075898 | Ga0439446_0075898_430_630 | 66 |
| 307 | 3300042185 | Ga0450909_011190 | Ga0450909_011190_503_703 | 66 |
| 308 | 3300042435 | Ga0439434_0000379 | Ga0439434_0000379_5651_5851 | 66 |
| 309 | 3300046453 | Ga0495627_097551 | Ga0495627_097551_53_253 | 66 |
| 310 | 3300047445 | Ga0495677_0360121 | Ga0495677_0360121_274_477 | 66 |
| 311 | 3300047470 | Ga0495681_0019121 | Ga0495681_0019121_2374_2574 | 66 |
| 312 | 3300048090 | Ga0495615_0274371 | Ga0495615_0274371_327_527 | 66 |
| 313 | 3300049581 | Ga0501047_0564995 | Ga0501047_0564995_723_923 | 66 |
| 314 | 3300049764 | Ga0501267_000984 | Ga0501267_000984_311_511 | 66 |
| 315 | 3300050494 | nmdc:mga06z11_1037182_c1 | nmdc:mga06z11_1037182_c1_43_252 | 66 |
| 316 | 3300050513 | nmdc:mga0rr50_191476_c1 | nmdc:mga0rr50_191476_c1_828_1037 | 66 |
| 317 | 3300053087 | Ga0500643_001599 | Ga0500643_001599_11030_11230 | 66 |
| 318 | 3300053087 | Ga0500643_001608 | Ga0500643_001608_1369_1569 | 66 |
| 319 | 3300053087 | Ga0500643_013772 | Ga0500643_013772_545_745 | 66 |
| 320 | 3300053094 | Ga0500566_0001569 | Ga0500566_0001569_8846_9046 | 66 |
| 321 | 3300053108 | Ga0500562_064434 | Ga0500562_064434_115_315 | 66 |
| 322 | 3300053119 | Ga0500595_078176 | Ga0500595_078176_601_801 | 66 |
| 323 | 3300053120 | Ga0500597_009180 | Ga0500597_009180_2753_2953 | 66 |
| 324 | 3300053128 | Ga0500626_315703 | Ga0500626_315703_273_473 | 66 |
| 325 | 3300053133 | Ga0500655_058377 | Ga0500655_058377_375_575 | 66 |
| 326 | 3300053134 | Ga0500658_0000613 | Ga0500658_0000613_3611_3811 | 66 |
| 327 | 3300053134 | Ga0500658_0004776 | Ga0500658_0004776_4108_4308 | 66 |
| 328 | 3300053139 | Ga0500568_0054307 | Ga0500568_0054307_985_1185 | 66 |
| 329 | 3300053140 | Ga0500573_0001894 | Ga0500573_0001894_4858_5058 | 66 |
| 330 | 3300053157 | Ga0500624_000004 | Ga0500624_000004_47916_48116 | 66 |
| 331 | 3300053178 | Ga0500637_0000064 | Ga0500637_0000064_10904_11104 | 66 |
| 332 | iso_pu_bacteria | 2512564014 | 2512642254 | 66 |
| 333 | iso_pu_bacteria | 2808606401 | 2809065318 | 66 |
| 334 | iso_pu_bacteria | 2808606404 | 2809081290 | 66 |
| 335 | iso_pu_bacteria | 2808606405 | 2809085655 | 66 |
| 336 | iso_pu_bacteria | 2880518877 | 2880520838 | 66 |
| 337 | 3300005331 | Ga0070670_100016756 | Ga0070670_1000167566 | 67 |
| 338 | 3300005339 | Ga0070660_100659291 | Ga0070660_1006592911 | 67 |
| 339 | 3300005353 | Ga0070669_101635692 | Ga0070669_1016356921 | 67 |
| 340 | 3300005367 | Ga0070667_100077737 | Ga0070667_1000777373 | 67 |
| 341 | 3300005367 | Ga0070667_101936277 | Ga0070667_1019362771 | 67 |
| 342 | 3300005457 | Ga0070662_101671252 | Ga0070662_1016712522 | 67 |
| 343 | 3300005614 | Ga0068856_101225306 | Ga0068856_1012253062 | 67 |
| 344 | 3300005616 | Ga0068852_100724799 | Ga0068852_1007247992 | 67 |
| 345 | 3300005842 | Ga0068858_100118087 | Ga0068858_1001180872 | 67 |
| 346 | 3300006237 | Ga0097621_100600984 | Ga0097621_1006009842 | 67 |
| 347 | 3300006358 | Ga0068871_100142408 | Ga0068871_1001424082 | 67 |
| 348 | 3300009176 | Ga0105242_10062500 | Ga0105242_100625002 | 67 |
| 349 | 3300009177 | Ga0105248_10735082 | Ga0105248_107350822 | 67 |
| 350 | 3300013308 | Ga0157375_10316477 | Ga0157375_103164772 | 67 |
| 351 | 3300025925 | Ga0207650_10052852 | Ga0207650_100528522 | 67 |
| 352 | 3300025931 | Ga0207644_10001293 | Ga0207644_100012939 | 67 |
| 353 | 3300025933 | Ga0207706_11131152 | Ga0207706_111311522 | 67 |
| 354 | 3300025937 | Ga0207669_10619866 | Ga0207669_106198662 | 67 |
| 355 | 3300025941 | Ga0207711_10004395 | Ga0207711_100043959 | 67 |
| 356 | 3300025960 | Ga0207651_10042226 | Ga0207651_100422262 | 67 |
| 357 | 3300026078 | Ga0207702_10340804 | Ga0207702_103408042 | 67 |
| 358 | 3300026121 | Ga0207683_10003436 | Ga0207683_1000343617 | 67 |
| 359 | 3300034820 | Ga0373959_0166889 | Ga0373959_0166889_238_444 | 67 |
| 360 | 3300048903 | Ga0496100_0008338 | Ga0496100_0008338_1405_1611 | 67 |
| 361 | 3300048904 | Ga0496101_0000925 | Ga0496101_0000925_11882_12088 | 67 |
| 362 | 3300048905 | Ga0496102_0023470 | Ga0496102_0023470_2329_2535 | 67 |
| 363 | 3300048908 | Ga0496105_0050298 | Ga0496105_0050298_2522_2728 | 67 |
| 364 | 3300048909 | Ga0496106_0019762 | Ga0496106_0019762_2859_3065 | 67 |
| 365 | 3300048910 | Ga0496107_0004578 | Ga0496107_0004578_2604_2810 | 67 |
| 366 | 3300048911 | Ga0496108_0003458 | Ga0496108_0003458_10179_10385 | 67 |
| 367 | 3300048912 | Ga0496109_0504844 | Ga0496109_0504844_246_452 | 67 |
| 368 | 3300048912 | Ga0496109_1778071 | Ga0496109_1778071_203_409 | 67 |
| 369 | 3300048914 | Ga0496111_0005412 | Ga0496111_0005412_6405_6611 | 67 |
| 370 | 3300048915 | Ga0496112_0006800 | Ga0496112_0006800_9552_9758 | 67 |
| 371 | 3300049585 | Ga0501069_0760492 | Ga0501069_0760492_230_436 | 67 |
| 372 | 3300013100 | Ga0157373_10743236 | Ga0157373_107432362 | 68 |
| 373 | 3300025909 | Ga0207705_10005148 | Ga0207705_100051486 | 68 |
| 374 | 3300025912 | Ga0207707_10007957 | Ga0207707_100079575 | 68 |
| 375 | 3300025917 | Ga0207660_10001967 | Ga0207660_100019677 | 68 |
| 376 | 3300025919 | Ga0207657_10032461 | Ga0207657_100324615 | 68 |
| 377 | 3300025920 | Ga0207649_10002828 | Ga0207649_100028284 | 68 |
| 378 | 3300025921 | Ga0207652_10009257 | Ga0207652_100092574 | 68 |
| 379 | 3300025932 | Ga0207690_10002642 | Ga0207690_100026423 | 68 |
| 380 | 3300025933 | Ga0207706_10002393 | Ga0207706_1000239310 | 68 |
| 381 | 3300025944 | Ga0207661_10088172 | Ga0207661_100881723 | 68 |
| 382 | 3300025945 | Ga0207679_10010434 | Ga0207679_100104343 | 68 |
| 383 | 3300025949 | Ga0207667_10099561 | Ga0207667_100995613 | 68 |
| 384 | 3300025981 | Ga0207640_10010121 | Ga0207640_100101214 | 68 |
| 385 | 3300026041 | Ga0207639_10004964 | Ga0207639_100049644 | 68 |
| 386 | 3300026067 | Ga0207678_10002287 | Ga0207678_1000228710 | 68 |
| 387 | 3300026078 | Ga0207702_11099897 | Ga0207702_110998972 | 68 |
| 388 | 3300026116 | Ga0207674_10004331 | Ga0207674_1000433113 | 68 |
| 389 | 3300026142 | Ga0207698_10020595 | Ga0207698_100205955 | 68 |
| 390 | 3300037418 | Ga0395900_0021537 | Ga0395900_0021537_5924_6133 | 68 |
| 391 | 3300037418 | Ga0395900_0918455 | Ga0395900_0918455_281_490 | 68 |
| 392 | 3300038443 | Ga0395901_1590879 | Ga0395901_1590879_99_308 | 68 |
| 393 | 3300038443 | Ga0395901_2127808 | Ga0395901_2127808_254_463 | 68 |
| 394 | 3300001904 | JGI24736J21556_1001450 | JGI24736J21556_10014503 | 69 |
| 395 | 3300001915 | JGI24741J21665_1000048 | JGI24741J21665_100004826 | 69 |
| 396 | 3300001979 | JGI24740J21852_10004476 | JGI24740J21852_100044766 | 69 |
| 397 | 3300001979 | JGI24740J21852_10184056 | JGI24740J21852_101840561 | 69 |
| 398 | 3300001989 | JGI24739J22299_10011462 | JGI24739J22299_100114622 | 69 |
| 399 | 3300001989 | JGI24739J22299_10032373 | JGI24739J22299_100323732 | 69 |
| 400 | 3300001990 | JGI24737J22298_10012215 | JGI24737J22298_100122152 | 69 |
| 401 | 3300002067 | JGI24735J21928_10008818 | JGI24735J21928_100088182 | 69 |
| 402 | 3300002067 | JGI24735J21928_10010559 | JGI24735J21928_100105592 | 69 |
| 403 | 3300002074 | JGI24748J21848_1013527 | JGI24748J21848_10135272 | 69 |
| 404 | 3300002075 | JGI24738J21930_10000964 | JGI24738J21930_100009643 | 69 |
| 405 | 3300005289 | Ga0065704_10224427 | Ga0065704_102244272 | 69 |
| 406 | 3300005289 | Ga0065704_10475945 | Ga0065704_104759451 | 69 |
| 407 | 3300005295 | Ga0065707_10435928 | Ga0065707_104359282 | 69 |
| 408 | 3300005327 | Ga0070658_10119367 | Ga0070658_101193672 | 69 |
| 409 | 3300005329 | Ga0070683_100990539 | Ga0070683_1009905392 | 69 |
| 410 | 3300005331 | Ga0070670_100062326 | Ga0070670_1000623264 | 69 |
| 411 | 3300005339 | Ga0070660_100411818 | Ga0070660_1004118181 | 69 |
| 412 | 3300005344 | Ga0070661_100237820 | Ga0070661_1002378202 | 69 |
| 413 | 3300005344 | Ga0070661_101178265 | Ga0070661_1011782652 | 69 |
| 414 | 3300005353 | Ga0070669_100090315 | Ga0070669_1000903153 | 69 |
| 415 | 3300005355 | Ga0070671_100366954 | Ga0070671_1003669542 | 69 |
| 416 | 3300005364 | Ga0070673_100147695 | Ga0070673_1001476953 | 69 |
| 417 | 3300005366 | Ga0070659_100030484 | Ga0070659_1000304843 | 69 |
| 418 | 3300005367 | Ga0070667_100301868 | Ga0070667_1003018682 | 69 |
| 419 | 3300005455 | Ga0070663_100004277 | Ga0070663_1000042773 | 69 |
| 420 | 3300005457 | Ga0070662_100363157 | Ga0070662_1003631572 | 69 |
| 421 | 3300005539 | Ga0068853_100572237 | Ga0068853_1005722372 | 69 |
| 422 | 3300005563 | Ga0068855_100049500 | Ga0068855_1000495002 | 69 |
| 423 | 3300005564 | Ga0070664_100013862 | Ga0070664_1000138623 | 69 |
| 424 | 3300005577 | Ga0068857_100409683 | Ga0068857_1004096832 | 69 |
| 425 | 3300005578 | Ga0068854_100272574 | Ga0068854_1002725742 | 69 |
| 426 | 3300005578 | Ga0068854_100297526 | Ga0068854_1002975262 | 69 |
| 427 | 3300005614 | Ga0068856_100032072 | Ga0068856_1000320723 | 69 |
| 428 | 3300005616 | Ga0068852_100280756 | Ga0068852_1002807562 | 69 |
| 429 | 3300005618 | Ga0068864_100025224 | Ga0068864_1000252243 | 69 |
| 430 | 3300005834 | Ga0068851_10050930 | Ga0068851_100509302 | 69 |
| 431 | 3300005841 | Ga0068863_100019197 | Ga0068863_1000191976 | 69 |
| 432 | 3300009011 | Ga0105251_10002522 | Ga0105251_100025226 | 69 |
| 433 | 3300009092 | Ga0105250_10264678 | Ga0105250_102646781 | 69 |
| 434 | 3300009093 | Ga0105240_10570939 | Ga0105240_105709392 | 69 |
| 435 | 3300009093 | Ga0105240_10570991 | Ga0105240_105709912 | 69 |
| 436 | 3300009174 | Ga0105241_10007549 | Ga0105241_100075492 | 69 |
| 437 | 3300009545 | Ga0105237_10021289 | Ga0105237_100212892 | 69 |
| 438 | 3300009551 | Ga0105238_10690144 | Ga0105238_106901442 | 69 |
| 439 | 3300009551 | Ga0105238_10786317 | Ga0105238_107863172 | 69 |
| 440 | 3300009553 | Ga0105249_10050027 | Ga0105249_100500272 | 69 |
| 441 | 3300009978 | Ga0105148_100102 | Ga0105148_1001023 | 69 |
| 442 | 3300010375 | Ga0105239_10037864 | Ga0105239_100378642 | 69 |
| 443 | 3300010375 | Ga0105239_11431155 | Ga0105239_114311552 | 69 |
| 444 | 3300013100 | Ga0157373_10209238 | Ga0157373_102092382 | 69 |
| 445 | 3300013102 | Ga0157371_10103257 | Ga0157371_101032572 | 69 |
| 446 | 3300013102 | Ga0157371_10468351 | Ga0157371_104683512 | 69 |
| 447 | 3300013102 | Ga0157371_11481587 | Ga0157371_114815872 | 69 |
| 448 | 3300013104 | Ga0157370_10134035 | Ga0157370_101340352 | 69 |
| 449 | 3300013105 | Ga0157369_10627049 | Ga0157369_106270492 | 69 |
| 450 | 3300013307 | Ga0157372_10159887 | Ga0157372_101598872 | 69 |
| 451 | 3300013307 | Ga0157372_10554200 | Ga0157372_105542002 | 69 |
| 452 | 3300014325 | Ga0163163_10350906 | Ga0163163_103509062 | 69 |
| 453 | 3300014326 | Ga0157380_10067298 | Ga0157380_100672982 | 69 |
| 454 | 3300014326 | Ga0157380_12619649 | Ga0157380_126196492 | 69 |
| 455 | 3300017792 | Ga0163161_10108094 | Ga0163161_101080942 | 69 |
| 456 | 3300022467 | Ga0224712_10423413 | Ga0224712_104234131 | 69 |
| 457 | 3300025321 | Ga0207656_10061607 | Ga0207656_100616072 | 69 |
| 458 | 3300025735 | Ga0207713_1005766 | Ga0207713_10057663 | 69 |
| 459 | 3300025904 | Ga0207647_10014707 | Ga0207647_100147072 | 69 |
| 460 | 3300025904 | Ga0207647_10786521 | Ga0207647_107865212 | 69 |
| 461 | 3300025909 | Ga0207705_10105306 | Ga0207705_101053062 | 69 |
| 462 | 3300025911 | Ga0207654_10199285 | Ga0207654_101992852 | 69 |
| 463 | 3300025913 | Ga0207695_10041232 | Ga0207695_100412325 | 69 |
| 464 | 3300025913 | Ga0207695_10570135 | Ga0207695_105701352 | 69 |
| 465 | 3300025914 | Ga0207671_11175992 | Ga0207671_111759921 | 69 |
| 466 | 3300025919 | Ga0207657_10190977 | Ga0207657_101909772 | 69 |
| 467 | 3300025920 | Ga0207649_11471647 | Ga0207649_114716472 | 69 |
| 468 | 3300025923 | Ga0207681_10032023 | Ga0207681_100320232 | 69 |
| 469 | 3300025924 | Ga0207694_10110636 | Ga0207694_101106362 | 69 |
| 470 | 3300025924 | Ga0207694_10175059 | Ga0207694_101750592 | 69 |
| 471 | 3300025925 | Ga0207650_10172515 | Ga0207650_101725152 | 69 |
| 472 | 3300025931 | Ga0207644_10010767 | Ga0207644_100107673 | 69 |
| 473 | 3300025931 | Ga0207644_10145733 | Ga0207644_101457332 | 69 |
| 474 | 3300025933 | Ga0207706_10192807 | Ga0207706_101928072 | 69 |
| 475 | 3300025933 | Ga0207706_10424368 | Ga0207706_104243682 | 69 |
| 476 | 3300025941 | Ga0207711_10056137 | Ga0207711_100561372 | 69 |
| 477 | 3300025941 | Ga0207711_11150112 | Ga0207711_111501122 | 69 |
| 478 | 3300025945 | Ga0207679_11147775 | Ga0207679_111477752 | 69 |
| 479 | 3300025949 | Ga0207667_10328634 | Ga0207667_103286342 | 69 |
| 480 | 3300025949 | Ga0207667_10371111 | Ga0207667_103711112 | 69 |
| 481 | 3300025960 | Ga0207651_10090128 | Ga0207651_100901283 | 69 |
| 482 | 3300025961 | Ga0207712_10041216 | Ga0207712_100412162 | 69 |
| 483 | 3300025981 | Ga0207640_10005003 | Ga0207640_100050035 | 69 |
| 484 | 3300025981 | Ga0207640_10434932 | Ga0207640_104349322 | 69 |
| 485 | 3300026041 | Ga0207639_10016956 | Ga0207639_100169562 | 69 |
| 486 | 3300026067 | Ga0207678_10001466 | Ga0207678_1000146621 | 69 |
| 487 | 3300026078 | Ga0207702_10001194 | Ga0207702_100011943 | 69 |
| 488 | 3300026088 | Ga0207641_10443474 | Ga0207641_104434742 | 69 |
| 489 | 3300026095 | Ga0207676_10094858 | Ga0207676_100948582 | 69 |
| 490 | 3300026116 | Ga0207674_10687159 | Ga0207674_106871592 | 69 |
| 491 | 3300026116 | Ga0207674_10687160 | Ga0207674_106871602 | 69 |
| 492 | 3300026142 | Ga0207698_10139888 | Ga0207698_101398882 | 69 |
| 493 | 3300026142 | Ga0207698_10617769 | Ga0207698_106177692 | 69 |
| 494 | 3300031548 | Ga0307408_100254688 | Ga0307408_1002546882 | 69 |
| 495 | 3300031548 | Ga0307408_101098651 | Ga0307408_1010986511 | 69 |
| 496 | 3300031548 | Ga0307408_101887596 | Ga0307408_1018875961 | 69 |
| 497 | 3300031731 | Ga0307405_10095155 | Ga0307405_100951553 | 69 |
| 498 | 3300031731 | Ga0307405_10394398 | Ga0307405_103943982 | 69 |
| 499 | 3300031731 | Ga0307405_10572723 | Ga0307405_105727232 | 69 |
| 500 | 3300031731 | Ga0307405_12006214 | Ga0307405_120062142 | 69 |
| 501 | 3300031824 | Ga0307413_11082354 | Ga0307413_110823542 | 69 |
| 502 | 3300031852 | Ga0307410_10198141 | Ga0307410_101981412 | 69 |
| 503 | 3300031852 | Ga0307410_10311723 | Ga0307410_103117232 | 69 |
| 504 | 3300031901 | Ga0307406_10751797 | Ga0307406_107517971 | 69 |
| 505 | 3300031903 | Ga0307407_10607213 | Ga0307407_106072132 | 69 |
| 506 | 3300031911 | Ga0307412_10008913 | Ga0307412_100089132 | 69 |
| 507 | 3300031911 | Ga0307412_10029915 | Ga0307412_100299152 | 69 |
| 508 | 3300031911 | Ga0307412_11184068 | Ga0307412_111840682 | 69 |
| 509 | 3300031995 | Ga0307409_100369752 | Ga0307409_1003697522 | 69 |
| 510 | 3300032002 | Ga0307416_100077154 | Ga0307416_1000771543 | 69 |
| 511 | 3300032002 | Ga0307416_100118153 | Ga0307416_1001181532 | 69 |
| 512 | 3300032004 | Ga0307414_10000308 | Ga0307414_100003085 | 69 |
| 513 | 3300032004 | Ga0307414_10150645 | Ga0307414_101506452 | 69 |
| 514 | 3300032004 | Ga0307414_10184595 | Ga0307414_101845952 | 69 |
| 515 | 3300032004 | Ga0307414_10345990 | Ga0307414_103459902 | 69 |
| 516 | 3300032005 | Ga0307411_10371224 | Ga0307411_103712242 | 69 |
| 517 | 3300037418 | Ga0395900_0728396 | Ga0395900_0728396_506_718 | 69 |
| 518 | 3300041494 | Ga0451837_1801820 | Ga0451837_1801820_32_298 | 69 |
| 519 | 3300048911 | Ga0496108_0072387 | Ga0496108_0072387_1389_1601 | 69 |
| 520 | 3300048911 | Ga0496108_0199336 | Ga0496108_0199336_104_313 | 69 |
| 521 | 3300048912 | Ga0496109_0107971 | Ga0496109_0107971_1200_1412 | 69 |
| 522 | 3300048912 | Ga0496109_1106035 | Ga0496109_1106035_221_433 | 69 |
| 523 | 3300048913 | Ga0496110_0134224 | Ga0496110_0134224_1968_2177 | 69 |
| 524 | 3300048913 | Ga0496110_0417791 | Ga0496110_0417791_663_875 | 69 |
| 525 | 3300048914 | Ga0496111_0036948 | Ga0496111_0036948_1645_1854 | 69 |
| 526 | 3300048915 | Ga0496112_0172174 | Ga0496112_0172174_863_1075 | 69 |
| 527 | 3300048916 | Ga0496113_0023727 | Ga0496113_0023727_3927_4139 | 69 |
| 528 | 3300048916 | Ga0496113_1494603 | Ga0496113_1494603_233_445 | 69 |
| 529 | 3300048921 | Ga0496118_0133474 | Ga0496118_0133474_278_487 | 69 |
| 530 | 3300048924 | Ga0496121_0263204 | Ga0496121_0263204_789_998 | 69 |
| 531 | 3300048925 | Ga0496122_0026332 | Ga0496122_0026332_2896_3105 | 69 |
| 532 | 3300048926 | Ga0496123_0073319 | Ga0496123_0073319_1067_1276 | 69 |
| 533 | 3300048927 | Ga0496124_0005716 | Ga0496124_0005716_11434_11643 | 69 |
| 534 | 3300048928 | Ga0496125_0011375 | Ga0496125_0011375_5329_5538 | 69 |
| 535 | 3300048929 | Ga0496126_0218046 | Ga0496126_0218046_976_1185 | 69 |
| 536 | 3300049530 | Ga0501314_023729 | Ga0501314_023729_349_558 | 69 |
| 537 | 3300049571 | Ga0501034_0184820 | Ga0501034_0184820_1336_1545 | 69 |
| 538 | 3300049663 | Ga0501223_003443 | Ga0501223_003443_2891_3100 | 69 |
| 539 | 3300049664 | Ga0501224_000006 | Ga0501224_000006_2880_3089 | 69 |
| 540 | 3300049668 | Ga0501233_001517 | Ga0501233_001517_2733_2942 | 69 |
| 541 | 3300049669 | Ga0501235_001207 | Ga0501235_001207_2871_3080 | 69 |
| 542 | 3300049705 | Ga0501225_0004467 | Ga0501225_0004467_3210_3419 | 69 |
| 543 | 3300049705 | Ga0501225_0006416 | Ga0501225_0006416_486_695 | 69 |
| 544 | 3300049853 | Ga0501226_000051 | Ga0501226_000051_2879_3088 | 69 |
| 545 | 3300053091 | Ga0500647_0237847 | Ga0500647_0237847_138_347 | 69 |
| 546 | 3300053108 | Ga0500562_014381 | Ga0500562_014381_1180_1389 | 69 |
| 547 | 3300053160 | Ga0500633_0272934 | Ga0500633_0272934_153_362 | 69 |
| 548 | 2162886007 | SwRhRL2b_contig_1064096 | SwRhRL2b_0425.00003890 | 70 |
| 549 | 3300002074 | JGI24748J21848_1011742 | JGI24748J21848_10117422 | 70 |
| 550 | 3300005289 | Ga0065704_10071561 | Ga0065704_100715614 | 70 |
| 551 | 3300005331 | Ga0070670_100089272 | Ga0070670_1000892723 | 70 |
| 552 | 3300005335 | Ga0070666_10037119 | Ga0070666_100371194 | 70 |
| 553 | 3300005347 | Ga0070668_100006950 | Ga0070668_1000069504 | 70 |
| 554 | 3300005347 | Ga0070668_100089449 | Ga0070668_1000894492 | 70 |
| 555 | 3300005353 | Ga0070669_100031265 | Ga0070669_1000312653 | 70 |
| 556 | 3300005353 | Ga0070669_100080662 | Ga0070669_1000806622 | 70 |
| 557 | 3300005355 | Ga0070671_100049452 | Ga0070671_1000494522 | 70 |
| 558 | 3300005367 | Ga0070667_100000130 | Ga0070667_10000013021 | 70 |
| 559 | 3300005367 | Ga0070667_100192283 | Ga0070667_1001922832 | 70 |
| 560 | 3300005466 | Ga0070685_10143247 | Ga0070685_101432472 | 70 |
| 561 | 3300005546 | Ga0070696_100205269 | Ga0070696_1002052692 | 70 |
| 562 | 3300005548 | Ga0070665_100034741 | Ga0070665_1000347413 | 70 |
| 563 | 3300005841 | Ga0068863_100000029 | Ga0068863_10000002991 | 70 |
| 564 | 3300005842 | Ga0068858_100082141 | Ga0068858_1000821413 | 70 |
| 565 | 3300005843 | Ga0068860_101443162 | Ga0068860_1014431622 | 70 |
| 566 | 3300005844 | Ga0068862_100309571 | Ga0068862_1003095712 | 70 |
| 567 | 3300006048 | Ga0075363_100193889 | Ga0075363_1001938892 | 70 |
| 568 | 3300006178 | Ga0075367_10000211 | Ga0075367_100002114 | 70 |
| 569 | 3300006353 | Ga0075370_10022844 | Ga0075370_100228444 | 70 |
| 570 | 3300009177 | Ga0105248_12134565 | Ga0105248_121345652 | 70 |
| 571 | 3300025903 | Ga0207680_10038339 | Ga0207680_100383393 | 70 |
| 572 | 3300025923 | Ga0207681_10040966 | Ga0207681_100409663 | 70 |
| 573 | 3300025923 | Ga0207681_10131469 | Ga0207681_101314693 | 70 |
| 574 | 3300025923 | Ga0207681_10237884 | Ga0207681_102378841 | 70 |
| 575 | 3300025925 | Ga0207650_10082142 | Ga0207650_100821422 | 70 |
| 576 | 3300025931 | Ga0207644_10129545 | Ga0207644_101295452 | 70 |
| 577 | 3300025972 | Ga0207668_10006665 | Ga0207668_100066652 | 70 |
| 578 | 3300025972 | Ga0207668_10015365 | Ga0207668_100153652 | 70 |
| 579 | 3300025986 | Ga0207658_10000100 | Ga0207658_1000010073 | 70 |
| 580 | 3300025986 | Ga0207658_11200803 | Ga0207658_112008031 | 70 |
| 581 | 3300026035 | Ga0207703_10264408 | Ga0207703_102644082 | 70 |
| 582 | 3300026088 | Ga0207641_10000049 | Ga0207641_1000004991 | 70 |
| 583 | 3300027866 | Ga0209813_10000033 | Ga0209813_1000003334 | 70 |
| 584 | 3300028379 | Ga0268266_10019470 | Ga0268266_100194706 | 70 |
| 585 | 3300028380 | Ga0268265_10730531 | Ga0268265_107305312 | 70 |
| 586 | 3300028381 | Ga0268264_10037976 | Ga0268264_100379762 | 70 |
| 587 | 3300046452 | Ga0495617_010630 | Ga0495617_010630_15_239 | 70 |
| 588 | 3300046460 | Ga0495638_0000051 | Ga0495638_0000051_161827_162051 | 70 |
| 589 | 3300046506 | Ga0495583_0000582 | Ga0495583_0000582_43873_44097 | 70 |
| 590 | 3300046519 | Ga0495632_0000356 | Ga0495632_0000356_30564_30788 | 70 |
| 591 | 3300046524 | Ga0495648_0000032 | Ga0495648_0000032_43933_44157 | 70 |
| 592 | 3300046558 | Ga0495633_0009727 | Ga0495633_0009727_372_590 | 70 |
| 593 | 3300046558 | Ga0495633_0031761 | Ga0495633_0031761_41_265 | 70 |
| 594 | 3300046692 | Ga0495671_0000020 | Ga0495671_0000020_161195_161419 | 70 |
| 595 | 3300047469 | Ga0495673_0000076 | Ga0495673_0000076_44054_44278 | 70 |
| 596 | 3300048905 | Ga0496102_0395853 | Ga0496102_0395853_161_373 | 70 |
| 597 | 3300048907 | Ga0496104_1584025 | Ga0496104_1584025_82_327 | 70 |
| 598 | 3300048911 | Ga0496108_0001130 | Ga0496108_0001130_5769_5981 | 70 |
| 599 | 3300048911 | Ga0496108_0048187 | Ga0496108_0048187_93_305 | 70 |
| 600 | 3300048911 | Ga0496108_0054812 | Ga0496108_0054812_3075_3287 | 70 |
| 601 | 3300048912 | Ga0496109_0039921 | Ga0496109_0039921_179_391 | 70 |
| 602 | 3300048913 | Ga0496110_0883574 | Ga0496110_0883574_508_720 | 70 |
| 603 | 3300048914 | Ga0496111_0327753 | Ga0496111_0327753_707_919 | 70 |
| 604 | 3300048914 | Ga0496111_0379346 | Ga0496111_0379346_737_949 | 70 |
| 605 | 3300048915 | Ga0496112_0725029 | Ga0496112_0725029_489_701 | 70 |
| 606 | 3300048916 | Ga0496113_0019059 | Ga0496113_0019059_1723_1935 | 70 |
| 607 | 3300048919 | Ga0496116_0088550 | Ga0496116_0088550_157_369 | 70 |
| 608 | 3300048920 | Ga0496117_0064871 | Ga0496117_0064871_1092_1304 | 70 |
| 609 | 3300048920 | Ga0496117_0575768 | Ga0496117_0575768_98_310 | 70 |
| 610 | 3300048921 | Ga0496118_0069140 | Ga0496118_0069140_169_381 | 70 |
| 611 | 3300048921 | Ga0496118_0124616 | Ga0496118_0124616_987_1199 | 70 |
| 612 | 3300048922 | Ga0496119_0091487 | Ga0496119_0091487_591_803 | 70 |
| 613 | 3300048924 | Ga0496121_0000472 | Ga0496121_0000472_72485_72697 | 70 |
| 614 | 3300048925 | Ga0496122_0114436 | Ga0496122_0114436_225_437 | 70 |
| 615 | 3300048925 | Ga0496122_0207715 | Ga0496122_0207715_672_884 | 70 |
| 616 | 3300048926 | Ga0496123_0118019 | Ga0496123_0118019_537_749 | 70 |
| 617 | 3300048927 | Ga0496124_0008647 | Ga0496124_0008647_5486_5698 | 70 |
| 618 | 3300048927 | Ga0496124_0264410 | Ga0496124_0264410_1033_1245 | 70 |
| 619 | 3300048928 | Ga0496125_0034223 | Ga0496125_0034223_945_1157 | 70 |
| 620 | 3300048928 | Ga0496125_0195103 | Ga0496125_0195103_915_1127 | 70 |
| 621 | 3300048929 | Ga0496126_0029630 | Ga0496126_0029630_4886_5098 | 70 |
| 622 | 3300049669 | Ga0501235_003472 | Ga0501235_003472_584_796 | 70 |
| 623 | 3300049704 | Ga0501221_141109 | Ga0501221_141109_269_481 | 70 |
| 624 | 3300049704 | Ga0501221_178131 | Ga0501221_178131_18_230 | 70 |
| 625 | 3300049705 | Ga0501225_0044509 | Ga0501225_0044509_227_439 | 70 |
| 626 | 3300050490 | nmdc:mga03n38_154012_c1 | nmdc:mga03n38_154012_c1_381_593 | 70 |
| 627 | 3300050494 | nmdc:mga06z11_67_c1 | nmdc:mga06z11_67_c1_28921_29133 | 70 |
| 628 | 3300050495 | nmdc:mga04h51_55_c1 | nmdc:mga04h51_55_c1_13669_13881 | 70 |
| 629 | 3300050496 | nmdc:mga07m45_40831_c1 | nmdc:mga07m45_40831_c1_443_655 | 70 |
| 630 | 3300053088 | Ga0500644_0157730 | Ga0500644_0157730_116_340 | 70 |
| 631 | 3300053151 | Ga0500604_0051999 | Ga0500604_0051999_885_1112 | 70 |
| 632 | 3300053157 | Ga0500624_000031 | Ga0500624_000031_54018_54236 | 70 |
| 633 | 3300053158 | Ga0500627_0005512 | Ga0500627_0005512_638_865 | 70 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nfx-assembly1.cif.gz_W | mammalian ribosome nascent chain complex with srp and srp receptor in early state a | 0.7986 | 26 | 65 |
| 7qgg-assembly1.cif.gz_X | neuronal rna granules are ribosome complexes stalled at the pre-translocation state | 0.7874 | 26 | 65 |
| 6sgc-assembly1.cif.gz_W2 | rabbit 80s ribosome stalled on a poly(a) tail | 0.7842 | 26 | 65 |
| 7oyd-assembly1.cif.gz_W | cryo-em structure of a rabbit 80s ribosome with zebrafish dap1b | 0.7822 | 26 | 65 |
| 6lqm-assembly1.cif.gz_f | cryo-em structure of a pre-60s ribosomal subunit - state c | 0.7811 | 26 | 65 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0WE20_22_65_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.8047 | 29 | 67 | 3.30.40.10 |
| af_Q69L67_45_94_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7737 | 29 | 67 | 3.30.40.10 |
| af_Q8JGR4_1_63_2.30.170.20 | Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L24 | 0.7604 | 26 | 65 | 2.30.170.20 |
| 4a17T00 | Mainly Beta;Roll;Ribosomal Protein L24e; Chain: T;;Ribosomal protein L24 | 0.7419 | 26 | 65 | 2.30.170.20 |
| af_A0A1D6Q9G1_17_63_3.30.40.10 | Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) | 0.7285 | 25 | 67 | 3.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-G6EBD0-F1-model_v4 | DUF2093 domain-containing protein | 0.9226 | 22 | 65 |
|
| AF-A0A839H290-F1-model_v4 | deleted | 0.914 | 22 | 66 |
|
| AF-A0A2N7SDV4-F1-model_v4 | deleted | 0.9087 | 22 | 68 |
|
| AF-A0A0Q7E0B1-F1-model_v4 | DUF2093 domain-containing protein | 0.8748 | 20 | 68 |
|
| AF-G6EBD0-F1-model_v4 | DUF2093 domain-containing protein | 0.8461 | 22 | 65 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar