F471099
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 633 | 354 | 624 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300039447|Ga0436361_0570909|Ga0436361_0570909_613_1920 |
| Length | 422 |
| Sequence | MRSSAIIPRDPPKTQRAPTIAPASAKALRKPLIAALAGERRPTPPIWLMRQAGRYLPEYRELRAKAASFLEFCYTPALAVEATLQPIRRFRFDAAILFSDILVMPDALGQRVSFETGEGPRLDPIHDASGFARLRDEPDWARLAPVFETIGRVKRALPDEVALIGFCGAPWTVASYMIAGRGTLDQGPARLFAYRDPDLFASLIDRLKTLLPGDVALIGFCGAPWTVASYMIAGRGTADQAPARLFAYRRPKLFSALIDRLVDASAEYLVRQLAAGAEAVQIFDSWAGVLPPAEFERWCVRPVASLIAKLRAQAPHAPIIAFPRGAATQLEKFAFMPDVAAVGLDTAVEPRAAVASLPAPIALQGNLDPLALVAGGPGLDAGIDCVLRGFEGRAHIFNLGHGILPETPVGHVERLVARVRGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 2 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 3 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 4 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 5 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 6 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 7 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 8 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 9 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 17 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 18 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 19 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 20 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 21 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 32 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 90 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 92 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 133 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 134 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 202 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 203 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 204 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 210 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 217 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 218 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 219 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 220 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 221 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 223 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 224 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 232 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 235 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 236 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 237 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 238 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 241 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 242 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 243 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 244 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 245 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 285 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 286 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 287 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 290 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 294 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 295 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 296 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 297 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 298 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 339 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 340 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 341 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 342 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 343 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 344 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 345 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 346 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 347 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 349 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 350 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 352 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 354 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.27 |
| Nodule | 0.32 |
| Rhizoplane | 6.64 |
| Rhizosphere | 82.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1005710 | 3300001904 | Bacteria | 2103 |
| 2 | JGI24740J21852_10003772 | 3300001979 | Bacteria | 6600 |
| 3 | JGI24740J21852_10025944 | 3300001979 | Bacteria | 1968 |
| 4 | JGI24739J22299_10000250 | 3300001989 | Bacteria | 18085 |
| 5 | JGI24737J22298_10002929 | 3300001990 | Bacteria | 6049 |
| 6 | JGI24737J22298_10003302 | 3300001990 | Bacteria | 5713 |
| 7 | JGI24735J21928_10000409 | 3300002067 | Bacteria | 15021 |
| 8 | JGI24738J21930_10000103 | 3300002075 | Bacteria | 19478 |
| 9 | JGI25165J46597_1000035 | 3300003214 | Bacteria | 290723 |
| 10 | JGI25153J46596_10001130 | 3300003215 | Bacteria | 16141 |
| 11 | rootH1_10079800 | 3300003316 | Bacteria | 1765 |
| 12 | rootH2_10032630 | 3300003320 | Bacteria | 4632 |
| 13 | rootH2_10047068 | 3300003320 | Bacteria | 4093 |
| 14 | rootL2_10101751 | 3300003322 | Bacteria | 4307 |
| 15 | rootH1_10037990 | 3300003323 | Bacteria | 3208 |
| 16 | Ga0055525_1000118 | 3300003759 | Bacteria | 120652 |
| 17 | Ga0055542_1000076 | 3300003762 | Bacteria | 139662 |
| 18 | Ga0055529_1000004 | 3300003763 | Bacteria | 433331 |
| 19 | Ga0070658_10115022 | 3300005327 | Bacteria | 2231 |
| 20 | Ga0070676_10017083 | 3300005328 | Bacteria | 4012 |
| 21 | Ga0070690_100000690 | 3300005330 | Bacteria | 17293 |
| 22 | Ga0070670_100003735 | 3300005331 | Bacteria | 12678 |
| 23 | Ga0070670_100187560 | 3300005331 | Bacteria | 1796 |
| 24 | Ga0068869_100066800 | 3300005334 | Bacteria | 2651 |
| 25 | Ga0070666_10000975 | 3300005335 | Bacteria | 17499 |
| 26 | Ga0070682_100000564 | 3300005337 | Bacteria | 22836 |
| 27 | Ga0070682_100085548 | 3300005337 | Bacteria | 2051 |
| 28 | Ga0068868_100003140 | 3300005338 | Bacteria | 11498 |
| 29 | Ga0068868_100051809 | 3300005338 | Bacteria | 3230 |
| 30 | Ga0068868_100121511 | 3300005338 | Bacteria | 2131 |
| 31 | Ga0070660_100000165 | 3300005339 | Bacteria | 43416 |
| 32 | Ga0070689_100000246 | 3300005340 | Bacteria | 31651 |
| 33 | Ga0070691_10000033 | 3300005341 | Bacteria | 39121 |
| 34 | Ga0070691_10011597 | 3300005341 | Bacteria | 4025 |
| 35 | Ga0070687_100000312 | 3300005343 | Bacteria | 16432 |
| 36 | Ga0070661_100000254 | 3300005344 | Bacteria | 43578 |
| 37 | Ga0070661_100001432 | 3300005344 | Bacteria | 16569 |
| 38 | Ga0070661_100008518 | 3300005344 | Bacteria | 7093 |
| 39 | Ga0070661_100172027 | 3300005344 | Bacteria | 1645 |
| 40 | Ga0070692_10009631 | 3300005345 | Bacteria | 4365 |
| 41 | Ga0070668_100006205 | 3300005347 | Bacteria | 8854 |
| 42 | Ga0070675_100000971 | 3300005354 | Bacteria | 20500 |
| 43 | Ga0070671_100002133 | 3300005355 | Bacteria | 15273 |
| 44 | Ga0070671_100010764 | 3300005355 | Bacteria | 7342 |
| 45 | Ga0070674_100005136 | 3300005356 | Bacteria | 7528 |
| 46 | Ga0070674_100053709 | 3300005356 | Bacteria | 2783 |
| 47 | Ga0070674_100139041 | 3300005356 | Bacteria | 1820 |
| 48 | Ga0070673_100003617 | 3300005364 | Bacteria | 9672 |
| 49 | Ga0070688_100000574 | 3300005365 | Bacteria | 18516 |
| 50 | Ga0070659_100033544 | 3300005366 | Bacteria | 3987 |
| 51 | Ga0070659_100058602 | 3300005366 | Bacteria | 3039 |
| 52 | Ga0070659_100140258 | 3300005366 | Bacteria | 1968 |
| 53 | Ga0070667_100040302 | 3300005367 | Bacteria | 3916 |
| 54 | Ga0070703_10003711 | 3300005406 | Bacteria | 4325 |
| 55 | Ga0070709_10000408 | 3300005434 | Bacteria | 26266 |
| 56 | Ga0070714_100005811 | 3300005435 | Bacteria | 9459 |
| 57 | Ga0070713_100000333 | 3300005436 | Bacteria | 30842 |
| 58 | Ga0070713_100312760 | 3300005436 | Bacteria | 1449 |
| 59 | Ga0070710_10080590 | 3300005437 | Bacteria | 1899 |
| 60 | Ga0070701_10001677 | 3300005438 | Bacteria | 8305 |
| 61 | Ga0070711_100009937 | 3300005439 | Bacteria | 5869 |
| 62 | Ga0070711_100072538 | 3300005439 | Bacteria | 2429 |
| 63 | Ga0070705_100053020 | 3300005440 | Bacteria | 2372 |
| 64 | Ga0070700_100000481 | 3300005441 | Bacteria | 19980 |
| 65 | Ga0070694_100001363 | 3300005444 | Bacteria | 14273 |
| 66 | Ga0070663_100000282 | 3300005455 | Bacteria | 25780 |
| 67 | Ga0070663_100020507 | 3300005455 | Bacteria | 4378 |
| 68 | Ga0070663_100108502 | 3300005455 | Bacteria | 2082 |
| 69 | Ga0070678_100003280 | 3300005456 | Bacteria | 8993 |
| 70 | Ga0070678_100010458 | 3300005456 | Bacteria | 5672 |
| 71 | Ga0070662_100012028 | 3300005457 | Bacteria | 5729 |
| 72 | Ga0070662_100048172 | 3300005457 | Bacteria | 3069 |
| 73 | Ga0070662_100267714 | 3300005457 | Bacteria | 1379 |
| 74 | Ga0070681_10083693 | 3300005458 | Bacteria | 3143 |
| 75 | Ga0070685_10014004 | 3300005466 | Bacteria | 4244 |
| 76 | Ga0070699_100068566 | 3300005518 | Bacteria | 3081 |
| 77 | Ga0070679_100045870 | 3300005530 | Bacteria | 4355 |
| 78 | Ga0070684_100057818 | 3300005535 | Bacteria | 3387 |
| 79 | Ga0070684_100127310 | 3300005535 | Bacteria | 2295 |
| 80 | Ga0070697_100005504 | 3300005536 | Bacteria | 9764 |
| 81 | Ga0068853_100001647 | 3300005539 | Bacteria | 16330 |
| 82 | Ga0068853_100031727 | 3300005539 | Bacteria | 4469 |
| 83 | Ga0068853_100119846 | 3300005539 | Bacteria | 2346 |
| 84 | Ga0070672_100010669 | 3300005543 | Bacteria | 6380 |
| 85 | Ga0070672_100025566 | 3300005543 | Bacteria | 4381 |
| 86 | Ga0070672_100059310 | 3300005543 | Bacteria | 3011 |
| 87 | Ga0070686_100002667 | 3300005544 | Bacteria | 9829 |
| 88 | Ga0070695_100071581 | 3300005545 | Bacteria | 2271 |
| 89 | Ga0070696_100005997 | 3300005546 | Bacteria | 8112 |
| 90 | Ga0070693_100000877 | 3300005547 | Bacteria | 13388 |
| 91 | Ga0070693_100048717 | 3300005547 | Bacteria | 2414 |
| 92 | Ga0070665_100000043 | 3300005548 | Bacteria | 279774 |
| 93 | Ga0070665_100011861 | 3300005548 | Bacteria | 8802 |
| 94 | Ga0070665_100215364 | 3300005548 | Bacteria | 1922 |
| 95 | Ga0070665_100373194 | 3300005548 | Bacteria | 1433 |
| 96 | Ga0070704_100000285 | 3300005549 | Bacteria | 22156 |
| 97 | Ga0068855_100030880 | 3300005563 | Bacteria | 6405 |
| 98 | Ga0068855_100173168 | 3300005563 | Bacteria | 2443 |
| 99 | Ga0068855_100262254 | 3300005563 | Bacteria | 1924 |
| 100 | Ga0070664_100003522 | 3300005564 | Bacteria | 12643 |
| 101 | Ga0070664_100063592 | 3300005564 | Bacteria | 3146 |
| 102 | Ga0068857_100001587 | 3300005577 | Bacteria | 18219 |
| 103 | Ga0068857_100006351 | 3300005577 | Bacteria | 10122 |
| 104 | Ga0068854_100000765 | 3300005578 | Bacteria | 19088 |
| 105 | Ga0068854_100047630 | 3300005578 | Bacteria | 3056 |
| 106 | Ga0068854_100262141 | 3300005578 | Bacteria | 1384 |
| 107 | Ga0068856_100001518 | 3300005614 | Bacteria | 24335 |
| 108 | Ga0068856_100001586 | 3300005614 | Bacteria | 23792 |
| 109 | Ga0068856_100031963 | 3300005614 | Bacteria | 5150 |
| 110 | Ga0068856_100050666 | 3300005614 | Bacteria | 4093 |
| 111 | Ga0070702_100001487 | 3300005615 | Bacteria | 9630 |
| 112 | Ga0070702_100256000 | 3300005615 | Bacteria | 1189 |
| 113 | Ga0068852_100023036 | 3300005616 | Bacteria | 5006 |
| 114 | Ga0068852_100059581 | 3300005616 | Bacteria | 3311 |
| 115 | Ga0068859_100018002 | 3300005617 | Bacteria | 7099 |
| 116 | Ga0068859_100064866 | 3300005617 | Bacteria | 3685 |
| 117 | Ga0068859_100250946 | 3300005617 | Bacteria | 1860 |
| 118 | Ga0068864_100006600 | 3300005618 | Bacteria | 9495 |
| 119 | Ga0068866_10027542 | 3300005718 | Bacteria | 2697 |
| 120 | Ga0068861_100045965 | 3300005719 | Bacteria | 3290 |
| 121 | Ga0068861_100368274 | 3300005719 | Bacteria | 1266 |
| 122 | Ga0068851_10087373 | 3300005834 | Bacteria | 1637 |
| 123 | Ga0068851_10097427 | 3300005834 | Bacteria | 1556 |
| 124 | Ga0068863_100000964 | 3300005841 | Bacteria | 28923 |
| 125 | Ga0068863_100285650 | 3300005841 | Bacteria | 1599 |
| 126 | Ga0068858_100000418 | 3300005842 | Bacteria | 44177 |
| 127 | Ga0068858_100009723 | 3300005842 | Bacteria | 9157 |
| 128 | Ga0068858_100013968 | 3300005842 | Bacteria | 7575 |
| 129 | Ga0068858_100207204 | 3300005842 | Bacteria | 1855 |
| 130 | Ga0068862_100000734 | 3300005844 | Bacteria | 32937 |
| 131 | Ga0070715_10000723 | 3300006163 | Bacteria | 8904 |
| 132 | Ga0070716_100000247 | 3300006173 | Bacteria | 21657 |
| 133 | Ga0070712_100000023 | 3300006175 | Bacteria | 80972 |
| 134 | Ga0070712_100000803 | 3300006175 | Bacteria | 18648 |
| 135 | Ga0070712_100001127 | 3300006175 | Bacteria | 16083 |
| 136 | Ga0075369_10024851 | 3300006186 | Bacteria | 2486 |
| 137 | Ga0075366_10042391 | 3300006195 | Bacteria | 2694 |
| 138 | Ga0097621_100008931 | 3300006237 | Bacteria | 7245 |
| 139 | Ga0068871_100045364 | 3300006358 | Bacteria | 3538 |
| 140 | Ga0068871_100071010 | 3300006358 | Bacteria | 2863 |
| 141 | Ga0075428_100000606 | 3300006844 | Bacteria | 36554 |
| 142 | Ga0075430_100015106 | 3300006846 | Bacteria | 6572 |
| 143 | Ga0075431_100000032 | 3300006847 | Bacteria | 72293 |
| 144 | Ga0075431_100003366 | 3300006847 | Bacteria | 15496 |
| 145 | Ga0075431_100112935 | 3300006847 | Bacteria | 2804 |
| 146 | Ga0075433_10126003 | 3300006852 | Bacteria | 2274 |
| 147 | Ga0075434_100048864 | 3300006871 | Bacteria | 4199 |
| 148 | Ga0075434_100121785 | 3300006871 | Bacteria | 2624 |
| 149 | Ga0075434_100367380 | 3300006871 | Bacteria | 1460 |
| 150 | Ga0075429_100008370 | 3300006880 | Bacteria | 9003 |
| 151 | Ga0068865_100002428 | 3300006881 | Bacteria | 11012 |
| 152 | Ga0068865_100129080 | 3300006881 | Bacteria | 1891 |
| 153 | Ga0068865_100333935 | 3300006881 | Bacteria | 1223 |
| 154 | Ga0075436_100000211 | 3300006914 | Bacteria | 36106 |
| 155 | Ga0075436_100001146 | 3300006914 | Bacteria | 17902 |
| 156 | Ga0075436_100306310 | 3300006914 | Bacteria | 1139 |
| 157 | Ga0097620_100064871 | 3300006931 | Bacteria | 3685 |
| 158 | Ga0075435_100019220 | 3300007076 | Bacteria | 5212 |
| 159 | Ga0075435_100243105 | 3300007076 | Bacteria | 1531 |
| 160 | Ga0105251_10003975 | 3300009011 | Bacteria | 10468 |
| 161 | Ga0105240_10001363 | 3300009093 | Bacteria | 41954 |
| 162 | Ga0105240_10196292 | 3300009093 | Bacteria | 2369 |
| 163 | Ga0105240_10282089 | 3300009093 | Bacteria | 1908 |
| 164 | Ga0111539_10001089 | 3300009094 | Bacteria | 35899 |
| 165 | Ga0105245_10001371 | 3300009098 | Bacteria | 22055 |
| 166 | Ga0105247_10000267 | 3300009101 | Bacteria | 48481 |
| 167 | Ga0105247_10000490 | 3300009101 | Bacteria | 32865 |
| 168 | Ga0114129_10000062 | 3300009147 | Bacteria | 96507 |
| 169 | Ga0114129_10038874 | 3300009147 | Bacteria | 6708 |
| 170 | Ga0114129_10099120 | 3300009147 | Bacteria | 4033 |
| 171 | Ga0105243_10000490 | 3300009148 | Bacteria | 40402 |
| 172 | Ga0105243_10004582 | 3300009148 | Bacteria | 10901 |
| 173 | Ga0105243_10012302 | 3300009148 | Bacteria | 6471 |
| 174 | Ga0105241_10004507 | 3300009174 | Bacteria | 10306 |
| 175 | Ga0105241_10006458 | 3300009174 | Bacteria | 8643 |
| 176 | Ga0105241_10018242 | 3300009174 | Bacteria | 5159 |
| 177 | Ga0105241_10027427 | 3300009174 | Bacteria | 4242 |
| 178 | Ga0105242_10495002 | 3300009176 | Bacteria | 1162 |
| 179 | Ga0105248_10000546 | 3300009177 | Bacteria | 42987 |
| 180 | Ga0105248_10019052 | 3300009177 | Bacteria | 7588 |
| 181 | Ga0105237_10000746 | 3300009545 | Bacteria | 44835 |
| 182 | Ga0105237_10135815 | 3300009545 | Bacteria | 2454 |
| 183 | Ga0105237_10240008 | 3300009545 | Bacteria | 1813 |
| 184 | Ga0105237_10427231 | 3300009545 | Bacteria | 1330 |
| 185 | Ga0105238_10064606 | 3300009551 | Bacteria | 3659 |
| 186 | Ga0105238_10146325 | 3300009551 | Bacteria | 2339 |
| 187 | Ga0105238_10191083 | 3300009551 | Bacteria | 2024 |
| 188 | Ga0105238_10214035 | 3300009551 | Bacteria | 1903 |
| 189 | Ga0105238_10299226 | 3300009551 | Bacteria | 1592 |
| 190 | Ga0105249_10010570 | 3300009553 | Bacteria | 8111 |
| 191 | Ga0105239_10010016 | 3300010375 | Bacteria | 10631 |
| 192 | Ga0105239_10014493 | 3300010375 | Bacteria | 8746 |
| 193 | Ga0105239_10040567 | 3300010375 | Bacteria | 5100 |
| 194 | Ga0105239_10069699 | 3300010375 | Bacteria | 3863 |
| 195 | Ga0105239_10570602 | 3300010375 | Bacteria | 1289 |
| 196 | Ga0105246_10000573 | 3300011119 | Bacteria | 20393 |
| 197 | Ga0157324_1000358 | 3300012506 | Bacteria | 2128 |
| 198 | Ga0157373_10001483 | 3300013100 | Bacteria | 17886 |
| 199 | Ga0157373_10002592 | 3300013100 | Bacteria | 13730 |
| 200 | Ga0157373_10093369 | 3300013100 | Bacteria | 2119 |
| 201 | Ga0157371_10000062 | 3300013102 | Bacteria | 169669 |
| 202 | Ga0157371_10052012 | 3300013102 | Bacteria | 2910 |
| 203 | Ga0157370_10000753 | 3300013104 | Bacteria | 40426 |
| 204 | Ga0157370_10018947 | 3300013104 | Bacteria | 6919 |
| 205 | Ga0157370_10273238 | 3300013104 | Bacteria | 1561 |
| 206 | Ga0157369_10001029 | 3300013105 | Bacteria | 35216 |
| 207 | Ga0157369_10002018 | 3300013105 | Bacteria | 24475 |
| 208 | Ga0157369_10067493 | 3300013105 | Bacteria | 3845 |
| 209 | Ga0157369_10173221 | 3300013105 | Bacteria | 2273 |
| 210 | Ga0157369_10420092 | 3300013105 | Bacteria | 1386 |
| 211 | Ga0157378_10085814 | 3300013297 | Bacteria | 2852 |
| 212 | Ga0157378_10325268 | 3300013297 | Bacteria | 1495 |
| 213 | Ga0157372_10002818 | 3300013307 | Bacteria | 18780 |
| 214 | Ga0157372_10419041 | 3300013307 | Bacteria | 1560 |
| 215 | Ga0157372_10419686 | 3300013307 | Bacteria | 1559 |
| 216 | Ga0157375_10032115 | 3300013308 | Bacteria | 4976 |
| 217 | Ga0157375_10412256 | 3300013308 | Bacteria | 1517 |
| 218 | Ga0163163_10018194 | 3300014325 | Bacteria | 6571 |
| 219 | Ga0163163_10069761 | 3300014325 | Bacteria | 3499 |
| 220 | Ga0157377_10002609 | 3300014745 | Bacteria | 8001 |
| 221 | Ga0157379_10001147 | 3300014968 | Bacteria | 21627 |
| 222 | Ga0157379_10002050 | 3300014968 | Bacteria | 16740 |
| 223 | Ga0157379_10013521 | 3300014968 | Bacteria | 7153 |
| 224 | Ga0157379_10015138 | 3300014968 | Bacteria | 6765 |
| 225 | Ga0157379_10035127 | 3300014968 | Bacteria | 4469 |
| 226 | Ga0157376_10024439 | 3300014969 | Bacteria | 4744 |
| 227 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 228 | Ga0213873_10000216 | 3300021358 | Bacteria | 10215 |
| 229 | Ga0213872_10008768 | 3300021361 | Bacteria | 4880 |
| 230 | Ga0213872_10016799 | 3300021361 | Bacteria | 3393 |
| 231 | Ga0213876_10000056 | 3300021384 | Bacteria | 135017 |
| 232 | Ga0213876_10000258 | 3300021384 | Bacteria | 49441 |
| 233 | Ga0209563_100070 | 3300025230 | Bacteria | 249779 |
| 234 | Ga0209646_1009815 | 3300025246 | Bacteria | 1512 |
| 235 | Ga0209148_1000008 | 3300025254 | Bacteria | 1504371 |
| 236 | Ga0209233_1032486 | 3300025261 | Bacteria | 1206 |
| 237 | Ga0209455_1000002 | 3300025272 | Bacteria | 1505459 |
| 238 | Ga0209758_1000007 | 3300025297 | Bacteria | 1270410 |
| 239 | Ga0207656_10000493 | 3300025321 | Bacteria | 13053 |
| 240 | Ga0207713_1024811 | 3300025735 | Bacteria | 2783 |
| 241 | Ga0207642_10082837 | 3300025899 | Bacteria | 1562 |
| 242 | Ga0207710_10001601 | 3300025900 | Bacteria | 11075 |
| 243 | Ga0207688_10000468 | 3300025901 | Bacteria | 19347 |
| 244 | Ga0207680_10127066 | 3300025903 | Bacteria | 1675 |
| 245 | Ga0207647_10000782 | 3300025904 | Bacteria | 24751 |
| 246 | Ga0207647_10002881 | 3300025904 | Bacteria | 12962 |
| 247 | Ga0207647_10173592 | 3300025904 | Bacteria | 1254 |
| 248 | Ga0207699_10000280 | 3300025906 | Bacteria | 27852 |
| 249 | Ga0207699_10018169 | 3300025906 | Bacteria | 3722 |
| 250 | Ga0207645_10201891 | 3300025907 | Bacteria | 1308 |
| 251 | Ga0207705_10039852 | 3300025909 | Bacteria | 3367 |
| 252 | Ga0207705_10044154 | 3300025909 | Bacteria | 3203 |
| 253 | Ga0207654_10000226 | 3300025911 | Bacteria | 34521 |
| 254 | Ga0207707_10190318 | 3300025912 | Bacteria | 1790 |
| 255 | Ga0207695_10016920 | 3300025913 | Bacteria | 8508 |
| 256 | Ga0207695_10051375 | 3300025913 | Bacteria | 4329 |
| 257 | Ga0207671_10032982 | 3300025914 | Bacteria | 3855 |
| 258 | Ga0207693_10000018 | 3300025915 | Bacteria | 138365 |
| 259 | Ga0207693_10000267 | 3300025915 | Bacteria | 48128 |
| 260 | Ga0207693_10000534 | 3300025915 | Bacteria | 34415 |
| 261 | Ga0207663_10000947 | 3300025916 | Bacteria | 13260 |
| 262 | Ga0207663_10011828 | 3300025916 | Bacteria | 4699 |
| 263 | Ga0207663_10255552 | 3300025916 | Bacteria | 1291 |
| 264 | Ga0207662_10000454 | 3300025918 | Bacteria | 18174 |
| 265 | Ga0207657_10000170 | 3300025919 | Bacteria | 66814 |
| 266 | Ga0207657_10009722 | 3300025919 | Bacteria | 9644 |
| 267 | Ga0207657_10037832 | 3300025919 | Bacteria | 4304 |
| 268 | Ga0207649_10000016 | 3300025920 | Bacteria | 243843 |
| 269 | Ga0207649_10000026 | 3300025920 | Bacteria | 177395 |
| 270 | Ga0207649_10011028 | 3300025920 | Bacteria | 4973 |
| 271 | Ga0207649_10032359 | 3300025920 | Bacteria | 3117 |
| 272 | Ga0207649_10105962 | 3300025920 | Bacteria | 1869 |
| 273 | Ga0207649_10129052 | 3300025920 | Bacteria | 1715 |
| 274 | Ga0207652_10008354 | 3300025921 | Bacteria | 8327 |
| 275 | Ga0207681_10237794 | 3300025923 | Bacteria | 1416 |
| 276 | Ga0207694_10027016 | 3300025924 | Bacteria | 4369 |
| 277 | Ga0207694_10034592 | 3300025924 | Bacteria | 3874 |
| 278 | Ga0207694_10039727 | 3300025924 | Bacteria | 3621 |
| 279 | Ga0207694_10061427 | 3300025924 | Bacteria | 2924 |
| 280 | Ga0207694_10117694 | 3300025924 | Bacteria | 2119 |
| 281 | Ga0207650_10031979 | 3300025925 | Bacteria | 3804 |
| 282 | Ga0207650_10074126 | 3300025925 | Bacteria | 2565 |
| 283 | Ga0207650_10205773 | 3300025925 | Bacteria | 1579 |
| 284 | Ga0207687_10018502 | 3300025927 | Bacteria | 4600 |
| 285 | Ga0207700_10000026 | 3300025928 | Bacteria | 139690 |
| 286 | Ga0207644_10006974 | 3300025931 | Bacteria | 7357 |
| 287 | Ga0207644_10008396 | 3300025931 | Bacteria | 6758 |
| 288 | Ga0207690_10002244 | 3300025932 | Bacteria | 11801 |
| 289 | Ga0207690_10003226 | 3300025932 | Bacteria | 9791 |
| 290 | Ga0207706_10000421 | 3300025933 | Bacteria | 45539 |
| 291 | Ga0207706_10063657 | 3300025933 | Bacteria | 3247 |
| 292 | Ga0207706_10084929 | 3300025933 | Bacteria | 2783 |
| 293 | Ga0207686_10003249 | 3300025934 | Bacteria | 8746 |
| 294 | Ga0207709_10000005 | 3300025935 | Bacteria | 806813 |
| 295 | Ga0207709_10110538 | 3300025935 | Bacteria | 1837 |
| 296 | Ga0207670_10012918 | 3300025936 | Bacteria | 4906 |
| 297 | Ga0207669_10005383 | 3300025937 | Bacteria | 5738 |
| 298 | Ga0207669_10014939 | 3300025937 | Bacteria | 3904 |
| 299 | Ga0207704_10013657 | 3300025938 | Bacteria | 4074 |
| 300 | Ga0207665_10000696 | 3300025939 | Bacteria | 22788 |
| 301 | Ga0207691_10019645 | 3300025940 | Bacteria | 6392 |
| 302 | Ga0207691_10037589 | 3300025940 | Bacteria | 4483 |
| 303 | Ga0207691_10044642 | 3300025940 | Bacteria | 4078 |
| 304 | Ga0207711_10037179 | 3300025941 | Bacteria | 4133 |
| 305 | Ga0207711_10163211 | 3300025941 | Bacteria | 2018 |
| 306 | Ga0207689_10210012 | 3300025942 | Bacteria | 1608 |
| 307 | Ga0207679_10025050 | 3300025945 | Bacteria | 4098 |
| 308 | Ga0207679_10143335 | 3300025945 | Bacteria | 1934 |
| 309 | Ga0207667_10000001 | 3300025949 | Bacteria | 1178522 |
| 310 | Ga0207667_10009832 | 3300025949 | Bacteria | 11240 |
| 311 | Ga0207667_10010243 | 3300025949 | Bacteria | 10974 |
| 312 | Ga0207667_10015513 | 3300025949 | Bacteria | 8647 |
| 313 | Ga0207667_10102808 | 3300025949 | Bacteria | 2947 |
| 314 | Ga0207667_10192437 | 3300025949 | Bacteria | 2093 |
| 315 | Ga0207651_10022299 | 3300025960 | Bacteria | 3868 |
| 316 | Ga0207651_10064387 | 3300025960 | Bacteria | 2566 |
| 317 | Ga0207712_10007229 | 3300025961 | Bacteria | 7003 |
| 318 | Ga0207712_10019682 | 3300025961 | Bacteria | 4411 |
| 319 | Ga0207668_10001754 | 3300025972 | Bacteria | 12694 |
| 320 | Ga0207640_10002461 | 3300025981 | Bacteria | 9912 |
| 321 | Ga0207640_10169283 | 3300025981 | Bacteria | 1626 |
| 322 | Ga0207658_10018107 | 3300025986 | Bacteria | 4859 |
| 323 | Ga0207658_10056784 | 3300025986 | Bacteria | 2906 |
| 324 | Ga0207677_10020778 | 3300026023 | Bacteria | 3995 |
| 325 | Ga0207677_10465194 | 3300026023 | Bacteria | 1086 |
| 326 | Ga0207703_10003927 | 3300026035 | Bacteria | 12343 |
| 327 | Ga0207703_10006685 | 3300026035 | Bacteria | 9199 |
| 328 | Ga0207639_10007127 | 3300026041 | Bacteria | 7620 |
| 329 | Ga0207678_10000210 | 3300026067 | Bacteria | 51779 |
| 330 | Ga0207678_10007090 | 3300026067 | Bacteria | 9943 |
| 331 | Ga0207678_10118717 | 3300026067 | Bacteria | 2257 |
| 332 | Ga0207702_10000592 | 3300026078 | Bacteria | 40068 |
| 333 | Ga0207702_10000862 | 3300026078 | Bacteria | 31638 |
| 334 | Ga0207702_10003947 | 3300026078 | Bacteria | 13327 |
| 335 | Ga0207702_10040468 | 3300026078 | Bacteria | 3907 |
| 336 | Ga0207702_10086962 | 3300026078 | Bacteria | 2727 |
| 337 | Ga0207702_10094682 | 3300026078 | Bacteria | 2622 |
| 338 | Ga0207641_10002237 | 3300026088 | Bacteria | 18096 |
| 339 | Ga0207641_10055921 | 3300026088 | Bacteria | 3352 |
| 340 | Ga0207641_10064687 | 3300026088 | Bacteria | 3126 |
| 341 | Ga0207676_10013348 | 3300026095 | Bacteria | 5901 |
| 342 | Ga0207674_10000134 | 3300026116 | Bacteria | 86377 |
| 343 | Ga0207674_10001169 | 3300026116 | Bacteria | 34089 |
| 344 | Ga0207674_10013140 | 3300026116 | Bacteria | 9215 |
| 345 | Ga0207674_10034643 | 3300026116 | Bacteria | 5276 |
| 346 | Ga0207675_100000311 | 3300026118 | Bacteria | 46624 |
| 347 | Ga0207675_100293639 | 3300026118 | Bacteria | 1582 |
| 348 | Ga0207683_10000192 | 3300026121 | Bacteria | 52412 |
| 349 | Ga0207683_10002482 | 3300026121 | Bacteria | 16096 |
| 350 | Ga0207683_10355248 | 3300026121 | Bacteria | 1345 |
| 351 | Ga0207698_10001942 | 3300026142 | Bacteria | 12137 |
| 352 | Ga0207698_10013227 | 3300026142 | Bacteria | 5436 |
| 353 | Ga0207698_10039343 | 3300026142 | Bacteria | 3502 |
| 354 | Ga0209974_10011378 | 3300027876 | Bacteria | 2988 |
| 355 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 356 | Ga0268266_10036274 | 3300028379 | Bacteria | 4196 |
| 357 | Ga0268265_10010125 | 3300028380 | Bacteria | 6366 |
| 358 | Ga0268264_10028296 | 3300028381 | Bacteria | 4583 |
| 359 | Ga0265319_1033409 | 3300028563 | Bacteria | 1777 |
| 360 | Ga0265318_10016634 | 3300028577 | Bacteria | 3034 |
| 361 | Ga0307517_10012984 | 3300028786 | Bacteria | 11362 |
| 362 | Ga0307517_10052987 | 3300028786 | Bacteria | 4051 |
| 363 | Ga0265324_10048288 | 3300029957 | Bacteria | 1464 |
| 364 | Ga0265330_10114450 | 3300031235 | Bacteria | 1150 |
| 365 | Ga0265332_10056104 | 3300031238 | Bacteria | 1688 |
| 366 | Ga0265325_10000365 | 3300031241 | Bacteria | 31743 |
| 367 | Ga0265339_10006412 | 3300031249 | Bacteria | 7719 |
| 368 | Ga0265339_10099610 | 3300031249 | Bacteria | 1514 |
| 369 | Ga0265331_10000008 | 3300031250 | Bacteria | 324311 |
| 370 | Ga0265331_10000067 | 3300031250 | Bacteria | 158073 |
| 371 | Ga0265331_10024816 | 3300031250 | Bacteria | 3029 |
| 372 | Ga0265327_10000036 | 3300031251 | Bacteria | 312827 |
| 373 | Ga0265316_10013136 | 3300031344 | Bacteria | 7377 |
| 374 | Ga0307513_10080372 | 3300031456 | Bacteria | 3363 |
| 375 | Ga0265313_10006830 | 3300031595 | Bacteria | 7964 |
| 376 | Ga0265313_10021851 | 3300031595 | Bacteria | 3488 |
| 377 | Ga0265314_10002746 | 3300031711 | Bacteria | 17598 |
| 378 | Ga0265314_10049117 | 3300031711 | Bacteria | 2956 |
| 379 | Ga0265342_10051682 | 3300031712 | Bacteria | 2451 |
| 380 | Ga0307414_10000567 | 3300032004 | Bacteria | 19287 |
| 381 | Ga0307411_10078968 | 3300032005 | Bacteria | 2258 |
| 382 | Ga0373952_0012269 | 3300035092 | Bacteria | 1683 |
| 383 | Ga0373939_0010689 | 3300035114 | Bacteria | 2302 |
| 384 | Ga0373955_0119421 | 3300035172 | Bacteria | 1531 |
| 385 | Ga0373942_0015942 | 3300035207 | Bacteria | 1838 |
| 386 | Ga0373931_0004736 | 3300035691 | Bacteria | 6237 |
| 387 | Ga0373931_0007222 | 3300035691 | Bacteria | 5229 |
| 388 | Ga0373935_0013458 | 3300035692 | Bacteria | 4937 |
| 389 | Ga0373927_0015725 | 3300035695 | Bacteria | 4996 |
| 390 | Ga0373937_0023121 | 3300036401 | Bacteria | 5593 |
| 391 | Ga0373925_0273977 | 3300037068 | Bacteria | 1358 |
| 392 | Ga0395899_0169452 | 3300037312 | Bacteria | 1538 |
| 393 | Ga0395900_0024597 | 3300037418 | Bacteria | 6165 |
| 394 | Ga0395898_0011788 | 3300037466 | Bacteria | 9063 |
| 395 | Ga0395905_0000108 | 3300037471 | Bacteria | 138234 |
| 396 | Ga0395905_0001746 | 3300037471 | Bacteria | 25379 |
| 397 | Ga0395905_0051525 | 3300037471 | Bacteria | 3856 |
| 398 | Ga0395905_0492486 | 3300037471 | Bacteria | 1126 |
| 399 | Ga0436364_0479880 | 3300037853 | Bacteria | 2180 |
| 400 | Ga0395901_0029521 | 3300038443 | Bacteria | 5647 |
| 401 | Ga0436365_0083543 | 3300039437 | Bacteria | 85224 |
| 402 | Ga0436365_0456925 | 3300039437 | Bacteria | 13529 |
| 403 | Ga0436365_1515960 | 3300039437 | Bacteria | 1079 |
| 404 | Ga0436360_0298857 | 3300039438 | Bacteria | 8376 |
| 405 | Ga0436361_0163275 | 3300039447 | Bacteria | 23310 |
| 406 | Ga0436361_0570909 | 3300039447 | Bacteria | 2853 |
| 407 | Ga0436361_0606425 | 3300039447 | Bacteria | 3014 |
| 408 | Ga0436361_0765979 | 3300039447 | Bacteria | 11155 |
| 409 | Ga0436361_1004845 | 3300039447 | Bacteria | 7440 |
| 410 | Ga0436362_1001952 | 3300039453 | Bacteria | 11094 |
| 411 | Ga0436362_1235945 | 3300039453 | Bacteria | 2266 |
| 412 | Ga0451787_345757 | 3300041441 | Bacteria | 1167 |
| 413 | Ga0439456_000012 | 3300042013 | Bacteria | 72838 |
| 414 | Ga0466969_0001813 | 3300044656 | Bacteria | 11397 |
| 415 | Ga0466969_0048192 | 3300044656 | Bacteria | 2107 |
| 416 | Ga0466969_0136845 | 3300044656 | Bacteria | 1134 |
| 417 | Ga0466966_0000261 | 3300044684 | Bacteria | 35154 |
| 418 | Ga0466966_0108505 | 3300044684 | Bacteria | 1712 |
| 419 | Ga0466971_0001002 | 3300044719 | Bacteria | 11653 |
| 420 | Ga0466970_0004102 | 3300044765 | Bacteria | 7162 |
| 421 | Ga0466970_0195302 | 3300044765 | Bacteria | 1125 |
| 422 | Ga0466957_0003464 | 3300044842 | Bacteria | 8662 |
| 423 | Ga0466957_0049582 | 3300044842 | Bacteria | 2553 |
| 424 | Ga0466957_0091550 | 3300044842 | Bacteria | 1906 |
| 425 | Ga0466957_0141996 | 3300044842 | Bacteria | 1548 |
| 426 | Ga0466959_0000155 | 3300045049 | Bacteria | 44848 |
| 427 | Ga0466959_0082965 | 3300045049 | Bacteria | 2309 |
| 428 | Ga0466958_0005552 | 3300045836 | Bacteria | 6799 |
| 429 | Ga0466958_0117236 | 3300045836 | Bacteria | 1665 |
| 430 | Ga0495629_0020819 | 3300046459 | Bacteria | 4682 |
| 431 | Ga0495650_0012193 | 3300046471 | Bacteria | 4641 |
| 432 | Ga0495584_0133840 | 3300046491 | Bacteria | 1258 |
| 433 | Ga0495585_0019768 | 3300046492 | Bacteria | 3879 |
| 434 | Ga0495585_0096486 | 3300046492 | Bacteria | 1586 |
| 435 | Ga0495583_0051520 | 3300046506 | Bacteria | 1876 |
| 436 | Ga0495606_0002116 | 3300046507 | Bacteria | 24110 |
| 437 | Ga0495606_0156780 | 3300046507 | Bacteria | 1331 |
| 438 | Ga0495606_0224367 | 3300046507 | Bacteria | 1057 |
| 439 | Ga0495628_0016870 | 3300046516 | Bacteria | 6087 |
| 440 | Ga0495637_0012078 | 3300046520 | Bacteria | 4138 |
| 441 | Ga0495643_0001994 | 3300046522 | Bacteria | 17059 |
| 442 | Ga0495648_0000323 | 3300046524 | Bacteria | 53106 |
| 443 | Ga0495663_0008715 | 3300046525 | Bacteria | 2813 |
| 444 | Ga0495642_0011218 | 3300046528 | Bacteria | 3437 |
| 445 | Ga0495587_0040230 | 3300046536 | Bacteria | 2795 |
| 446 | Ga0495597_0089462 | 3300046542 | Bacteria | 1308 |
| 447 | Ga0495622_0012236 | 3300046557 | Bacteria | 3968 |
| 448 | Ga0495633_0000494 | 3300046558 | Bacteria | 39797 |
| 449 | Ga0495668_0000059 | 3300046616 | Bacteria | 194951 |
| 450 | Ga0495611_0035018 | 3300046648 | Bacteria | 2222 |
| 451 | Ga0495611_0051772 | 3300046648 | Bacteria | 1851 |
| 452 | Ga0495611_0121531 | 3300046648 | Bacteria | 1218 |
| 453 | Ga0495625_0000559 | 3300046660 | Bacteria | 54547 |
| 454 | Ga0495625_0009358 | 3300046660 | Bacteria | 8205 |
| 455 | Ga0495625_0093589 | 3300046660 | Bacteria | 2074 |
| 456 | Ga0495625_0167472 | 3300046660 | Bacteria | 1468 |
| 457 | Ga0495646_0114196 | 3300046680 | Bacteria | 1535 |
| 458 | Ga0495669_0000628 | 3300046684 | Bacteria | 15338 |
| 459 | Ga0495613_0006941 | 3300046689 | Bacteria | 8446 |
| 460 | Ga0495613_0254987 | 3300046689 | Bacteria | 1223 |
| 461 | Ga0495670_0099123 | 3300046691 | Bacteria | 1499 |
| 462 | Ga0495671_0093788 | 3300046692 | Bacteria | 1469 |
| 463 | Ga0495649_0033503 | 3300046694 | Bacteria | 2827 |
| 464 | Ga0495649_0100773 | 3300046694 | Bacteria | 1535 |
| 465 | Ga0495600_0006647 | 3300046809 | Bacteria | 7044 |
| 466 | Ga0495683_0047147 | 3300047323 | Bacteria | 2162 |
| 467 | Ga0495683_0069502 | 3300047323 | Bacteria | 1730 |
| 468 | Ga0495683_0157615 | 3300047323 | Bacteria | 1052 |
| 469 | Ga0495687_000152 | 3300047443 | Bacteria | 105602 |
| 470 | Ga0495687_000517 | 3300047443 | Bacteria | 46300 |
| 471 | Ga0495687_028628 | 3300047443 | Bacteria | 2589 |
| 472 | Ga0495677_0009651 | 3300047445 | Bacteria | 3559 |
| 473 | Ga0495673_0044873 | 3300047469 | Bacteria | 1969 |
| 474 | Ga0495681_0006423 | 3300047470 | Bacteria | 7729 |
| 475 | Ga0495684_0061653 | 3300047471 | Bacteria | 2853 |
| 476 | Ga0495686_0000209 | 3300047472 | Bacteria | 108972 |
| 477 | Ga0496100_0011653 | 3300048903 | Bacteria | 5011 |
| 478 | Ga0496101_0031856 | 3300048904 | Bacteria | 3708 |
| 479 | Ga0496102_0000010 | 3300048905 | Bacteria | 324617 |
| 480 | Ga0496102_0000184 | 3300048905 | Bacteria | 84568 |
| 481 | Ga0496102_0088810 | 3300048905 | Bacteria | 2858 |
| 482 | Ga0496102_0296709 | 3300048905 | Bacteria | 1523 |
| 483 | Ga0496102_0336537 | 3300048905 | Bacteria | 1421 |
| 484 | Ga0496103_0000082 | 3300048906 | Bacteria | 109451 |
| 485 | Ga0496103_0000099 | 3300048906 | Bacteria | 94046 |
| 486 | Ga0496103_0024985 | 3300048906 | Bacteria | 3607 |
| 487 | Ga0496104_0002902 | 3300048907 | Bacteria | 14768 |
| 488 | Ga0496104_0037107 | 3300048907 | Bacteria | 4557 |
| 489 | Ga0496104_0053857 | 3300048907 | Bacteria | 3802 |
| 490 | Ga0496104_0185783 | 3300048907 | Bacteria | 1989 |
| 491 | Ga0496105_0000589 | 3300048908 | Bacteria | 24200 |
| 492 | Ga0496105_0046110 | 3300048908 | Bacteria | 3597 |
| 493 | Ga0496105_0190159 | 3300048908 | Bacteria | 1679 |
| 494 | Ga0496106_0056041 | 3300048909 | Bacteria | 2979 |
| 495 | Ga0496107_0019441 | 3300048910 | Bacteria | 4792 |
| 496 | Ga0496107_0118510 | 3300048910 | Bacteria | 1949 |
| 497 | Ga0496107_0189696 | 3300048910 | Bacteria | 1527 |
| 498 | Ga0496107_0253421 | 3300048910 | Bacteria | 1310 |
| 499 | Ga0496108_0005359 | 3300048911 | Bacteria | 10370 |
| 500 | Ga0496109_0001652 | 3300048912 | Bacteria | 18631 |
| 501 | Ga0496110_0059985 | 3300048913 | Bacteria | 3354 |
| 502 | Ga0496110_0080817 | 3300048913 | Bacteria | 2897 |
| 503 | Ga0496110_0197855 | 3300048913 | Bacteria | 1825 |
| 504 | Ga0496111_0041330 | 3300048914 | Bacteria | 3308 |
| 505 | Ga0496111_0081271 | 3300048914 | Bacteria | 2365 |
| 506 | Ga0496111_0224106 | 3300048914 | Bacteria | 1397 |
| 507 | Ga0496111_0257477 | 3300048914 | Bacteria | 1295 |
| 508 | Ga0496112_0069480 | 3300048915 | Bacteria | 3479 |
| 509 | Ga0496113_0007975 | 3300048916 | Bacteria | 6861 |
| 510 | Ga0496113_0051841 | 3300048916 | Bacteria | 3062 |
| 511 | Ga0496113_0059974 | 3300048916 | Bacteria | 2867 |
| 512 | Ga0496114_0002662 | 3300048917 | Bacteria | 13626 |
| 513 | Ga0496114_0016017 | 3300048917 | Bacteria | 6032 |
| 514 | Ga0496114_0301064 | 3300048917 | Bacteria | 1416 |
| 515 | Ga0496115_0000066 | 3300048918 | Bacteria | 95550 |
| 516 | Ga0496115_0041710 | 3300048918 | Bacteria | 3653 |
| 517 | Ga0496115_0047342 | 3300048918 | Bacteria | 3438 |
| 518 | Ga0496116_0004459 | 3300048919 | Bacteria | 13338 |
| 519 | Ga0496116_0020607 | 3300048919 | Bacteria | 5002 |
| 520 | Ga0496117_0000037 | 3300048920 | Bacteria | 324960 |
| 521 | Ga0496117_0001024 | 3300048920 | Bacteria | 42696 |
| 522 | Ga0496118_0000034 | 3300048921 | Bacteria | 322764 |
| 523 | Ga0496118_0000154 | 3300048921 | Bacteria | 122224 |
| 524 | Ga0496118_0004003 | 3300048921 | Bacteria | 17936 |
| 525 | Ga0496119_0036254 | 3300048922 | Bacteria | 3222 |
| 526 | Ga0496119_0048681 | 3300048922 | Bacteria | 2627 |
| 527 | Ga0496120_0016240 | 3300048923 | Bacteria | 4872 |
| 528 | Ga0496121_0010925 | 3300048924 | Bacteria | 10142 |
| 529 | Ga0496121_0018754 | 3300048924 | Bacteria | 6954 |
| 530 | Ga0496122_0024680 | 3300048925 | Bacteria | 5254 |
| 531 | Ga0496123_0029886 | 3300048926 | Bacteria | 4000 |
| 532 | Ga0496124_0000033 | 3300048927 | Bacteria | 330586 |
| 533 | Ga0496124_0000291 | 3300048927 | Bacteria | 94493 |
| 534 | Ga0496125_0001248 | 3300048928 | Bacteria | 37996 |
| 535 | Ga0496125_0017934 | 3300048928 | Bacteria | 6729 |
| 536 | Ga0496126_0000463 | 3300048929 | Bacteria | 80860 |
| 537 | Ga0496126_0001079 | 3300048929 | Bacteria | 45863 |
| 538 | Ga0501031_0017718 | 3300049568 | Bacteria | 4631 |
| 539 | Ga0501031_0329525 | 3300049568 | Bacteria | 989 |
| 540 | Ga0501033_0022975 | 3300049570 | Bacteria | 4701 |
| 541 | Ga0501034_0000286 | 3300049571 | Bacteria | 90126 |
| 542 | Ga0501034_0008706 | 3300049571 | Bacteria | 10687 |
| 543 | Ga0501034_0008957 | 3300049571 | Bacteria | 10519 |
| 544 | Ga0501034_0051251 | 3300049571 | Bacteria | 4162 |
| 545 | Ga0501034_0145554 | 3300049571 | Bacteria | 2347 |
| 546 | Ga0501036_0129779 | 3300049572 | Bacteria | 2128 |
| 547 | Ga0501036_0233759 | 3300049572 | Bacteria | 1542 |
| 548 | Ga0501036_0278359 | 3300049572 | Bacteria | 1400 |
| 549 | Ga0501037_0098885 | 3300049573 | Bacteria | 2107 |
| 550 | Ga0501038_0131515 | 3300049574 | Bacteria | 2054 |
| 551 | Ga0501038_0275980 | 3300049574 | Bacteria | 1324 |
| 552 | Ga0501039_0022369 | 3300049575 | Bacteria | 4853 |
| 553 | Ga0501046_0014467 | 3300049580 | Bacteria | 6658 |
| 554 | Ga0501046_0299916 | 3300049580 | Bacteria | 1174 |
| 555 | Ga0501047_0008090 | 3300049581 | Bacteria | 9923 |
| 556 | Ga0501047_0079020 | 3300049581 | Bacteria | 3163 |
| 557 | Ga0501047_0110150 | 3300049581 | Bacteria | 2636 |
| 558 | Ga0501067_0002385 | 3300049583 | Bacteria | 10394 |
| 559 | Ga0501070_0009504 | 3300049586 | Bacteria | 8219 |
| 560 | Ga0501070_0070443 | 3300049586 | Bacteria | 2895 |
| 561 | Ga0501071_0015263 | 3300049587 | Bacteria | 5271 |
| 562 | Ga0501073_0013297 | 3300049589 | Bacteria | 5997 |
| 563 | Ga0501073_0017379 | 3300049589 | Bacteria | 5210 |
| 564 | Ga0501074_0014761 | 3300049590 | Bacteria | 5681 |
| 565 | Ga0501079_0008105 | 3300049741 | Bacteria | 7959 |
| 566 | Ga0501080_0007490 | 3300049742 | Bacteria | 9856 |
| 567 | Ga0501080_0015887 | 3300049742 | Bacteria | 6943 |
| 568 | Ga0501080_0062636 | 3300049742 | Bacteria | 3462 |
| 569 | Ga0501080_0389956 | 3300049742 | Bacteria | 1254 |
| 570 | Ga0501083_0052719 | 3300049744 | Bacteria | 2732 |
| 571 | Ga0501083_0186988 | 3300049744 | Bacteria | 1352 |
| 572 | Ga0501035_0002157 | 3300049822 | Bacteria | 19534 |
| 573 | Ga0501035_0016301 | 3300049822 | Bacteria | 6854 |
| 574 | Ga0501035_0052277 | 3300049822 | Bacteria | 3656 |
| 575 | Ga0501035_0165668 | 3300049822 | Bacteria | 1911 |
| 576 | Ga0501035_0235098 | 3300049822 | Bacteria | 1561 |
| 577 | Ga0501044_0010959 | 3300049823 | Bacteria | 9839 |
| 578 | Ga0501044_0047773 | 3300049823 | Bacteria | 4426 |
| 579 | Ga0501044_0065211 | 3300049823 | Bacteria | 3715 |
| 580 | Ga0501044_0072794 | 3300049823 | Bacteria | 3493 |
| 581 | Ga0501044_0081622 | 3300049823 | Bacteria | 3272 |
| 582 | nmdc:mga0k408_48360_c1 | 3300050493 | Bacteria | 2460 |
| 583 | nmdc:mga05p37_124990_c1 | 3300050507 | Bacteria | 3159 |
| 584 | nmdc:mga05p37_190858_c1 | 3300050507 | Bacteria | 2487 |
| 585 | nmdc:mga05p37_564_c1 | 3300050507 | Bacteria | 40786 |
| 586 | nmdc:mga09592_7130_c1 | 3300050508 | Bacteria | 9087 |
| 587 | nmdc:mga0qj67_192884_c1 | 3300050509 | Bacteria | 1655 |
| 588 | nmdc:mga0qj67_445_c1 | 3300050509 | Bacteria | 28226 |
| 589 | nmdc:mga06r32_191_c1 | 3300050510 | Bacteria | 49056 |
| 590 | nmdc:mga08y16_70447_c1 | 3300050511 | Bacteria | 3645 |
| 591 | nmdc:mga08y16_89_c1 | 3300050511 | Bacteria | 76793 |
| 592 | nmdc:mga0n895_102394_c1 | 3300050512 | Bacteria | 2874 |
| 593 | nmdc:mga0n895_127947_c1 | 3300050512 | Bacteria | 2564 |
| 594 | nmdc:mga0n895_254365_c1 | 3300050512 | Bacteria | 1782 |
| 595 | nmdc:mga0n895_37597_c1 | 3300050512 | Bacteria | 4685 |
| 596 | nmdc:mga0n895_54746_c1 | 3300050512 | Bacteria | 3925 |
| 597 | nmdc:mga0n895_98404_c1 | 3300050512 | Bacteria | 2932 |
| 598 | nmdc:mga0rr50_139249_c1 | 3300050513 | Bacteria | 1951 |
| 599 | nmdc:mga0rr50_230908_c1 | 3300050513 | Bacteria | 1531 |
| 600 | nmdc:mga0rr50_35907_c1 | 3300050513 | Bacteria | 3564 |
| 601 | nmdc:mga0rr50_93255_c1 | 3300050513 | Bacteria | 2349 |
| 602 | nmdc:mga08x19_54_c1 | 3300050514 | Bacteria | 121662 |
| 603 | nmdc:mga0a205_13445_c1 | 3300050515 | Bacteria | 7622 |
| 604 | Ga0500610_0000101 | 3300053079 | Bacteria | 25651 |
| 605 | Ga0495595_0047830 | 3300053084 | Bacteria | 1974 |
| 606 | Ga0495619_0088688 | 3300053085 | Bacteria | 2092 |
| 607 | Ga0500640_051667 | 3300053095 | Bacteria | 1797 |
| 608 | Ga0500593_000072 | 3300053117 | Bacteria | 37884 |
| 609 | Ga0500595_005603 | 3300053119 | Bacteria | 5463 |
| 610 | Ga0500597_000402 | 3300053120 | Bacteria | 9012 |
| 611 | Ga0500607_011812 | 3300053121 | Bacteria | 5150 |
| 612 | Ga0500642_0000830 | 3300053130 | Bacteria | 9013 |
| 613 | Ga0500559_0168859 | 3300053136 | Bacteria | 1029 |
| 614 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 615 | Ga0500568_0004709 | 3300053139 | Bacteria | 7238 |
| 616 | Ga0500624_000003 | 3300053157 | Bacteria | 253364 |
| 617 | Ga0500636_0009480 | 3300053177 | Bacteria | 5660 |
| 618 | Ga0500637_0000073 | 3300053178 | Bacteria | 35884 |
| 619 | Ga0500645_002663 | 3300053730 | Bacteria | 7780 |
| 620 | Ga0501084_0007919 | 3300054114 | Bacteria | 8746 |
| 621 | Ga0501084_0438181 | 3300054114 | Bacteria | 1105 |
| 622 | Ga0590071_006680 | 3300059421 | Bacteria | 2737 |
| 623 | Ga0501082_0088124 | 3300060353 | Bacteria | 2678 |
| 624 | Ga0466962_0001111 | 3300061719 | Bacteria | 12400 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044765 | Ga0466970_0195302 | Ga0466970_0195302_260_1114 | 260 |
| 2 | 3300049568 | Ga0501031_0329525 | Ga0501031_0329525_37_936 | 293 |
| 3 | 3300053136 | Ga0500559_0168859 | Ga0500559_0168859_109_1005 | 294 |
| 4 | 3300009545 | Ga0105237_10135815 | Ga0105237_101358152 | 315 |
| 5 | 3300009551 | Ga0105238_10191083 | Ga0105238_101910832 | 315 |
| 6 | 3300013104 | Ga0157370_10273238 | Ga0157370_102732382 | 315 |
| 7 | 3300013105 | Ga0157369_10173221 | Ga0157369_101732212 | 315 |
| 8 | 3300044842 | Ga0466957_0141996 | Ga0466957_0141996_471_1490 | 315 |
| 9 | 3300053139 | Ga0500568_0004709 | Ga0500568_0004709_4341_5300 | 315 |
| 10 | 3300005344 | Ga0070661_100008518 | Ga0070661_1000085185 | 316 |
| 11 | 3300005356 | Ga0070674_100053709 | Ga0070674_1000537092 | 316 |
| 12 | 3300005539 | Ga0068853_100031727 | Ga0068853_1000317273 | 316 |
| 13 | 3300005543 | Ga0070672_100025566 | Ga0070672_1000255664 | 316 |
| 14 | 3300006881 | Ga0068865_100129080 | Ga0068865_1001290801 | 316 |
| 15 | 3300009545 | Ga0105237_10427231 | Ga0105237_104272312 | 316 |
| 16 | 3300009551 | Ga0105238_10146325 | Ga0105238_101463252 | 316 |
| 17 | 3300010375 | Ga0105239_10040567 | Ga0105239_100405674 | 316 |
| 18 | 3300013104 | Ga0157370_10018947 | Ga0157370_100189479 | 316 |
| 19 | 3300013105 | Ga0157369_10067493 | Ga0157369_100674933 | 316 |
| 20 | 3300025940 | Ga0207691_10037589 | Ga0207691_100375891 | 316 |
| 21 | 3300025960 | Ga0207651_10064387 | Ga0207651_100643872 | 316 |
| 22 | 3300037471 | Ga0395905_0000108 | Ga0395905_0000108_57170_58126 | 316 |
| 23 | 3300037471 | Ga0395905_0051525 | Ga0395905_0051525_2292_3248 | 316 |
| 24 | 3300044656 | Ga0466969_0001813 | Ga0466969_0001813_6221_7177 | 316 |
| 25 | 3300044684 | Ga0466966_0000261 | Ga0466966_0000261_18879_19835 | 316 |
| 26 | 3300044719 | Ga0466971_0001002 | Ga0466971_0001002_4570_5526 | 316 |
| 27 | 3300044765 | Ga0466970_0004102 | Ga0466970_0004102_589_1545 | 316 |
| 28 | 3300044842 | Ga0466957_0003464 | Ga0466957_0003464_4485_5441 | 316 |
| 29 | 3300045049 | Ga0466959_0000155 | Ga0466959_0000155_32180_33136 | 316 |
| 30 | 3300045049 | Ga0466959_0082965 | Ga0466959_0082965_591_1547 | 316 |
| 31 | 3300045836 | Ga0466958_0005552 | Ga0466958_0005552_3760_4716 | 316 |
| 32 | 3300049571 | Ga0501034_0145554 | Ga0501034_0145554_1376_2332 | 316 |
| 33 | 3300049572 | Ga0501036_0129779 | Ga0501036_0129779_783_1751 | 316 |
| 34 | 3300049742 | Ga0501080_0062636 | Ga0501080_0062636_17_985 | 316 |
| 35 | 3300049742 | Ga0501080_0389956 | Ga0501080_0389956_200_1162 | 316 |
| 36 | 3300049822 | Ga0501035_0016301 | Ga0501035_0016301_5390_6349 | 316 |
| 37 | 3300049822 | Ga0501035_0235098 | Ga0501035_0235098_50_1006 | 316 |
| 38 | 3300049823 | Ga0501044_0072794 | Ga0501044_0072794_858_1817 | 316 |
| 39 | 3300049823 | Ga0501044_0081622 | Ga0501044_0081622_723_1685 | 316 |
| 40 | 3300061719 | Ga0466962_0001111 | Ga0466962_0001111_4190_5146 | 316 |
| 41 | 3300006847 | Ga0075431_100112935 | Ga0075431_1001129351 | 317 |
| 42 | 3300009093 | Ga0105240_10001363 | Ga0105240_1000136313 | 317 |
| 43 | 3300009147 | Ga0114129_10038874 | Ga0114129_100388745 | 317 |
| 44 | 3300009174 | Ga0105241_10018242 | Ga0105241_100182426 | 317 |
| 45 | 3300009545 | Ga0105237_10000746 | Ga0105237_100007469 | 317 |
| 46 | 3300010375 | Ga0105239_10010016 | Ga0105239_100100164 | 317 |
| 47 | 3300013100 | Ga0157373_10001483 | Ga0157373_1000148321 | 317 |
| 48 | 3300013104 | Ga0157370_10000753 | Ga0157370_1000075345 | 317 |
| 49 | 3300013105 | Ga0157369_10002018 | Ga0157369_1000201828 | 317 |
| 50 | 3300014325 | Ga0163163_10069761 | Ga0163163_100697613 | 317 |
| 51 | 3300014968 | Ga0157379_10002050 | Ga0157379_1000205018 | 317 |
| 52 | 3300025925 | Ga0207650_10074126 | Ga0207650_100741262 | 317 |
| 53 | 3300037853 | Ga0436364_0479880 | Ga0436364_0479880_66_1034 | 317 |
| 54 | 3300039437 | Ga0436365_1515960 | Ga0436365_1515960_54_1022 | 317 |
| 55 | 3300039453 | Ga0436362_1235945 | Ga0436362_1235945_847_1821 | 317 |
| 56 | 3300046507 | Ga0495606_0224367 | Ga0495606_0224367_18_974 | 317 |
| 57 | 3300046648 | Ga0495611_0035018 | Ga0495611_0035018_289_1245 | 317 |
| 58 | 3300046660 | Ga0495625_0009358 | Ga0495625_0009358_1240_2196 | 317 |
| 59 | 3300046684 | Ga0495669_0000628 | Ga0495669_0000628_958_1914 | 317 |
| 60 | 3300046694 | Ga0495649_0100773 | Ga0495649_0100773_168_1124 | 317 |
| 61 | 3300047323 | Ga0495683_0157615 | Ga0495683_0157615_35_991 | 317 |
| 62 | 3300047443 | Ga0495687_000152 | Ga0495687_000152_90452_91408 | 317 |
| 63 | 3300048905 | Ga0496102_0000010 | Ga0496102_0000010_99300_100262 | 317 |
| 64 | 3300048905 | Ga0496102_0296709 | Ga0496102_0296709_140_1102 | 317 |
| 65 | 3300048906 | Ga0496103_0000082 | Ga0496103_0000082_10838_11800 | 317 |
| 66 | 3300048907 | Ga0496104_0053857 | Ga0496104_0053857_2006_2968 | 317 |
| 67 | 3300048907 | Ga0496104_0185783 | Ga0496104_0185783_453_1415 | 317 |
| 68 | 3300048908 | Ga0496105_0190159 | Ga0496105_0190159_174_1136 | 317 |
| 69 | 3300048910 | Ga0496107_0189696 | Ga0496107_0189696_17_988 | 317 |
| 70 | 3300048911 | Ga0496108_0005359 | Ga0496108_0005359_1124_2086 | 317 |
| 71 | 3300048912 | Ga0496109_0001652 | Ga0496109_0001652_3784_4746 | 317 |
| 72 | 3300048913 | Ga0496110_0059985 | Ga0496110_0059985_1618_2580 | 317 |
| 73 | 3300048914 | Ga0496111_0081271 | Ga0496111_0081271_611_1573 | 317 |
| 74 | 3300048916 | Ga0496113_0051841 | Ga0496113_0051841_1211_2173 | 317 |
| 75 | 3300048917 | Ga0496114_0301064 | Ga0496114_0301064_356_1318 | 317 |
| 76 | 3300048919 | Ga0496116_0004459 | Ga0496116_0004459_10725_11687 | 317 |
| 77 | 3300048920 | Ga0496117_0000037 | Ga0496117_0000037_99890_100852 | 317 |
| 78 | 3300048921 | Ga0496118_0000034 | Ga0496118_0000034_97694_98656 | 317 |
| 79 | 3300048923 | Ga0496120_0016240 | Ga0496120_0016240_1259_2221 | 317 |
| 80 | 3300048927 | Ga0496124_0000033 | Ga0496124_0000033_97694_98656 | 317 |
| 81 | 3300049571 | Ga0501034_0051251 | Ga0501034_0051251_413_1378 | 317 |
| 82 | 3300049572 | Ga0501036_0233759 | Ga0501036_0233759_137_1102 | 317 |
| 83 | 3300049581 | Ga0501047_0008090 | Ga0501047_0008090_5232_6197 | 317 |
| 84 | 3300049583 | Ga0501067_0002385 | Ga0501067_0002385_296_1261 | 317 |
| 85 | 3300049586 | Ga0501070_0009504 | Ga0501070_0009504_292_1257 | 317 |
| 86 | 3300049589 | Ga0501073_0017379 | Ga0501073_0017379_409_1374 | 317 |
| 87 | 3300049590 | Ga0501074_0014761 | Ga0501074_0014761_880_1845 | 317 |
| 88 | 3300049741 | Ga0501079_0008105 | Ga0501079_0008105_6587_7552 | 317 |
| 89 | 3300049742 | Ga0501080_0015887 | Ga0501080_0015887_5444_6409 | 317 |
| 90 | 3300049822 | Ga0501035_0002157 | Ga0501035_0002157_11731_12696 | 317 |
| 91 | 3300049823 | Ga0501044_0010959 | Ga0501044_0010959_3431_4396 | 317 |
| 92 | 3300050507 | nmdc:mga05p37_124990_c1 | nmdc:mga05p37_124990_c1_2089_3051 | 317 |
| 93 | 3300050511 | nmdc:mga08y16_70447_c1 | nmdc:mga08y16_70447_c1_1194_2153 | 317 |
| 94 | 3300053079 | Ga0500610_0000101 | Ga0500610_0000101_21_977 | 317 |
| 95 | 3300053084 | Ga0495595_0047830 | Ga0495595_0047830_363_1325 | 317 |
| 96 | 3300053085 | Ga0495619_0088688 | Ga0495619_0088688_594_1556 | 317 |
| 97 | 3300053730 | Ga0500645_002663 | Ga0500645_002663_123_1079 | 317 |
| 98 | 3300054114 | Ga0501084_0007919 | Ga0501084_0007919_982_1947 | 317 |
| 99 | 3300006914 | Ga0075436_100306310 | Ga0075436_1003063101 | 318 |
| 100 | 3300007076 | Ga0075435_100019220 | Ga0075435_1000192203 | 318 |
| 101 | 3300035695 | Ga0373927_0015725 | Ga0373927_0015725_3319_4290 | 318 |
| 102 | 3300050512 | nmdc:mga0n895_127947_c1 | nmdc:mga0n895_127947_c1_1511_2485 | 318 |
| 103 | 3300050513 | nmdc:mga0rr50_35907_c1 | nmdc:mga0rr50_35907_c1_318_1292 | 318 |
| 104 | 3300053095 | Ga0500640_051667 | Ga0500640_051667_581_1543 | 318 |
| 105 | 3300031249 | Ga0265339_10099610 | Ga0265339_100996101 | 323 |
| 106 | 3300031712 | Ga0265342_10051682 | Ga0265342_100516822 | 323 |
| 107 | 3300042013 | Ga0439456_000012 | Ga0439456_000012_71194_72237 | 324 |
| 108 | iso_pu_bacteria | 2912963787 | 2912966696 | 328 |
| 109 | iso_pu_bacteria | 2939651529 | 2939655741 | 328 |
| 110 | iso_pu_bacteria | 8055878733 | 8055880397 | 328 |
| 111 | 3300009093 | Ga0105240_10282089 | Ga0105240_102820892 | 329 |
| 112 | 3300046507 | Ga0495606_0156780 | Ga0495606_0156780_188_1183 | 330 |
| 113 | 3300046558 | Ga0495633_0000494 | Ga0495633_0000494_1051_2046 | 330 |
| 114 | 3300046660 | Ga0495625_0167472 | Ga0495625_0167472_140_1135 | 330 |
| 115 | 3300046692 | Ga0495671_0093788 | Ga0495671_0093788_139_1134 | 330 |
| 116 | 3300005355 | Ga0070671_100010764 | Ga0070671_1000107642 | 331 |
| 117 | 3300009094 | Ga0111539_10001089 | Ga0111539_100010893 | 331 |
| 118 | 3300009147 | Ga0114129_10000062 | Ga0114129_1000006225 | 331 |
| 119 | 3300009148 | Ga0105243_10004582 | Ga0105243_1000458211 | 331 |
| 120 | 3300009176 | Ga0105242_10495002 | Ga0105242_104950021 | 331 |
| 121 | 3300025931 | Ga0207644_10006974 | Ga0207644_100069747 | 331 |
| 122 | 3300031595 | Ga0265313_10021851 | Ga0265313_100218512 | 331 |
| 123 | 3300046516 | Ga0495628_0016870 | Ga0495628_0016870_2766_3821 | 331 |
| 124 | 3300047471 | Ga0495684_0061653 | Ga0495684_0061653_143_1198 | 331 |
| 125 | 3300049587 | Ga0501071_0015263 | Ga0501071_0015263_2593_3612 | 331 |
| 126 | 3300050507 | nmdc:mga05p37_564_c1 | nmdc:mga05p37_564_c1_18458_19462 | 331 |
| 127 | 3300050508 | nmdc:mga09592_7130_c1 | nmdc:mga09592_7130_c1_1552_2556 | 331 |
| 128 | 3300050509 | nmdc:mga0qj67_192884_c1 | nmdc:mga0qj67_192884_c1_130_1134 | 331 |
| 129 | 3300050510 | nmdc:mga06r32_191_c1 | nmdc:mga06r32_191_c1_43788_44792 | 331 |
| 130 | 3300050511 | nmdc:mga08y16_89_c1 | nmdc:mga08y16_89_c1_58969_59973 | 331 |
| 131 | 3300005355 | Ga0070671_100002133 | Ga0070671_1000021338 | 332 |
| 132 | 3300005842 | Ga0068858_100000418 | Ga0068858_10000041819 | 332 |
| 133 | 3300009093 | Ga0105240_10196292 | Ga0105240_101962923 | 332 |
| 134 | 3300009147 | Ga0114129_10099120 | Ga0114129_100991202 | 332 |
| 135 | 3300009553 | Ga0105249_10010570 | Ga0105249_100105702 | 332 |
| 136 | 3300025900 | Ga0207710_10001601 | Ga0207710_100016019 | 332 |
| 137 | 3300025941 | Ga0207711_10163211 | Ga0207711_101632112 | 332 |
| 138 | 3300025961 | Ga0207712_10019682 | Ga0207712_100196822 | 332 |
| 139 | 3300025986 | Ga0207658_10056784 | Ga0207658_100567843 | 332 |
| 140 | 3300026035 | Ga0207703_10003927 | Ga0207703_100039278 | 332 |
| 141 | 3300026088 | Ga0207641_10064687 | Ga0207641_100646873 | 332 |
| 142 | 3300050507 | nmdc:mga05p37_190858_c1 | nmdc:mga05p37_190858_c1_1298_2311 | 332 |
| 143 | 3300050512 | nmdc:mga0n895_254365_c1 | nmdc:mga0n895_254365_c1_453_1466 | 332 |
| 144 | 3300014968 | Ga0157379_10013521 | Ga0157379_100135212 | 333 |
| 145 | 3300048929 | Ga0496126_0000463 | Ga0496126_0000463_49987_51006 | 334 |
| 146 | 3300021361 | Ga0213872_10008768 | Ga0213872_100087684 | 335 |
| 147 | 3300025920 | Ga0207649_10000016 | Ga0207649_10000016155 | 335 |
| 148 | 3300032005 | Ga0307411_10078968 | Ga0307411_100789682 | 335 |
| 149 | 3300039447 | Ga0436361_0163275 | Ga0436361_0163275_14210_15235 | 335 |
| 150 | iso_pu_bacteria | 2643221736 | 2644746485 | 335 |
| 151 | iso_pu_bacteria | 2739367756 | 2739792737 | 335 |
| 152 | 3300009101 | Ga0105247_10000267 | Ga0105247_1000026733 | 336 |
| 153 | 3300009177 | Ga0105248_10019052 | Ga0105248_100190525 | 336 |
| 154 | 3300013297 | Ga0157378_10085814 | Ga0157378_100858142 | 336 |
| 155 | 3300031250 | Ga0265331_10000067 | Ga0265331_1000006731 | 336 |
| 156 | 3300031711 | Ga0265314_10049117 | Ga0265314_100491172 | 336 |
| 157 | 3300035691 | Ga0373931_0004736 | Ga0373931_0004736_3377_4399 | 336 |
| 158 | 3300035692 | Ga0373935_0013458 | Ga0373935_0013458_1563_2585 | 336 |
| 159 | 3300044656 | Ga0466969_0136845 | Ga0466969_0136845_94_1122 | 336 |
| 160 | 3300044684 | Ga0466966_0108505 | Ga0466966_0108505_624_1652 | 336 |
| 161 | 3300045836 | Ga0466958_0117236 | Ga0466958_0117236_280_1308 | 336 |
| 162 | 3300048905 | Ga0496102_0088810 | Ga0496102_0088810_1066_2133 | 336 |
| 163 | 3300048914 | Ga0496111_0257477 | Ga0496111_0257477_86_1114 | 336 |
| 164 | 3300048922 | Ga0496119_0048681 | Ga0496119_0048681_1491_2558 | 336 |
| 165 | 3300048924 | Ga0496121_0018754 | Ga0496121_0018754_1121_2188 | 336 |
| 166 | 3300048928 | Ga0496125_0017934 | Ga0496125_0017934_4796_5863 | 336 |
| 167 | iso_pu_bacteria | 2643221629 | 2644164753 | 336 |
| 168 | iso_pu_bacteria | 2643221662 | 2644345975 | 336 |
| 169 | iso_pu_bacteria | 2841911363 | 2841912482 | 336 |
| 170 | iso_pu_bacteria | 2841917233 | 2841918237 | 336 |
| 171 | 3300003214 | JGI25165J46597_1000035 | JGI25165J46597_1000035136 | 337 |
| 172 | 3300005328 | Ga0070676_10017083 | Ga0070676_100170832 | 337 |
| 173 | 3300005338 | Ga0068868_100051809 | Ga0068868_1000518091 | 337 |
| 174 | 3300005535 | Ga0070684_100057818 | Ga0070684_1000578182 | 337 |
| 175 | 3300005563 | Ga0068855_100173168 | Ga0068855_1001731682 | 337 |
| 176 | 3300006881 | Ga0068865_100333935 | Ga0068865_1003339351 | 337 |
| 177 | 3300025924 | Ga0207694_10061427 | Ga0207694_100614273 | 337 |
| 178 | 3300025925 | Ga0207650_10205773 | Ga0207650_102057732 | 337 |
| 179 | 3300025949 | Ga0207667_10102808 | Ga0207667_101028083 | 337 |
| 180 | 3300046689 | Ga0495613_0006941 | Ga0495613_0006941_6866_7897 | 337 |
| 181 | 3300049571 | Ga0501034_0000286 | Ga0501034_0000286_49093_50115 | 337 |
| 182 | 3300049744 | Ga0501083_0052719 | Ga0501083_0052719_137_1159 | 337 |
| 183 | 3300049744 | Ga0501083_0186988 | Ga0501083_0186988_127_1149 | 337 |
| 184 | 3300050512 | nmdc:mga0n895_54746_c1 | nmdc:mga0n895_54746_c1_2297_3322 | 337 |
| 185 | 3300050513 | nmdc:mga0rr50_93255_c1 | nmdc:mga0rr50_93255_c1_238_1263 | 337 |
| 186 | 3300060353 | Ga0501082_0088124 | Ga0501082_0088124_51_1073 | 337 |
| 187 | 3300003320 | rootH2_10032630 | rootH2_100326302 | 338 |
| 188 | 3300003320 | rootH2_10047068 | rootH2_100470681 | 338 |
| 189 | 3300003322 | rootL2_10101751 | rootL2_101017514 | 338 |
| 190 | 3300003323 | rootH1_10037990 | rootH1_100379901 | 338 |
| 191 | 3300005344 | Ga0070661_100000254 | Ga0070661_1000002542 | 338 |
| 192 | 3300005535 | Ga0070684_100127310 | Ga0070684_1001273102 | 338 |
| 193 | 3300006846 | Ga0075430_100015106 | Ga0075430_1000151069 | 338 |
| 194 | 3300015684 | Ga0183365_10001 | Ga0183365_10001495 | 338 |
| 195 | 3300025920 | Ga0207649_10000026 | Ga0207649_1000002622 | 338 |
| 196 | 3300029957 | Ga0265324_10048288 | Ga0265324_100482881 | 338 |
| 197 | 3300031250 | Ga0265331_10000008 | Ga0265331_10000008144 | 338 |
| 198 | 3300031251 | Ga0265327_10000036 | Ga0265327_1000003624 | 338 |
| 199 | 3300039447 | Ga0436361_0765979 | Ga0436361_0765979_3195_4223 | 338 |
| 200 | 3300049570 | Ga0501033_0022975 | Ga0501033_0022975_1092_2129 | 338 |
| 201 | 3300049571 | Ga0501034_0008706 | Ga0501034_0008706_4189_5247 | 338 |
| 202 | 3300049573 | Ga0501037_0098885 | Ga0501037_0098885_267_1325 | 338 |
| 203 | 3300049574 | Ga0501038_0275980 | Ga0501038_0275980_113_1150 | 338 |
| 204 | 3300049580 | Ga0501046_0014467 | Ga0501046_0014467_4928_5965 | 338 |
| 205 | 3300049580 | Ga0501046_0299916 | Ga0501046_0299916_39_1076 | 338 |
| 206 | 3300049581 | Ga0501047_0110150 | Ga0501047_0110150_40_1077 | 338 |
| 207 | 3300049586 | Ga0501070_0070443 | Ga0501070_0070443_482_1519 | 338 |
| 208 | 3300049589 | Ga0501073_0013297 | Ga0501073_0013297_2028_3065 | 338 |
| 209 | 3300049822 | Ga0501035_0052277 | Ga0501035_0052277_322_1359 | 338 |
| 210 | 3300049823 | Ga0501044_0065211 | Ga0501044_0065211_1384_2442 | 338 |
| 211 | 3300050509 | nmdc:mga0qj67_445_c1 | nmdc:mga0qj67_445_c1_18397_19422 | 338 |
| 212 | 3300053117 | Ga0500593_000072 | Ga0500593_000072_14586_15617 | 338 |
| 213 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_218912_219943 | 338 |
| 214 | 3300005338 | Ga0068868_100121511 | Ga0068868_1001215113 | 339 |
| 215 | 3300005341 | Ga0070691_10000033 | Ga0070691_1000003339 | 339 |
| 216 | 3300005344 | Ga0070661_100172027 | Ga0070661_1001720271 | 339 |
| 217 | 3300005366 | Ga0070659_100033544 | Ga0070659_1000335443 | 339 |
| 218 | 3300005434 | Ga0070709_10000408 | Ga0070709_1000040820 | 339 |
| 219 | 3300005436 | Ga0070713_100000333 | Ga0070713_10000033325 | 339 |
| 220 | 3300005439 | Ga0070711_100072538 | Ga0070711_1000725381 | 339 |
| 221 | 3300005440 | Ga0070705_100053020 | Ga0070705_1000530201 | 339 |
| 222 | 3300005539 | Ga0068853_100001647 | Ga0068853_1000016472 | 339 |
| 223 | 3300005548 | Ga0070665_100215364 | Ga0070665_1002153642 | 339 |
| 224 | 3300005563 | Ga0068855_100262254 | Ga0068855_1002622542 | 339 |
| 225 | 3300005577 | Ga0068857_100001587 | Ga0068857_10000158719 | 339 |
| 226 | 3300005578 | Ga0068854_100047630 | Ga0068854_1000476302 | 339 |
| 227 | 3300005578 | Ga0068854_100262141 | Ga0068854_1002621412 | 339 |
| 228 | 3300005614 | Ga0068856_100001518 | Ga0068856_10000151824 | 339 |
| 229 | 3300005614 | Ga0068856_100031963 | Ga0068856_1000319633 | 339 |
| 230 | 3300005614 | Ga0068856_100050666 | Ga0068856_1000506665 | 339 |
| 231 | 3300005616 | Ga0068852_100023036 | Ga0068852_1000230366 | 339 |
| 232 | 3300005616 | Ga0068852_100059581 | Ga0068852_1000595814 | 339 |
| 233 | 3300005842 | Ga0068858_100009723 | Ga0068858_1000097239 | 339 |
| 234 | 3300005842 | Ga0068858_100207204 | Ga0068858_1002072042 | 339 |
| 235 | 3300006175 | Ga0070712_100000023 | Ga0070712_10000002357 | 339 |
| 236 | 3300006175 | Ga0070712_100000803 | Ga0070712_10000080319 | 339 |
| 237 | 3300006914 | Ga0075436_100000211 | Ga0075436_1000002116 | 339 |
| 238 | 3300007076 | Ga0075435_100243105 | Ga0075435_1002431052 | 339 |
| 239 | 3300009174 | Ga0105241_10027427 | Ga0105241_100274274 | 339 |
| 240 | 3300009551 | Ga0105238_10299226 | Ga0105238_102992262 | 339 |
| 241 | 3300010375 | Ga0105239_10069699 | Ga0105239_100696992 | 339 |
| 242 | 3300014968 | Ga0157379_10015138 | Ga0157379_100151389 | 339 |
| 243 | 3300014968 | Ga0157379_10035127 | Ga0157379_100351272 | 339 |
| 244 | 3300025906 | Ga0207699_10000280 | Ga0207699_1000028011 | 339 |
| 245 | 3300025909 | Ga0207705_10039852 | Ga0207705_100398522 | 339 |
| 246 | 3300025909 | Ga0207705_10044154 | Ga0207705_100441543 | 339 |
| 247 | 3300025912 | Ga0207707_10190318 | Ga0207707_101903181 | 339 |
| 248 | 3300025915 | Ga0207693_10000018 | Ga0207693_10000018120 | 339 |
| 249 | 3300025915 | Ga0207693_10000534 | Ga0207693_1000053419 | 339 |
| 250 | 3300025916 | Ga0207663_10011828 | Ga0207663_100118284 | 339 |
| 251 | 3300025916 | Ga0207663_10255552 | Ga0207663_102555522 | 339 |
| 252 | 3300025919 | Ga0207657_10037832 | Ga0207657_100378323 | 339 |
| 253 | 3300025920 | Ga0207649_10105962 | Ga0207649_101059622 | 339 |
| 254 | 3300025920 | Ga0207649_10129052 | Ga0207649_101290521 | 339 |
| 255 | 3300025924 | Ga0207694_10039727 | Ga0207694_100397272 | 339 |
| 256 | 3300025924 | Ga0207694_10117694 | Ga0207694_101176942 | 339 |
| 257 | 3300025928 | Ga0207700_10000026 | Ga0207700_1000002641 | 339 |
| 258 | 3300025949 | Ga0207667_10010243 | Ga0207667_100102434 | 339 |
| 259 | 3300025949 | Ga0207667_10192437 | Ga0207667_101924371 | 339 |
| 260 | 3300025981 | Ga0207640_10169283 | Ga0207640_101692832 | 339 |
| 261 | 3300026023 | Ga0207677_10465194 | Ga0207677_104651941 | 339 |
| 262 | 3300026035 | Ga0207703_10006685 | Ga0207703_100066859 | 339 |
| 263 | 3300026078 | Ga0207702_10000592 | Ga0207702_100005925 | 339 |
| 264 | 3300026078 | Ga0207702_10003947 | Ga0207702_1000394713 | 339 |
| 265 | 3300026078 | Ga0207702_10086962 | Ga0207702_100869624 | 339 |
| 266 | 3300026078 | Ga0207702_10094682 | Ga0207702_100946822 | 339 |
| 267 | 3300026116 | Ga0207674_10000134 | Ga0207674_1000013448 | 339 |
| 268 | 3300026116 | Ga0207674_10034643 | Ga0207674_100346433 | 339 |
| 269 | 3300026142 | Ga0207698_10013227 | Ga0207698_100132276 | 339 |
| 270 | 3300026142 | Ga0207698_10039343 | Ga0207698_100393432 | 339 |
| 271 | 3300028563 | Ga0265319_1033409 | Ga0265319_10334092 | 339 |
| 272 | 3300028577 | Ga0265318_10016634 | Ga0265318_100166343 | 339 |
| 273 | 3300031238 | Ga0265332_10056104 | Ga0265332_100561042 | 339 |
| 274 | 3300031241 | Ga0265325_10000365 | Ga0265325_1000036517 | 339 |
| 275 | 3300031249 | Ga0265339_10006412 | Ga0265339_100064128 | 339 |
| 276 | 3300031344 | Ga0265316_10013136 | Ga0265316_100131368 | 339 |
| 277 | 3300031595 | Ga0265313_10006830 | Ga0265313_100068302 | 339 |
| 278 | 3300035172 | Ga0373955_0119421 | Ga0373955_0119421_410_1444 | 339 |
| 279 | 3300036401 | Ga0373937_0023121 | Ga0373937_0023121_4008_5042 | 339 |
| 280 | 3300048910 | Ga0496107_0253421 | Ga0496107_0253421_49_1083 | 339 |
| 281 | 3300048914 | Ga0496111_0224106 | Ga0496111_0224106_175_1209 | 339 |
| 282 | 3300049568 | Ga0501031_0017718 | Ga0501031_0017718_1239_2270 | 339 |
| 283 | 3300049572 | Ga0501036_0278359 | Ga0501036_0278359_44_1072 | 339 |
| 284 | 3300049574 | Ga0501038_0131515 | Ga0501038_0131515_697_1725 | 339 |
| 285 | 3300049575 | Ga0501039_0022369 | Ga0501039_0022369_1239_2270 | 339 |
| 286 | 3300049581 | Ga0501047_0079020 | Ga0501047_0079020_695_1726 | 339 |
| 287 | 3300049742 | Ga0501080_0007490 | Ga0501080_0007490_1651_2685 | 339 |
| 288 | 3300049822 | Ga0501035_0165668 | Ga0501035_0165668_806_1834 | 339 |
| 289 | 3300050512 | nmdc:mga0n895_102394_c1 | nmdc:mga0n895_102394_c1_1756_2790 | 339 |
| 290 | 3300050513 | nmdc:mga0rr50_230908_c1 | nmdc:mga0rr50_230908_c1_397_1431 | 339 |
| 291 | 3300050514 | nmdc:mga08x19_54_c1 | nmdc:mga08x19_54_c1_84824_85858 | 339 |
| 292 | 3300053120 | Ga0500597_000402 | Ga0500597_000402_305_1330 | 339 |
| 293 | 3300053157 | Ga0500624_000003 | Ga0500624_000003_88140_89165 | 339 |
| 294 | 3300053178 | Ga0500637_0000073 | Ga0500637_0000073_2743_3768 | 339 |
| 295 | 3300006871 | Ga0075434_100367380 | Ga0075434_1003673802 | 340 |
| 296 | 3300025904 | Ga0207647_10173592 | Ga0207647_101735922 | 340 |
| 297 | 3300039438 | Ga0436360_0298857 | Ga0436360_0298857_3663_4736 | 340 |
| 298 | 3300039447 | Ga0436361_0606425 | Ga0436361_0606425_838_1911 | 340 |
| 299 | 3300059421 | Ga0590071_006680 | Ga0590071_006680_122_1159 | 340 |
| 300 | 3300005548 | Ga0070665_100011861 | Ga0070665_1000118616 | 341 |
| 301 | 3300005617 | Ga0068859_100018002 | Ga0068859_10001800211 | 341 |
| 302 | 3300005719 | Ga0068861_100368274 | Ga0068861_1003682741 | 341 |
| 303 | 3300006871 | Ga0075434_100048864 | Ga0075434_1000488643 | 341 |
| 304 | 3300021358 | Ga0213873_10000216 | Ga0213873_100002163 | 341 |
| 305 | 3300021384 | Ga0213876_10000056 | Ga0213876_10000056140 | 341 |
| 306 | 3300021384 | Ga0213876_10000258 | Ga0213876_1000025841 | 341 |
| 307 | 3300026118 | Ga0207675_100293639 | Ga0207675_1002936393 | 341 |
| 308 | 3300028381 | Ga0268264_10028296 | Ga0268264_100282964 | 341 |
| 309 | 3300039437 | Ga0436365_0083543 | Ga0436365_0083543_2056_3081 | 341 |
| 310 | 3300039437 | Ga0436365_0456925 | Ga0436365_0456925_4498_5523 | 341 |
| 311 | 3300039453 | Ga0436362_1001952 | Ga0436362_1001952_2063_3088 | 341 |
| 312 | 3300050512 | nmdc:mga0n895_98404_c1 | nmdc:mga0n895_98404_c1_1094_2119 | 341 |
| 313 | 3300005330 | Ga0070690_100000690 | Ga0070690_1000006907 | 342 |
| 314 | 3300005331 | Ga0070670_100003735 | Ga0070670_10000373515 | 342 |
| 315 | 3300005334 | Ga0068869_100066800 | Ga0068869_1000668001 | 342 |
| 316 | 3300005335 | Ga0070666_10000975 | Ga0070666_100009755 | 342 |
| 317 | 3300005337 | Ga0070682_100000564 | Ga0070682_10000056410 | 342 |
| 318 | 3300005338 | Ga0068868_100003140 | Ga0068868_10000314011 | 342 |
| 319 | 3300005339 | Ga0070660_100000165 | Ga0070660_10000016523 | 342 |
| 320 | 3300005340 | Ga0070689_100000246 | Ga0070689_10000024624 | 342 |
| 321 | 3300005341 | Ga0070691_10011597 | Ga0070691_100115973 | 342 |
| 322 | 3300005343 | Ga0070687_100000312 | Ga0070687_10000031213 | 342 |
| 323 | 3300005344 | Ga0070661_100001432 | Ga0070661_1000014324 | 342 |
| 324 | 3300005345 | Ga0070692_10009631 | Ga0070692_100096314 | 342 |
| 325 | 3300005347 | Ga0070668_100006205 | Ga0070668_1000062057 | 342 |
| 326 | 3300005354 | Ga0070675_100000971 | Ga0070675_10000097124 | 342 |
| 327 | 3300005356 | Ga0070674_100005136 | Ga0070674_1000051363 | 342 |
| 328 | 3300005364 | Ga0070673_100003617 | Ga0070673_10000361710 | 342 |
| 329 | 3300005365 | Ga0070688_100000574 | Ga0070688_10000057421 | 342 |
| 330 | 3300005366 | Ga0070659_100058602 | Ga0070659_1000586022 | 342 |
| 331 | 3300005406 | Ga0070703_10003711 | Ga0070703_100037114 | 342 |
| 332 | 3300005435 | Ga0070714_100005811 | Ga0070714_1000058116 | 342 |
| 333 | 3300005436 | Ga0070713_100312760 | Ga0070713_1003127602 | 342 |
| 334 | 3300005437 | Ga0070710_10080590 | Ga0070710_100805901 | 342 |
| 335 | 3300005438 | Ga0070701_10001677 | Ga0070701_100016777 | 342 |
| 336 | 3300005439 | Ga0070711_100009937 | Ga0070711_1000099375 | 342 |
| 337 | 3300005441 | Ga0070700_100000481 | Ga0070700_10000048117 | 342 |
| 338 | 3300005444 | Ga0070694_100001363 | Ga0070694_1000013634 | 342 |
| 339 | 3300005455 | Ga0070663_100000282 | Ga0070663_1000002829 | 342 |
| 340 | 3300005456 | Ga0070678_100003280 | Ga0070678_10000328010 | 342 |
| 341 | 3300005457 | Ga0070662_100012028 | Ga0070662_1000120285 | 342 |
| 342 | 3300005466 | Ga0070685_10014004 | Ga0070685_100140044 | 342 |
| 343 | 3300005518 | Ga0070699_100068566 | Ga0070699_1000685664 | 342 |
| 344 | 3300005530 | Ga0070679_100045870 | Ga0070679_1000458702 | 342 |
| 345 | 3300005536 | Ga0070697_100005504 | Ga0070697_10000550411 | 342 |
| 346 | 3300005543 | Ga0070672_100010669 | Ga0070672_1000106692 | 342 |
| 347 | 3300005544 | Ga0070686_100002667 | Ga0070686_1000026678 | 342 |
| 348 | 3300005545 | Ga0070695_100071581 | Ga0070695_1000715813 | 342 |
| 349 | 3300005546 | Ga0070696_100005997 | Ga0070696_1000059975 | 342 |
| 350 | 3300005547 | Ga0070693_100000877 | Ga0070693_10000087710 | 342 |
| 351 | 3300005549 | Ga0070704_100000285 | Ga0070704_1000002853 | 342 |
| 352 | 3300005563 | Ga0068855_100030880 | Ga0068855_1000308803 | 342 |
| 353 | 3300005564 | Ga0070664_100003522 | Ga0070664_10000352210 | 342 |
| 354 | 3300005577 | Ga0068857_100006351 | Ga0068857_10000635111 | 342 |
| 355 | 3300005578 | Ga0068854_100000765 | Ga0068854_1000007657 | 342 |
| 356 | 3300005614 | Ga0068856_100001586 | Ga0068856_10000158620 | 342 |
| 357 | 3300005615 | Ga0070702_100001487 | Ga0070702_1000014877 | 342 |
| 358 | 3300005617 | Ga0068859_100064866 | Ga0068859_1000648666 | 342 |
| 359 | 3300005618 | Ga0068864_100006600 | Ga0068864_1000066006 | 342 |
| 360 | 3300005718 | Ga0068866_10027542 | Ga0068866_100275423 | 342 |
| 361 | 3300005719 | Ga0068861_100045965 | Ga0068861_1000459653 | 342 |
| 362 | 3300005834 | Ga0068851_10087373 | Ga0068851_100873732 | 342 |
| 363 | 3300005841 | Ga0068863_100000964 | Ga0068863_1000009649 | 342 |
| 364 | 3300005841 | Ga0068863_100285650 | Ga0068863_1002856502 | 342 |
| 365 | 3300005842 | Ga0068858_100013968 | Ga0068858_1000139688 | 342 |
| 366 | 3300005844 | Ga0068862_100000734 | Ga0068862_10000073421 | 342 |
| 367 | 3300006163 | Ga0070715_10000723 | Ga0070715_100007233 | 342 |
| 368 | 3300006173 | Ga0070716_100000247 | Ga0070716_10000024711 | 342 |
| 369 | 3300006175 | Ga0070712_100001127 | Ga0070712_1000011275 | 342 |
| 370 | 3300006237 | Ga0097621_100008931 | Ga0097621_1000089314 | 342 |
| 371 | 3300006358 | Ga0068871_100045364 | Ga0068871_1000453643 | 342 |
| 372 | 3300006844 | Ga0075428_100000606 | Ga0075428_1000006062 | 342 |
| 373 | 3300006847 | Ga0075431_100000032 | Ga0075431_10000003252 | 342 |
| 374 | 3300006847 | Ga0075431_100003366 | Ga0075431_10000336616 | 342 |
| 375 | 3300006852 | Ga0075433_10126003 | Ga0075433_101260031 | 342 |
| 376 | 3300006871 | Ga0075434_100121785 | Ga0075434_1001217851 | 342 |
| 377 | 3300006880 | Ga0075429_100008370 | Ga0075429_1000083703 | 342 |
| 378 | 3300006881 | Ga0068865_100002428 | Ga0068865_10000242811 | 342 |
| 379 | 3300006914 | Ga0075436_100001146 | Ga0075436_10000114611 | 342 |
| 380 | 3300006931 | Ga0097620_100064871 | Ga0097620_1000648716 | 342 |
| 381 | 3300009098 | Ga0105245_10001371 | Ga0105245_1000137128 | 342 |
| 382 | 3300009101 | Ga0105247_10000490 | Ga0105247_1000049015 | 342 |
| 383 | 3300009148 | Ga0105243_10012302 | Ga0105243_100123026 | 342 |
| 384 | 3300009174 | Ga0105241_10004507 | Ga0105241_100045075 | 342 |
| 385 | 3300009177 | Ga0105248_10000546 | Ga0105248_1000054656 | 342 |
| 386 | 3300009551 | Ga0105238_10064606 | Ga0105238_100646063 | 342 |
| 387 | 3300010375 | Ga0105239_10014493 | Ga0105239_100144934 | 342 |
| 388 | 3300011119 | Ga0105246_10000573 | Ga0105246_1000057322 | 342 |
| 389 | 3300013100 | Ga0157373_10002592 | Ga0157373_100025926 | 342 |
| 390 | 3300013102 | Ga0157371_10052012 | Ga0157371_100520122 | 342 |
| 391 | 3300013105 | Ga0157369_10001029 | Ga0157369_100010299 | 342 |
| 392 | 3300013307 | Ga0157372_10002818 | Ga0157372_1000281823 | 342 |
| 393 | 3300013308 | Ga0157375_10032115 | Ga0157375_100321153 | 342 |
| 394 | 3300014325 | Ga0163163_10018194 | Ga0163163_100181946 | 342 |
| 395 | 3300014745 | Ga0157377_10002609 | Ga0157377_100026093 | 342 |
| 396 | 3300014968 | Ga0157379_10001147 | Ga0157379_100011472 | 342 |
| 397 | 3300014969 | Ga0157376_10024439 | Ga0157376_100244395 | 342 |
| 398 | 3300025899 | Ga0207642_10082837 | Ga0207642_100828372 | 342 |
| 399 | 3300025901 | Ga0207688_10000468 | Ga0207688_1000046811 | 342 |
| 400 | 3300025903 | Ga0207680_10127066 | Ga0207680_101270661 | 342 |
| 401 | 3300025904 | Ga0207647_10002881 | Ga0207647_100028815 | 342 |
| 402 | 3300025906 | Ga0207699_10018169 | Ga0207699_100181692 | 342 |
| 403 | 3300025915 | Ga0207693_10000267 | Ga0207693_1000026727 | 342 |
| 404 | 3300025916 | Ga0207663_10000947 | Ga0207663_1000094711 | 342 |
| 405 | 3300025918 | Ga0207662_10000454 | Ga0207662_1000045411 | 342 |
| 406 | 3300025919 | Ga0207657_10000170 | Ga0207657_1000017046 | 342 |
| 407 | 3300025920 | Ga0207649_10032359 | Ga0207649_100323591 | 342 |
| 408 | 3300025921 | Ga0207652_10008354 | Ga0207652_100083542 | 342 |
| 409 | 3300025923 | Ga0207681_10237794 | Ga0207681_102377941 | 342 |
| 410 | 3300025924 | Ga0207694_10034592 | Ga0207694_100345923 | 342 |
| 411 | 3300025927 | Ga0207687_10018502 | Ga0207687_100185025 | 342 |
| 412 | 3300025931 | Ga0207644_10008396 | Ga0207644_100083963 | 342 |
| 413 | 3300025932 | Ga0207690_10002244 | Ga0207690_1000224414 | 342 |
| 414 | 3300025933 | Ga0207706_10000421 | Ga0207706_1000042115 | 342 |
| 415 | 3300025934 | Ga0207686_10003249 | Ga0207686_1000324910 | 342 |
| 416 | 3300025935 | Ga0207709_10110538 | Ga0207709_101105382 | 342 |
| 417 | 3300025936 | Ga0207670_10012918 | Ga0207670_100129183 | 342 |
| 418 | 3300025937 | Ga0207669_10014939 | Ga0207669_100149394 | 342 |
| 419 | 3300025938 | Ga0207704_10013657 | Ga0207704_100136575 | 342 |
| 420 | 3300025939 | Ga0207665_10000696 | Ga0207665_100006965 | 342 |
| 421 | 3300025940 | Ga0207691_10019645 | Ga0207691_100196458 | 342 |
| 422 | 3300025941 | Ga0207711_10037179 | Ga0207711_100371793 | 342 |
| 423 | 3300025942 | Ga0207689_10210012 | Ga0207689_102100121 | 342 |
| 424 | 3300025945 | Ga0207679_10143335 | Ga0207679_101433351 | 342 |
| 425 | 3300025949 | Ga0207667_10015513 | Ga0207667_100155138 | 342 |
| 426 | 3300025960 | Ga0207651_10022299 | Ga0207651_100222994 | 342 |
| 427 | 3300025961 | Ga0207712_10007229 | Ga0207712_100072294 | 342 |
| 428 | 3300025972 | Ga0207668_10001754 | Ga0207668_100017543 | 342 |
| 429 | 3300026023 | Ga0207677_10020778 | Ga0207677_100207781 | 342 |
| 430 | 3300026067 | Ga0207678_10000210 | Ga0207678_1000021034 | 342 |
| 431 | 3300026078 | Ga0207702_10040468 | Ga0207702_100404683 | 342 |
| 432 | 3300026088 | Ga0207641_10002237 | Ga0207641_1000223713 | 342 |
| 433 | 3300026088 | Ga0207641_10055921 | Ga0207641_100559214 | 342 |
| 434 | 3300026095 | Ga0207676_10013348 | Ga0207676_100133482 | 342 |
| 435 | 3300026116 | Ga0207674_10001169 | Ga0207674_100011693 | 342 |
| 436 | 3300026118 | Ga0207675_100000311 | Ga0207675_10000031134 | 342 |
| 437 | 3300026121 | Ga0207683_10000192 | Ga0207683_1000019226 | 342 |
| 438 | 3300028380 | Ga0268265_10010125 | Ga0268265_100101257 | 342 |
| 439 | 3300031250 | Ga0265331_10024816 | Ga0265331_100248163 | 342 |
| 440 | 3300031711 | Ga0265314_10002746 | Ga0265314_100027468 | 342 |
| 441 | 3300035092 | Ga0373952_0012269 | Ga0373952_0012269_12_1061 | 342 |
| 442 | 3300035114 | Ga0373939_0010689 | Ga0373939_0010689_433_1482 | 342 |
| 443 | 3300035207 | Ga0373942_0015942 | Ga0373942_0015942_253_1302 | 342 |
| 444 | 3300035691 | Ga0373931_0007222 | Ga0373931_0007222_3657_4706 | 342 |
| 445 | 3300037418 | Ga0395900_0024597 | Ga0395900_0024597_3653_4702 | 342 |
| 446 | 3300037466 | Ga0395898_0011788 | Ga0395898_0011788_5072_6121 | 342 |
| 447 | 3300037471 | Ga0395905_0001746 | Ga0395905_0001746_21138_22187 | 342 |
| 448 | 3300038443 | Ga0395901_0029521 | Ga0395901_0029521_4571_5620 | 342 |
| 449 | 3300041441 | Ga0451787_345757 | Ga0451787_345757_73_1101 | 342 |
| 450 | 3300048903 | Ga0496100_0011653 | Ga0496100_0011653_1973_3022 | 342 |
| 451 | 3300048904 | Ga0496101_0031856 | Ga0496101_0031856_1919_2968 | 342 |
| 452 | 3300048905 | Ga0496102_0336537 | Ga0496102_0336537_282_1331 | 342 |
| 453 | 3300048906 | Ga0496103_0024985 | Ga0496103_0024985_2047_3096 | 342 |
| 454 | 3300048907 | Ga0496104_0037107 | Ga0496104_0037107_1519_2568 | 342 |
| 455 | 3300048908 | Ga0496105_0046110 | Ga0496105_0046110_630_1679 | 342 |
| 456 | 3300048909 | Ga0496106_0056041 | Ga0496106_0056041_1208_2257 | 342 |
| 457 | 3300048910 | Ga0496107_0019441 | Ga0496107_0019441_512_1561 | 342 |
| 458 | 3300048913 | Ga0496110_0197855 | Ga0496110_0197855_512_1561 | 342 |
| 459 | 3300048914 | Ga0496111_0041330 | Ga0496111_0041330_1519_2568 | 342 |
| 460 | 3300048915 | Ga0496112_0069480 | Ga0496112_0069480_1919_2968 | 342 |
| 461 | 3300048916 | Ga0496113_0007975 | Ga0496113_0007975_2581_3630 | 342 |
| 462 | 3300048917 | Ga0496114_0002662 | Ga0496114_0002662_3128_4177 | 342 |
| 463 | 3300048917 | Ga0496114_0016017 | Ga0496114_0016017_3998_5029 | 342 |
| 464 | 3300048918 | Ga0496115_0041710 | Ga0496115_0041710_1086_2135 | 342 |
| 465 | 3300050512 | nmdc:mga0n895_37597_c1 | nmdc:mga0n895_37597_c1_1193_2242 | 342 |
| 466 | 3300050513 | nmdc:mga0rr50_139249_c1 | nmdc:mga0rr50_139249_c1_90_1139 | 342 |
| 467 | 3300050515 | nmdc:mga0a205_13445_c1 | nmdc:mga0a205_13445_c1_4053_5102 | 342 |
| 468 | 3300053177 | Ga0500636_0009480 | Ga0500636_0009480_3700_4731 | 342 |
| 469 | 3300005337 | Ga0070682_100085548 | Ga0070682_1000855483 | 343 |
| 470 | 3300005455 | Ga0070663_100020507 | Ga0070663_1000205074 | 343 |
| 471 | 3300005458 | Ga0070681_10083693 | Ga0070681_100836932 | 343 |
| 472 | 3300005547 | Ga0070693_100048717 | Ga0070693_1000487173 | 343 |
| 473 | 3300005615 | Ga0070702_100256000 | Ga0070702_1002560001 | 343 |
| 474 | 3300013297 | Ga0157378_10325268 | Ga0157378_103252681 | 343 |
| 475 | 3300013307 | Ga0157372_10419041 | Ga0157372_104190411 | 343 |
| 476 | 3300013308 | Ga0157375_10412256 | Ga0157375_104122561 | 343 |
| 477 | 3300026067 | Ga0207678_10118717 | Ga0207678_101187172 | 343 |
| 478 | 3300027876 | Ga0209974_10011378 | Ga0209974_100113782 | 343 |
| 479 | 3300044842 | Ga0466957_0049582 | Ga0466957_0049582_99_1130 | 343 |
| 480 | 3300048910 | Ga0496107_0118510 | Ga0496107_0118510_622_1674 | 343 |
| 481 | 3300048918 | Ga0496115_0047342 | Ga0496115_0047342_644_1696 | 343 |
| 482 | 3300031235 | Ga0265330_10114450 | Ga0265330_101144501 | 344 |
| 483 | 3300049571 | Ga0501034_0008957 | Ga0501034_0008957_8590_9660 | 344 |
| 484 | 3300049823 | Ga0501044_0047773 | Ga0501044_0047773_2298_3368 | 344 |
| 485 | 3300054114 | Ga0501084_0438181 | Ga0501084_0438181_49_1095 | 344 |
| 486 | 3300025735 | Ga0207713_1024811 | Ga0207713_10248111 | 345 |
| 487 | 3300025913 | Ga0207695_10051375 | Ga0207695_100513753 | 345 |
| 488 | 3300001979 | JGI24740J21852_10003772 | JGI24740J21852_100037727 | 346 |
| 489 | 3300001990 | JGI24737J22298_10002929 | JGI24737J22298_100029292 | 346 |
| 490 | 3300003215 | JGI25153J46596_10001130 | JGI25153J46596_1000113019 | 346 |
| 491 | 3300003759 | Ga0055525_1000118 | Ga0055525_100011862 | 346 |
| 492 | 3300003762 | Ga0055542_1000076 | Ga0055542_100007631 | 346 |
| 493 | 3300003763 | Ga0055529_1000004 | Ga0055529_1000004113 | 346 |
| 494 | 3300005327 | Ga0070658_10115022 | Ga0070658_101150222 | 346 |
| 495 | 3300005331 | Ga0070670_100187560 | Ga0070670_1001875601 | 346 |
| 496 | 3300005356 | Ga0070674_100139041 | Ga0070674_1001390411 | 346 |
| 497 | 3300005367 | Ga0070667_100040302 | Ga0070667_1000403023 | 346 |
| 498 | 3300005455 | Ga0070663_100108502 | Ga0070663_1001085022 | 346 |
| 499 | 3300005456 | Ga0070678_100010458 | Ga0070678_1000104583 | 346 |
| 500 | 3300005457 | Ga0070662_100267714 | Ga0070662_1002677141 | 346 |
| 501 | 3300005543 | Ga0070672_100059310 | Ga0070672_1000593102 | 346 |
| 502 | 3300005548 | Ga0070665_100000043 | Ga0070665_100000043278 | 346 |
| 503 | 3300005548 | Ga0070665_100373194 | Ga0070665_1003731941 | 346 |
| 504 | 3300005564 | Ga0070664_100063592 | Ga0070664_1000635922 | 346 |
| 505 | 3300005617 | Ga0068859_100250946 | Ga0068859_1002509462 | 346 |
| 506 | 3300005834 | Ga0068851_10097427 | Ga0068851_100974271 | 346 |
| 507 | 3300006186 | Ga0075369_10024851 | Ga0075369_100248511 | 346 |
| 508 | 3300006195 | Ga0075366_10042391 | Ga0075366_100423911 | 346 |
| 509 | 3300006358 | Ga0068871_100071010 | Ga0068871_1000710102 | 346 |
| 510 | 3300009148 | Ga0105243_10000490 | Ga0105243_1000049020 | 346 |
| 511 | 3300009174 | Ga0105241_10006458 | Ga0105241_1000645812 | 346 |
| 512 | 3300009545 | Ga0105237_10240008 | Ga0105237_102400082 | 346 |
| 513 | 3300009551 | Ga0105238_10214035 | Ga0105238_102140352 | 346 |
| 514 | 3300010375 | Ga0105239_10570602 | Ga0105239_105706021 | 346 |
| 515 | 3300012506 | Ga0157324_1000358 | Ga0157324_10003583 | 346 |
| 516 | 3300013100 | Ga0157373_10093369 | Ga0157373_100933692 | 346 |
| 517 | 3300013102 | Ga0157371_10000062 | Ga0157371_1000006280 | 346 |
| 518 | 3300013105 | Ga0157369_10420092 | Ga0157369_104200922 | 346 |
| 519 | 3300013307 | Ga0157372_10419686 | Ga0157372_104196861 | 346 |
| 520 | 3300025230 | Ga0209563_100070 | Ga0209563_10007061 | 346 |
| 521 | 3300025246 | Ga0209646_1009815 | Ga0209646_10098152 | 346 |
| 522 | 3300025254 | Ga0209148_1000008 | Ga0209148_1000008605 | 346 |
| 523 | 3300025261 | Ga0209233_1032486 | Ga0209233_10324861 | 346 |
| 524 | 3300025272 | Ga0209455_1000002 | Ga0209455_1000002819 | 346 |
| 525 | 3300025297 | Ga0209758_1000007 | Ga0209758_1000007720 | 346 |
| 526 | 3300025321 | Ga0207656_10000493 | Ga0207656_100004933 | 346 |
| 527 | 3300025907 | Ga0207645_10201891 | Ga0207645_102018911 | 346 |
| 528 | 3300025911 | Ga0207654_10000226 | Ga0207654_1000022612 | 346 |
| 529 | 3300025913 | Ga0207695_10016920 | Ga0207695_100169203 | 346 |
| 530 | 3300025914 | Ga0207671_10032982 | Ga0207671_100329822 | 346 |
| 531 | 3300025919 | Ga0207657_10009722 | Ga0207657_100097223 | 346 |
| 532 | 3300025920 | Ga0207649_10011028 | Ga0207649_100110286 | 346 |
| 533 | 3300025924 | Ga0207694_10027016 | Ga0207694_100270163 | 346 |
| 534 | 3300025925 | Ga0207650_10031979 | Ga0207650_100319791 | 346 |
| 535 | 3300025932 | Ga0207690_10003226 | Ga0207690_100032263 | 346 |
| 536 | 3300025933 | Ga0207706_10084929 | Ga0207706_100849293 | 346 |
| 537 | 3300025935 | Ga0207709_10000005 | Ga0207709_10000005580 | 346 |
| 538 | 3300025937 | Ga0207669_10005383 | Ga0207669_100053836 | 346 |
| 539 | 3300025940 | Ga0207691_10044642 | Ga0207691_100446424 | 346 |
| 540 | 3300025945 | Ga0207679_10025050 | Ga0207679_100250503 | 346 |
| 541 | 3300025949 | Ga0207667_10000001 | Ga0207667_100000011099 | 346 |
| 542 | 3300025949 | Ga0207667_10009832 | Ga0207667_1000983212 | 346 |
| 543 | 3300025981 | Ga0207640_10002461 | Ga0207640_100024613 | 346 |
| 544 | 3300025986 | Ga0207658_10018107 | Ga0207658_100181074 | 346 |
| 545 | 3300026041 | Ga0207639_10007127 | Ga0207639_100071278 | 346 |
| 546 | 3300026067 | Ga0207678_10007090 | Ga0207678_1000709012 | 346 |
| 547 | 3300026078 | Ga0207702_10000862 | Ga0207702_1000086214 | 346 |
| 548 | 3300026116 | Ga0207674_10013140 | Ga0207674_100131403 | 346 |
| 549 | 3300026121 | Ga0207683_10002482 | Ga0207683_100024826 | 346 |
| 550 | 3300026121 | Ga0207683_10355248 | Ga0207683_103552482 | 346 |
| 551 | 3300026142 | Ga0207698_10001942 | Ga0207698_1000194214 | 346 |
| 552 | 3300028379 | Ga0268266_10000002 | Ga0268266_10000002314 | 346 |
| 553 | 3300028379 | Ga0268266_10036274 | Ga0268266_100362744 | 346 |
| 554 | 3300028786 | Ga0307517_10012984 | Ga0307517_1001298412 | 346 |
| 555 | 3300028786 | Ga0307517_10052987 | Ga0307517_100529873 | 346 |
| 556 | 3300031456 | Ga0307513_10080372 | Ga0307513_100803722 | 346 |
| 557 | 3300037312 | Ga0395899_0169452 | Ga0395899_0169452_454_1497 | 346 |
| 558 | 3300037471 | Ga0395905_0492486 | Ga0395905_0492486_12_1055 | 346 |
| 559 | 3300046459 | Ga0495629_0020819 | Ga0495629_0020819_1907_2950 | 346 |
| 560 | 3300046471 | Ga0495650_0012193 | Ga0495650_0012193_854_1897 | 346 |
| 561 | 3300046491 | Ga0495584_0133840 | Ga0495584_0133840_76_1119 | 346 |
| 562 | 3300046492 | Ga0495585_0019768 | Ga0495585_0019768_1924_2967 | 346 |
| 563 | 3300046492 | Ga0495585_0096486 | Ga0495585_0096486_158_1201 | 346 |
| 564 | 3300046506 | Ga0495583_0051520 | Ga0495583_0051520_482_1525 | 346 |
| 565 | 3300046507 | Ga0495606_0002116 | Ga0495606_0002116_19917_20960 | 346 |
| 566 | 3300046520 | Ga0495637_0012078 | Ga0495637_0012078_472_1515 | 346 |
| 567 | 3300046522 | Ga0495643_0001994 | Ga0495643_0001994_8649_9692 | 346 |
| 568 | 3300046524 | Ga0495648_0000323 | Ga0495648_0000323_27495_28538 | 346 |
| 569 | 3300046525 | Ga0495663_0008715 | Ga0495663_0008715_353_1396 | 346 |
| 570 | 3300046528 | Ga0495642_0011218 | Ga0495642_0011218_1125_2168 | 346 |
| 571 | 3300046536 | Ga0495587_0040230 | Ga0495587_0040230_939_1982 | 346 |
| 572 | 3300046542 | Ga0495597_0089462 | Ga0495597_0089462_108_1151 | 346 |
| 573 | 3300046557 | Ga0495622_0012236 | Ga0495622_0012236_1105_2148 | 346 |
| 574 | 3300046616 | Ga0495668_0000059 | Ga0495668_0000059_146423_147466 | 346 |
| 575 | 3300046648 | Ga0495611_0051772 | Ga0495611_0051772_104_1147 | 346 |
| 576 | 3300046648 | Ga0495611_0121531 | Ga0495611_0121531_122_1165 | 346 |
| 577 | 3300046660 | Ga0495625_0000559 | Ga0495625_0000559_43248_44291 | 346 |
| 578 | 3300046660 | Ga0495625_0093589 | Ga0495625_0093589_71_1114 | 346 |
| 579 | 3300046680 | Ga0495646_0114196 | Ga0495646_0114196_367_1410 | 346 |
| 580 | 3300046689 | Ga0495613_0254987 | Ga0495613_0254987_150_1193 | 346 |
| 581 | 3300046691 | Ga0495670_0099123 | Ga0495670_0099123_159_1202 | 346 |
| 582 | 3300046694 | Ga0495649_0033503 | Ga0495649_0033503_1036_2079 | 346 |
| 583 | 3300046809 | Ga0495600_0006647 | Ga0495600_0006647_1887_2930 | 346 |
| 584 | 3300047323 | Ga0495683_0047147 | Ga0495683_0047147_937_1980 | 346 |
| 585 | 3300047323 | Ga0495683_0069502 | Ga0495683_0069502_134_1177 | 346 |
| 586 | 3300047443 | Ga0495687_000517 | Ga0495687_000517_1157_2200 | 346 |
| 587 | 3300047445 | Ga0495677_0009651 | Ga0495677_0009651_1263_2306 | 346 |
| 588 | 3300047469 | Ga0495673_0044873 | Ga0495673_0044873_92_1135 | 346 |
| 589 | 3300047470 | Ga0495681_0006423 | Ga0495681_0006423_1113_2156 | 346 |
| 590 | 3300047472 | Ga0495686_0000209 | Ga0495686_0000209_48759_49802 | 346 |
| 591 | 3300048905 | Ga0496102_0000184 | Ga0496102_0000184_81531_82574 | 346 |
| 592 | 3300048906 | Ga0496103_0000099 | Ga0496103_0000099_1327_2370 | 346 |
| 593 | 3300048907 | Ga0496104_0002902 | Ga0496104_0002902_952_1995 | 346 |
| 594 | 3300048908 | Ga0496105_0000589 | Ga0496105_0000589_21930_22973 | 346 |
| 595 | 3300048913 | Ga0496110_0080817 | Ga0496110_0080817_925_1968 | 346 |
| 596 | 3300048916 | Ga0496113_0059974 | Ga0496113_0059974_1637_2680 | 346 |
| 597 | 3300048918 | Ga0496115_0000066 | Ga0496115_0000066_91632_92675 | 346 |
| 598 | 3300048919 | Ga0496116_0020607 | Ga0496116_0020607_126_1169 | 346 |
| 599 | 3300048920 | Ga0496117_0001024 | Ga0496117_0001024_1657_2700 | 346 |
| 600 | 3300048921 | Ga0496118_0000154 | Ga0496118_0000154_78216_79259 | 346 |
| 601 | 3300048922 | Ga0496119_0036254 | Ga0496119_0036254_438_1481 | 346 |
| 602 | 3300048924 | Ga0496121_0010925 | Ga0496121_0010925_1953_2996 | 346 |
| 603 | 3300048925 | Ga0496122_0024680 | Ga0496122_0024680_3407_4450 | 346 |
| 604 | 3300048926 | Ga0496123_0029886 | Ga0496123_0029886_470_1513 | 346 |
| 605 | 3300048927 | Ga0496124_0000291 | Ga0496124_0000291_91430_92473 | 346 |
| 606 | 3300048928 | Ga0496125_0001248 | Ga0496125_0001248_35282_36325 | 346 |
| 607 | 3300048929 | Ga0496126_0001079 | Ga0496126_0001079_42936_43979 | 346 |
| 608 | 3300050493 | nmdc:mga0k408_48360_c1 | nmdc:mga0k408_48360_c1_510_1553 | 346 |
| 609 | 3300053119 | Ga0500595_005603 | Ga0500595_005603_2524_3567 | 346 |
| 610 | 3300053121 | Ga0500607_011812 | Ga0500607_011812_3852_4895 | 346 |
| 611 | 3300053130 | Ga0500642_0000830 | Ga0500642_0000830_758_1801 | 346 |
| 612 | 3300021361 | Ga0213872_10016799 | Ga0213872_100167994 | 347 |
| 613 | 3300039447 | Ga0436361_1004845 | Ga0436361_1004845_5488_6579 | 347 |
| 614 | 3300032004 | Ga0307414_10000567 | Ga0307414_1000056713 | 348 |
| 615 | 3300044656 | Ga0466969_0048192 | Ga0466969_0048192_525_1706 | 348 |
| 616 | 3300001979 | JGI24740J21852_10025944 | JGI24740J21852_100259443 | 349 |
| 617 | 3300009011 | Ga0105251_10003975 | Ga0105251_100039752 | 349 |
| 618 | 3300039447 | Ga0436361_0570909 | Ga0436361_0570909_613_1920 | 350 |
| 619 | 3300037068 | Ga0373925_0273977 | Ga0373925_0273977_155_1306 | 353 |
| 620 | 3300048921 | Ga0496118_0004003 | Ga0496118_0004003_15471_16541 | 353 |
| 621 | 3300001904 | JGI24736J21556_1005710 | JGI24736J21556_10057103 | 354 |
| 622 | 3300001989 | JGI24739J22299_10000250 | JGI24739J22299_1000025013 | 354 |
| 623 | 3300001990 | JGI24737J22298_10003302 | JGI24737J22298_100033026 | 354 |
| 624 | 3300002067 | JGI24735J21928_10000409 | JGI24735J21928_100004098 | 354 |
| 625 | 3300002075 | JGI24738J21930_10000103 | JGI24738J21930_1000010315 | 354 |
| 626 | 3300003316 | rootH1_10079800 | rootH1_100798001 | 354 |
| 627 | 3300005366 | Ga0070659_100140258 | Ga0070659_1001402581 | 354 |
| 628 | 3300005457 | Ga0070662_100048172 | Ga0070662_1000481721 | 354 |
| 629 | 3300005539 | Ga0068853_100119846 | Ga0068853_1001198463 | 354 |
| 630 | 3300025904 | Ga0207647_10000782 | Ga0207647_1000078218 | 354 |
| 631 | 3300025933 | Ga0207706_10063657 | Ga0207706_100636573 | 354 |
| 632 | 3300044842 | Ga0466957_0091550 | Ga0466957_0091550_199_1272 | 354 |
| 633 | 3300047443 | Ga0495687_028628 | Ga0495687_028628_569_1642 | 354 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r3s-assembly1.cif.gz_A | uroporphyrinogen decarboxylase single mutant d86g in complex with coproporphyrinogen-i | 0.9606 | 20 | 353 |
| 1r3q-assembly1.cif.gz_A | uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i | 0.9601 | 20 | 353 |
| 1r3w-assembly1.cif.gz_A-2 | uroporphyrinogen decarboxylase y164f mutant in complex with coproporphyrinogen-iii | 0.9596 | 20 | 353 |
| 1jph-assembly1.cif.gz_A-2 | ile260thr mutant of human urod, human uroporphyrinogen iii decarboxylase | 0.9594 | 20 | 353 |
| 3gw3-assembly1.cif.gz_A-2 | human urod mutant k297n | 0.9591 | 20 | 353 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1r3sA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9606 | 20 | 353 | 3.20.20.210 |
| af_P9WFE1_2_357_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9397 | 13 | 353 | 3.20.20.210 |
| af_P32347_4_362_3.20.20.210 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9393 | 12 | 352 | 3.20.20.210 |
| 2ejaB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9266 | 20 | 354 | 3.20.20.210 |
| 2infD00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel; | 0.9207 | 18 | 353 | 3.20.20.210 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N0WZN4-F1-model_v4 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | 0.9953 | 18 | 354 |
GO:0004853
GO:0005829 GO:0019353 |
| AF-A0A520ESE8-F1-model_v4 | deleted | 0.9945 | 248 | 353 |
|
| AF-A0A519EBC1-F1-model_v4 | deleted | 0.9942 | 254 | 354 |
|
| AF-A0A6L4A2C3-F1-model_v4 | deleted | 0.9941 | 186 | 353 |
|
| AF-A0A844Z894-F1-model_v4 | Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) | 0.9934 | 18 | 353 |
GO:0004853
GO:0005829 GO:0019353 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar