F471099

General Info

Members Datasets Scaffolds Average Seq Length
633 354 624 342

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0570909|Ga0436361_0570909_613_1920
Length 422
Sequence MRSSAIIPRDPPKTQRAPTIAPASAKALRKPLIAALAGERRPTPPIWLMRQAGRYLPEYRELRAKAASFLEFCYTPALAVEATLQPIRRFRFDAAILFSDILVMPDALGQRVSFETGEGPRLDPIHDASGFARLRDEPDWARLAPVFETIGRVKRALPDEVALIGFCGAPWTVASYMIAGRGTLDQGPARLFAYRDPDLFASLIDRLKTLLPGDVALIGFCGAPWTVASYMIAGRGTADQAPARLFAYRRPKLFSALIDRLVDASAEYLVRQLAAGAEAVQIFDSWAGVLPPAEFERWCVRPVASLIAKLRAQAPHAPIIAFPRGAATQLEKFAFMPDVAAVGLDTAVEPRAAVASLPAPIALQGNLDPLALVAGGPGLDAGIDCVLRGFEGRAHIFNLGHGILPETPVGHVERLVARVRGQ

Samples

Sample ID Description Type Environment
1 2643221629 Devosia sp. Root105 Isolate Unclassified
2 2643221662 Devosia sp. Root413D1 Isolate Unclassified
3 2643221736 Bosea sp. Root483D1 Isolate Unclassified
4 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
5 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
6 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
7 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
8 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
18 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
22 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
23 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
35 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
90 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
133 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
134 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
202 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
203 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
206 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
209 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
210 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
219 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
232 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
235 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
238 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
243 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
259 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
273 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
274 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
275 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
320 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
321 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
322 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
332 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
333 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
334 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
335 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
339 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
340 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
341 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
342 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
343 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
346 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
347 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
348 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
349 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
350 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
351 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
352 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
353 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
354 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.27
Nodule 0.32
Rhizoplane 6.64
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005710 3300001904 Bacteria 2103
2 JGI24740J21852_10003772 3300001979 Bacteria 6600
3 JGI24740J21852_10025944 3300001979 Bacteria 1968
4 JGI24739J22299_10000250 3300001989 Bacteria 18085
5 JGI24737J22298_10002929 3300001990 Bacteria 6049
6 JGI24737J22298_10003302 3300001990 Bacteria 5713
7 JGI24735J21928_10000409 3300002067 Bacteria 15021
8 JGI24738J21930_10000103 3300002075 Bacteria 19478
9 JGI25165J46597_1000035 3300003214 Bacteria 290723
10 JGI25153J46596_10001130 3300003215 Bacteria 16141
11 rootH1_10079800 3300003316 Bacteria 1765
12 rootH2_10032630 3300003320 Bacteria 4632
13 rootH2_10047068 3300003320 Bacteria 4093
14 rootL2_10101751 3300003322 Bacteria 4307
15 rootH1_10037990 3300003323 Bacteria 3208
16 Ga0055525_1000118 3300003759 Bacteria 120652
17 Ga0055542_1000076 3300003762 Bacteria 139662
18 Ga0055529_1000004 3300003763 Bacteria 433331
19 Ga0070658_10115022 3300005327 Bacteria 2231
20 Ga0070676_10017083 3300005328 Bacteria 4012
21 Ga0070690_100000690 3300005330 Bacteria 17293
22 Ga0070670_100003735 3300005331 Bacteria 12678
23 Ga0070670_100187560 3300005331 Bacteria 1796
24 Ga0068869_100066800 3300005334 Bacteria 2651
25 Ga0070666_10000975 3300005335 Bacteria 17499
26 Ga0070682_100000564 3300005337 Bacteria 22836
27 Ga0070682_100085548 3300005337 Bacteria 2051
28 Ga0068868_100003140 3300005338 Bacteria 11498
29 Ga0068868_100051809 3300005338 Bacteria 3230
30 Ga0068868_100121511 3300005338 Bacteria 2131
31 Ga0070660_100000165 3300005339 Bacteria 43416
32 Ga0070689_100000246 3300005340 Bacteria 31651
33 Ga0070691_10000033 3300005341 Bacteria 39121
34 Ga0070691_10011597 3300005341 Bacteria 4025
35 Ga0070687_100000312 3300005343 Bacteria 16432
36 Ga0070661_100000254 3300005344 Bacteria 43578
37 Ga0070661_100001432 3300005344 Bacteria 16569
38 Ga0070661_100008518 3300005344 Bacteria 7093
39 Ga0070661_100172027 3300005344 Bacteria 1645
40 Ga0070692_10009631 3300005345 Bacteria 4365
41 Ga0070668_100006205 3300005347 Bacteria 8854
42 Ga0070675_100000971 3300005354 Bacteria 20500
43 Ga0070671_100002133 3300005355 Bacteria 15273
44 Ga0070671_100010764 3300005355 Bacteria 7342
45 Ga0070674_100005136 3300005356 Bacteria 7528
46 Ga0070674_100053709 3300005356 Bacteria 2783
47 Ga0070674_100139041 3300005356 Bacteria 1820
48 Ga0070673_100003617 3300005364 Bacteria 9672
49 Ga0070688_100000574 3300005365 Bacteria 18516
50 Ga0070659_100033544 3300005366 Bacteria 3987
51 Ga0070659_100058602 3300005366 Bacteria 3039
52 Ga0070659_100140258 3300005366 Bacteria 1968
53 Ga0070667_100040302 3300005367 Bacteria 3916
54 Ga0070703_10003711 3300005406 Bacteria 4325
55 Ga0070709_10000408 3300005434 Bacteria 26266
56 Ga0070714_100005811 3300005435 Bacteria 9459
57 Ga0070713_100000333 3300005436 Bacteria 30842
58 Ga0070713_100312760 3300005436 Bacteria 1449
59 Ga0070710_10080590 3300005437 Bacteria 1899
60 Ga0070701_10001677 3300005438 Bacteria 8305
61 Ga0070711_100009937 3300005439 Bacteria 5869
62 Ga0070711_100072538 3300005439 Bacteria 2429
63 Ga0070705_100053020 3300005440 Bacteria 2372
64 Ga0070700_100000481 3300005441 Bacteria 19980
65 Ga0070694_100001363 3300005444 Bacteria 14273
66 Ga0070663_100000282 3300005455 Bacteria 25780
67 Ga0070663_100020507 3300005455 Bacteria 4378
68 Ga0070663_100108502 3300005455 Bacteria 2082
69 Ga0070678_100003280 3300005456 Bacteria 8993
70 Ga0070678_100010458 3300005456 Bacteria 5672
71 Ga0070662_100012028 3300005457 Bacteria 5729
72 Ga0070662_100048172 3300005457 Bacteria 3069
73 Ga0070662_100267714 3300005457 Bacteria 1379
74 Ga0070681_10083693 3300005458 Bacteria 3143
75 Ga0070685_10014004 3300005466 Bacteria 4244
76 Ga0070699_100068566 3300005518 Bacteria 3081
77 Ga0070679_100045870 3300005530 Bacteria 4355
78 Ga0070684_100057818 3300005535 Bacteria 3387
79 Ga0070684_100127310 3300005535 Bacteria 2295
80 Ga0070697_100005504 3300005536 Bacteria 9764
81 Ga0068853_100001647 3300005539 Bacteria 16330
82 Ga0068853_100031727 3300005539 Bacteria 4469
83 Ga0068853_100119846 3300005539 Bacteria 2346
84 Ga0070672_100010669 3300005543 Bacteria 6380
85 Ga0070672_100025566 3300005543 Bacteria 4381
86 Ga0070672_100059310 3300005543 Bacteria 3011
87 Ga0070686_100002667 3300005544 Bacteria 9829
88 Ga0070695_100071581 3300005545 Bacteria 2271
89 Ga0070696_100005997 3300005546 Bacteria 8112
90 Ga0070693_100000877 3300005547 Bacteria 13388
91 Ga0070693_100048717 3300005547 Bacteria 2414
92 Ga0070665_100000043 3300005548 Bacteria 279774
93 Ga0070665_100011861 3300005548 Bacteria 8802
94 Ga0070665_100215364 3300005548 Bacteria 1922
95 Ga0070665_100373194 3300005548 Bacteria 1433
96 Ga0070704_100000285 3300005549 Bacteria 22156
97 Ga0068855_100030880 3300005563 Bacteria 6405
98 Ga0068855_100173168 3300005563 Bacteria 2443
99 Ga0068855_100262254 3300005563 Bacteria 1924
100 Ga0070664_100003522 3300005564 Bacteria 12643
101 Ga0070664_100063592 3300005564 Bacteria 3146
102 Ga0068857_100001587 3300005577 Bacteria 18219
103 Ga0068857_100006351 3300005577 Bacteria 10122
104 Ga0068854_100000765 3300005578 Bacteria 19088
105 Ga0068854_100047630 3300005578 Bacteria 3056
106 Ga0068854_100262141 3300005578 Bacteria 1384
107 Ga0068856_100001518 3300005614 Bacteria 24335
108 Ga0068856_100001586 3300005614 Bacteria 23792
109 Ga0068856_100031963 3300005614 Bacteria 5150
110 Ga0068856_100050666 3300005614 Bacteria 4093
111 Ga0070702_100001487 3300005615 Bacteria 9630
112 Ga0070702_100256000 3300005615 Bacteria 1189
113 Ga0068852_100023036 3300005616 Bacteria 5006
114 Ga0068852_100059581 3300005616 Bacteria 3311
115 Ga0068859_100018002 3300005617 Bacteria 7099
116 Ga0068859_100064866 3300005617 Bacteria 3685
117 Ga0068859_100250946 3300005617 Bacteria 1860
118 Ga0068864_100006600 3300005618 Bacteria 9495
119 Ga0068866_10027542 3300005718 Bacteria 2697
120 Ga0068861_100045965 3300005719 Bacteria 3290
121 Ga0068861_100368274 3300005719 Bacteria 1266
122 Ga0068851_10087373 3300005834 Bacteria 1637
123 Ga0068851_10097427 3300005834 Bacteria 1556
124 Ga0068863_100000964 3300005841 Bacteria 28923
125 Ga0068863_100285650 3300005841 Bacteria 1599
126 Ga0068858_100000418 3300005842 Bacteria 44177
127 Ga0068858_100009723 3300005842 Bacteria 9157
128 Ga0068858_100013968 3300005842 Bacteria 7575
129 Ga0068858_100207204 3300005842 Bacteria 1855
130 Ga0068862_100000734 3300005844 Bacteria 32937
131 Ga0070715_10000723 3300006163 Bacteria 8904
132 Ga0070716_100000247 3300006173 Bacteria 21657
133 Ga0070712_100000023 3300006175 Bacteria 80972
134 Ga0070712_100000803 3300006175 Bacteria 18648
135 Ga0070712_100001127 3300006175 Bacteria 16083
136 Ga0075369_10024851 3300006186 Bacteria 2486
137 Ga0075366_10042391 3300006195 Bacteria 2694
138 Ga0097621_100008931 3300006237 Bacteria 7245
139 Ga0068871_100045364 3300006358 Bacteria 3538
140 Ga0068871_100071010 3300006358 Bacteria 2863
141 Ga0075428_100000606 3300006844 Bacteria 36554
142 Ga0075430_100015106 3300006846 Bacteria 6572
143 Ga0075431_100000032 3300006847 Bacteria 72293
144 Ga0075431_100003366 3300006847 Bacteria 15496
145 Ga0075431_100112935 3300006847 Bacteria 2804
146 Ga0075433_10126003 3300006852 Bacteria 2274
147 Ga0075434_100048864 3300006871 Bacteria 4199
148 Ga0075434_100121785 3300006871 Bacteria 2624
149 Ga0075434_100367380 3300006871 Bacteria 1460
150 Ga0075429_100008370 3300006880 Bacteria 9003
151 Ga0068865_100002428 3300006881 Bacteria 11012
152 Ga0068865_100129080 3300006881 Bacteria 1891
153 Ga0068865_100333935 3300006881 Bacteria 1223
154 Ga0075436_100000211 3300006914 Bacteria 36106
155 Ga0075436_100001146 3300006914 Bacteria 17902
156 Ga0075436_100306310 3300006914 Bacteria 1139
157 Ga0097620_100064871 3300006931 Bacteria 3685
158 Ga0075435_100019220 3300007076 Bacteria 5212
159 Ga0075435_100243105 3300007076 Bacteria 1531
160 Ga0105251_10003975 3300009011 Bacteria 10468
161 Ga0105240_10001363 3300009093 Bacteria 41954
162 Ga0105240_10196292 3300009093 Bacteria 2369
163 Ga0105240_10282089 3300009093 Bacteria 1908
164 Ga0111539_10001089 3300009094 Bacteria 35899
165 Ga0105245_10001371 3300009098 Bacteria 22055
166 Ga0105247_10000267 3300009101 Bacteria 48481
167 Ga0105247_10000490 3300009101 Bacteria 32865
168 Ga0114129_10000062 3300009147 Bacteria 96507
169 Ga0114129_10038874 3300009147 Bacteria 6708
170 Ga0114129_10099120 3300009147 Bacteria 4033
171 Ga0105243_10000490 3300009148 Bacteria 40402
172 Ga0105243_10004582 3300009148 Bacteria 10901
173 Ga0105243_10012302 3300009148 Bacteria 6471
174 Ga0105241_10004507 3300009174 Bacteria 10306
175 Ga0105241_10006458 3300009174 Bacteria 8643
176 Ga0105241_10018242 3300009174 Bacteria 5159
177 Ga0105241_10027427 3300009174 Bacteria 4242
178 Ga0105242_10495002 3300009176 Bacteria 1162
179 Ga0105248_10000546 3300009177 Bacteria 42987
180 Ga0105248_10019052 3300009177 Bacteria 7588
181 Ga0105237_10000746 3300009545 Bacteria 44835
182 Ga0105237_10135815 3300009545 Bacteria 2454
183 Ga0105237_10240008 3300009545 Bacteria 1813
184 Ga0105237_10427231 3300009545 Bacteria 1330
185 Ga0105238_10064606 3300009551 Bacteria 3659
186 Ga0105238_10146325 3300009551 Bacteria 2339
187 Ga0105238_10191083 3300009551 Bacteria 2024
188 Ga0105238_10214035 3300009551 Bacteria 1903
189 Ga0105238_10299226 3300009551 Bacteria 1592
190 Ga0105249_10010570 3300009553 Bacteria 8111
191 Ga0105239_10010016 3300010375 Bacteria 10631
192 Ga0105239_10014493 3300010375 Bacteria 8746
193 Ga0105239_10040567 3300010375 Bacteria 5100
194 Ga0105239_10069699 3300010375 Bacteria 3863
195 Ga0105239_10570602 3300010375 Bacteria 1289
196 Ga0105246_10000573 3300011119 Bacteria 20393
197 Ga0157324_1000358 3300012506 Bacteria 2128
198 Ga0157373_10001483 3300013100 Bacteria 17886
199 Ga0157373_10002592 3300013100 Bacteria 13730
200 Ga0157373_10093369 3300013100 Bacteria 2119
201 Ga0157371_10000062 3300013102 Bacteria 169669
202 Ga0157371_10052012 3300013102 Bacteria 2910
203 Ga0157370_10000753 3300013104 Bacteria 40426
204 Ga0157370_10018947 3300013104 Bacteria 6919
205 Ga0157370_10273238 3300013104 Bacteria 1561
206 Ga0157369_10001029 3300013105 Bacteria 35216
207 Ga0157369_10002018 3300013105 Bacteria 24475
208 Ga0157369_10067493 3300013105 Bacteria 3845
209 Ga0157369_10173221 3300013105 Bacteria 2273
210 Ga0157369_10420092 3300013105 Bacteria 1386
211 Ga0157378_10085814 3300013297 Bacteria 2852
212 Ga0157378_10325268 3300013297 Bacteria 1495
213 Ga0157372_10002818 3300013307 Bacteria 18780
214 Ga0157372_10419041 3300013307 Bacteria 1560
215 Ga0157372_10419686 3300013307 Bacteria 1559
216 Ga0157375_10032115 3300013308 Bacteria 4976
217 Ga0157375_10412256 3300013308 Bacteria 1517
218 Ga0163163_10018194 3300014325 Bacteria 6571
219 Ga0163163_10069761 3300014325 Bacteria 3499
220 Ga0157377_10002609 3300014745 Bacteria 8001
221 Ga0157379_10001147 3300014968 Bacteria 21627
222 Ga0157379_10002050 3300014968 Bacteria 16740
223 Ga0157379_10013521 3300014968 Bacteria 7153
224 Ga0157379_10015138 3300014968 Bacteria 6765
225 Ga0157379_10035127 3300014968 Bacteria 4469
226 Ga0157376_10024439 3300014969 Bacteria 4744
227 Ga0183365_10001 3300015684 Bacteria 2090444
228 Ga0213873_10000216 3300021358 Bacteria 10215
229 Ga0213872_10008768 3300021361 Bacteria 4880
230 Ga0213872_10016799 3300021361 Bacteria 3393
231 Ga0213876_10000056 3300021384 Bacteria 135017
232 Ga0213876_10000258 3300021384 Bacteria 49441
233 Ga0209563_100070 3300025230 Bacteria 249779
234 Ga0209646_1009815 3300025246 Bacteria 1512
235 Ga0209148_1000008 3300025254 Bacteria 1504371
236 Ga0209233_1032486 3300025261 Bacteria 1206
237 Ga0209455_1000002 3300025272 Bacteria 1505459
238 Ga0209758_1000007 3300025297 Bacteria 1270410
239 Ga0207656_10000493 3300025321 Bacteria 13053
240 Ga0207713_1024811 3300025735 Bacteria 2783
241 Ga0207642_10082837 3300025899 Bacteria 1562
242 Ga0207710_10001601 3300025900 Bacteria 11075
243 Ga0207688_10000468 3300025901 Bacteria 19347
244 Ga0207680_10127066 3300025903 Bacteria 1675
245 Ga0207647_10000782 3300025904 Bacteria 24751
246 Ga0207647_10002881 3300025904 Bacteria 12962
247 Ga0207647_10173592 3300025904 Bacteria 1254
248 Ga0207699_10000280 3300025906 Bacteria 27852
249 Ga0207699_10018169 3300025906 Bacteria 3722
250 Ga0207645_10201891 3300025907 Bacteria 1308
251 Ga0207705_10039852 3300025909 Bacteria 3367
252 Ga0207705_10044154 3300025909 Bacteria 3203
253 Ga0207654_10000226 3300025911 Bacteria 34521
254 Ga0207707_10190318 3300025912 Bacteria 1790
255 Ga0207695_10016920 3300025913 Bacteria 8508
256 Ga0207695_10051375 3300025913 Bacteria 4329
257 Ga0207671_10032982 3300025914 Bacteria 3855
258 Ga0207693_10000018 3300025915 Bacteria 138365
259 Ga0207693_10000267 3300025915 Bacteria 48128
260 Ga0207693_10000534 3300025915 Bacteria 34415
261 Ga0207663_10000947 3300025916 Bacteria 13260
262 Ga0207663_10011828 3300025916 Bacteria 4699
263 Ga0207663_10255552 3300025916 Bacteria 1291
264 Ga0207662_10000454 3300025918 Bacteria 18174
265 Ga0207657_10000170 3300025919 Bacteria 66814
266 Ga0207657_10009722 3300025919 Bacteria 9644
267 Ga0207657_10037832 3300025919 Bacteria 4304
268 Ga0207649_10000016 3300025920 Bacteria 243843
269 Ga0207649_10000026 3300025920 Bacteria 177395
270 Ga0207649_10011028 3300025920 Bacteria 4973
271 Ga0207649_10032359 3300025920 Bacteria 3117
272 Ga0207649_10105962 3300025920 Bacteria 1869
273 Ga0207649_10129052 3300025920 Bacteria 1715
274 Ga0207652_10008354 3300025921 Bacteria 8327
275 Ga0207681_10237794 3300025923 Bacteria 1416
276 Ga0207694_10027016 3300025924 Bacteria 4369
277 Ga0207694_10034592 3300025924 Bacteria 3874
278 Ga0207694_10039727 3300025924 Bacteria 3621
279 Ga0207694_10061427 3300025924 Bacteria 2924
280 Ga0207694_10117694 3300025924 Bacteria 2119
281 Ga0207650_10031979 3300025925 Bacteria 3804
282 Ga0207650_10074126 3300025925 Bacteria 2565
283 Ga0207650_10205773 3300025925 Bacteria 1579
284 Ga0207687_10018502 3300025927 Bacteria 4600
285 Ga0207700_10000026 3300025928 Bacteria 139690
286 Ga0207644_10006974 3300025931 Bacteria 7357
287 Ga0207644_10008396 3300025931 Bacteria 6758
288 Ga0207690_10002244 3300025932 Bacteria 11801
289 Ga0207690_10003226 3300025932 Bacteria 9791
290 Ga0207706_10000421 3300025933 Bacteria 45539
291 Ga0207706_10063657 3300025933 Bacteria 3247
292 Ga0207706_10084929 3300025933 Bacteria 2783
293 Ga0207686_10003249 3300025934 Bacteria 8746
294 Ga0207709_10000005 3300025935 Bacteria 806813
295 Ga0207709_10110538 3300025935 Bacteria 1837
296 Ga0207670_10012918 3300025936 Bacteria 4906
297 Ga0207669_10005383 3300025937 Bacteria 5738
298 Ga0207669_10014939 3300025937 Bacteria 3904
299 Ga0207704_10013657 3300025938 Bacteria 4074
300 Ga0207665_10000696 3300025939 Bacteria 22788
301 Ga0207691_10019645 3300025940 Bacteria 6392
302 Ga0207691_10037589 3300025940 Bacteria 4483
303 Ga0207691_10044642 3300025940 Bacteria 4078
304 Ga0207711_10037179 3300025941 Bacteria 4133
305 Ga0207711_10163211 3300025941 Bacteria 2018
306 Ga0207689_10210012 3300025942 Bacteria 1608
307 Ga0207679_10025050 3300025945 Bacteria 4098
308 Ga0207679_10143335 3300025945 Bacteria 1934
309 Ga0207667_10000001 3300025949 Bacteria 1178522
310 Ga0207667_10009832 3300025949 Bacteria 11240
311 Ga0207667_10010243 3300025949 Bacteria 10974
312 Ga0207667_10015513 3300025949 Bacteria 8647
313 Ga0207667_10102808 3300025949 Bacteria 2947
314 Ga0207667_10192437 3300025949 Bacteria 2093
315 Ga0207651_10022299 3300025960 Bacteria 3868
316 Ga0207651_10064387 3300025960 Bacteria 2566
317 Ga0207712_10007229 3300025961 Bacteria 7003
318 Ga0207712_10019682 3300025961 Bacteria 4411
319 Ga0207668_10001754 3300025972 Bacteria 12694
320 Ga0207640_10002461 3300025981 Bacteria 9912
321 Ga0207640_10169283 3300025981 Bacteria 1626
322 Ga0207658_10018107 3300025986 Bacteria 4859
323 Ga0207658_10056784 3300025986 Bacteria 2906
324 Ga0207677_10020778 3300026023 Bacteria 3995
325 Ga0207677_10465194 3300026023 Bacteria 1086
326 Ga0207703_10003927 3300026035 Bacteria 12343
327 Ga0207703_10006685 3300026035 Bacteria 9199
328 Ga0207639_10007127 3300026041 Bacteria 7620
329 Ga0207678_10000210 3300026067 Bacteria 51779
330 Ga0207678_10007090 3300026067 Bacteria 9943
331 Ga0207678_10118717 3300026067 Bacteria 2257
332 Ga0207702_10000592 3300026078 Bacteria 40068
333 Ga0207702_10000862 3300026078 Bacteria 31638
334 Ga0207702_10003947 3300026078 Bacteria 13327
335 Ga0207702_10040468 3300026078 Bacteria 3907
336 Ga0207702_10086962 3300026078 Bacteria 2727
337 Ga0207702_10094682 3300026078 Bacteria 2622
338 Ga0207641_10002237 3300026088 Bacteria 18096
339 Ga0207641_10055921 3300026088 Bacteria 3352
340 Ga0207641_10064687 3300026088 Bacteria 3126
341 Ga0207676_10013348 3300026095 Bacteria 5901
342 Ga0207674_10000134 3300026116 Bacteria 86377
343 Ga0207674_10001169 3300026116 Bacteria 34089
344 Ga0207674_10013140 3300026116 Bacteria 9215
345 Ga0207674_10034643 3300026116 Bacteria 5276
346 Ga0207675_100000311 3300026118 Bacteria 46624
347 Ga0207675_100293639 3300026118 Bacteria 1582
348 Ga0207683_10000192 3300026121 Bacteria 52412
349 Ga0207683_10002482 3300026121 Bacteria 16096
350 Ga0207683_10355248 3300026121 Bacteria 1345
351 Ga0207698_10001942 3300026142 Bacteria 12137
352 Ga0207698_10013227 3300026142 Bacteria 5436
353 Ga0207698_10039343 3300026142 Bacteria 3502
354 Ga0209974_10011378 3300027876 Bacteria 2988
355 Ga0268266_10000002 3300028379 Bacteria 3059047
356 Ga0268266_10036274 3300028379 Bacteria 4196
357 Ga0268265_10010125 3300028380 Bacteria 6366
358 Ga0268264_10028296 3300028381 Bacteria 4583
359 Ga0265319_1033409 3300028563 Bacteria 1777
360 Ga0265318_10016634 3300028577 Bacteria 3034
361 Ga0307517_10012984 3300028786 Bacteria 11362
362 Ga0307517_10052987 3300028786 Bacteria 4051
363 Ga0265324_10048288 3300029957 Bacteria 1464
364 Ga0265330_10114450 3300031235 Bacteria 1150
365 Ga0265332_10056104 3300031238 Bacteria 1688
366 Ga0265325_10000365 3300031241 Bacteria 31743
367 Ga0265339_10006412 3300031249 Bacteria 7719
368 Ga0265339_10099610 3300031249 Bacteria 1514
369 Ga0265331_10000008 3300031250 Bacteria 324311
370 Ga0265331_10000067 3300031250 Bacteria 158073
371 Ga0265331_10024816 3300031250 Bacteria 3029
372 Ga0265327_10000036 3300031251 Bacteria 312827
373 Ga0265316_10013136 3300031344 Bacteria 7377
374 Ga0307513_10080372 3300031456 Bacteria 3363
375 Ga0265313_10006830 3300031595 Bacteria 7964
376 Ga0265313_10021851 3300031595 Bacteria 3488
377 Ga0265314_10002746 3300031711 Bacteria 17598
378 Ga0265314_10049117 3300031711 Bacteria 2956
379 Ga0265342_10051682 3300031712 Bacteria 2451
380 Ga0307414_10000567 3300032004 Bacteria 19287
381 Ga0307411_10078968 3300032005 Bacteria 2258
382 Ga0373952_0012269 3300035092 Bacteria 1683
383 Ga0373939_0010689 3300035114 Bacteria 2302
384 Ga0373955_0119421 3300035172 Bacteria 1531
385 Ga0373942_0015942 3300035207 Bacteria 1838
386 Ga0373931_0004736 3300035691 Bacteria 6237
387 Ga0373931_0007222 3300035691 Bacteria 5229
388 Ga0373935_0013458 3300035692 Bacteria 4937
389 Ga0373927_0015725 3300035695 Bacteria 4996
390 Ga0373937_0023121 3300036401 Bacteria 5593
391 Ga0373925_0273977 3300037068 Bacteria 1358
392 Ga0395899_0169452 3300037312 Bacteria 1538
393 Ga0395900_0024597 3300037418 Bacteria 6165
394 Ga0395898_0011788 3300037466 Bacteria 9063
395 Ga0395905_0000108 3300037471 Bacteria 138234
396 Ga0395905_0001746 3300037471 Bacteria 25379
397 Ga0395905_0051525 3300037471 Bacteria 3856
398 Ga0395905_0492486 3300037471 Bacteria 1126
399 Ga0436364_0479880 3300037853 Bacteria 2180
400 Ga0395901_0029521 3300038443 Bacteria 5647
401 Ga0436365_0083543 3300039437 Bacteria 85224
402 Ga0436365_0456925 3300039437 Bacteria 13529
403 Ga0436365_1515960 3300039437 Bacteria 1079
404 Ga0436360_0298857 3300039438 Bacteria 8376
405 Ga0436361_0163275 3300039447 Bacteria 23310
406 Ga0436361_0570909 3300039447 Bacteria 2853
407 Ga0436361_0606425 3300039447 Bacteria 3014
408 Ga0436361_0765979 3300039447 Bacteria 11155
409 Ga0436361_1004845 3300039447 Bacteria 7440
410 Ga0436362_1001952 3300039453 Bacteria 11094
411 Ga0436362_1235945 3300039453 Bacteria 2266
412 Ga0451787_345757 3300041441 Bacteria 1167
413 Ga0439456_000012 3300042013 Bacteria 72838
414 Ga0466969_0001813 3300044656 Bacteria 11397
415 Ga0466969_0048192 3300044656 Bacteria 2107
416 Ga0466969_0136845 3300044656 Bacteria 1134
417 Ga0466966_0000261 3300044684 Bacteria 35154
418 Ga0466966_0108505 3300044684 Bacteria 1712
419 Ga0466971_0001002 3300044719 Bacteria 11653
420 Ga0466970_0004102 3300044765 Bacteria 7162
421 Ga0466970_0195302 3300044765 Bacteria 1125
422 Ga0466957_0003464 3300044842 Bacteria 8662
423 Ga0466957_0049582 3300044842 Bacteria 2553
424 Ga0466957_0091550 3300044842 Bacteria 1906
425 Ga0466957_0141996 3300044842 Bacteria 1548
426 Ga0466959_0000155 3300045049 Bacteria 44848
427 Ga0466959_0082965 3300045049 Bacteria 2309
428 Ga0466958_0005552 3300045836 Bacteria 6799
429 Ga0466958_0117236 3300045836 Bacteria 1665
430 Ga0495629_0020819 3300046459 Bacteria 4682
431 Ga0495650_0012193 3300046471 Bacteria 4641
432 Ga0495584_0133840 3300046491 Bacteria 1258
433 Ga0495585_0019768 3300046492 Bacteria 3879
434 Ga0495585_0096486 3300046492 Bacteria 1586
435 Ga0495583_0051520 3300046506 Bacteria 1876
436 Ga0495606_0002116 3300046507 Bacteria 24110
437 Ga0495606_0156780 3300046507 Bacteria 1331
438 Ga0495606_0224367 3300046507 Bacteria 1057
439 Ga0495628_0016870 3300046516 Bacteria 6087
440 Ga0495637_0012078 3300046520 Bacteria 4138
441 Ga0495643_0001994 3300046522 Bacteria 17059
442 Ga0495648_0000323 3300046524 Bacteria 53106
443 Ga0495663_0008715 3300046525 Bacteria 2813
444 Ga0495642_0011218 3300046528 Bacteria 3437
445 Ga0495587_0040230 3300046536 Bacteria 2795
446 Ga0495597_0089462 3300046542 Bacteria 1308
447 Ga0495622_0012236 3300046557 Bacteria 3968
448 Ga0495633_0000494 3300046558 Bacteria 39797
449 Ga0495668_0000059 3300046616 Bacteria 194951
450 Ga0495611_0035018 3300046648 Bacteria 2222
451 Ga0495611_0051772 3300046648 Bacteria 1851
452 Ga0495611_0121531 3300046648 Bacteria 1218
453 Ga0495625_0000559 3300046660 Bacteria 54547
454 Ga0495625_0009358 3300046660 Bacteria 8205
455 Ga0495625_0093589 3300046660 Bacteria 2074
456 Ga0495625_0167472 3300046660 Bacteria 1468
457 Ga0495646_0114196 3300046680 Bacteria 1535
458 Ga0495669_0000628 3300046684 Bacteria 15338
459 Ga0495613_0006941 3300046689 Bacteria 8446
460 Ga0495613_0254987 3300046689 Bacteria 1223
461 Ga0495670_0099123 3300046691 Bacteria 1499
462 Ga0495671_0093788 3300046692 Bacteria 1469
463 Ga0495649_0033503 3300046694 Bacteria 2827
464 Ga0495649_0100773 3300046694 Bacteria 1535
465 Ga0495600_0006647 3300046809 Bacteria 7044
466 Ga0495683_0047147 3300047323 Bacteria 2162
467 Ga0495683_0069502 3300047323 Bacteria 1730
468 Ga0495683_0157615 3300047323 Bacteria 1052
469 Ga0495687_000152 3300047443 Bacteria 105602
470 Ga0495687_000517 3300047443 Bacteria 46300
471 Ga0495687_028628 3300047443 Bacteria 2589
472 Ga0495677_0009651 3300047445 Bacteria 3559
473 Ga0495673_0044873 3300047469 Bacteria 1969
474 Ga0495681_0006423 3300047470 Bacteria 7729
475 Ga0495684_0061653 3300047471 Bacteria 2853
476 Ga0495686_0000209 3300047472 Bacteria 108972
477 Ga0496100_0011653 3300048903 Bacteria 5011
478 Ga0496101_0031856 3300048904 Bacteria 3708
479 Ga0496102_0000010 3300048905 Bacteria 324617
480 Ga0496102_0000184 3300048905 Bacteria 84568
481 Ga0496102_0088810 3300048905 Bacteria 2858
482 Ga0496102_0296709 3300048905 Bacteria 1523
483 Ga0496102_0336537 3300048905 Bacteria 1421
484 Ga0496103_0000082 3300048906 Bacteria 109451
485 Ga0496103_0000099 3300048906 Bacteria 94046
486 Ga0496103_0024985 3300048906 Bacteria 3607
487 Ga0496104_0002902 3300048907 Bacteria 14768
488 Ga0496104_0037107 3300048907 Bacteria 4557
489 Ga0496104_0053857 3300048907 Bacteria 3802
490 Ga0496104_0185783 3300048907 Bacteria 1989
491 Ga0496105_0000589 3300048908 Bacteria 24200
492 Ga0496105_0046110 3300048908 Bacteria 3597
493 Ga0496105_0190159 3300048908 Bacteria 1679
494 Ga0496106_0056041 3300048909 Bacteria 2979
495 Ga0496107_0019441 3300048910 Bacteria 4792
496 Ga0496107_0118510 3300048910 Bacteria 1949
497 Ga0496107_0189696 3300048910 Bacteria 1527
498 Ga0496107_0253421 3300048910 Bacteria 1310
499 Ga0496108_0005359 3300048911 Bacteria 10370
500 Ga0496109_0001652 3300048912 Bacteria 18631
501 Ga0496110_0059985 3300048913 Bacteria 3354
502 Ga0496110_0080817 3300048913 Bacteria 2897
503 Ga0496110_0197855 3300048913 Bacteria 1825
504 Ga0496111_0041330 3300048914 Bacteria 3308
505 Ga0496111_0081271 3300048914 Bacteria 2365
506 Ga0496111_0224106 3300048914 Bacteria 1397
507 Ga0496111_0257477 3300048914 Bacteria 1295
508 Ga0496112_0069480 3300048915 Bacteria 3479
509 Ga0496113_0007975 3300048916 Bacteria 6861
510 Ga0496113_0051841 3300048916 Bacteria 3062
511 Ga0496113_0059974 3300048916 Bacteria 2867
512 Ga0496114_0002662 3300048917 Bacteria 13626
513 Ga0496114_0016017 3300048917 Bacteria 6032
514 Ga0496114_0301064 3300048917 Bacteria 1416
515 Ga0496115_0000066 3300048918 Bacteria 95550
516 Ga0496115_0041710 3300048918 Bacteria 3653
517 Ga0496115_0047342 3300048918 Bacteria 3438
518 Ga0496116_0004459 3300048919 Bacteria 13338
519 Ga0496116_0020607 3300048919 Bacteria 5002
520 Ga0496117_0000037 3300048920 Bacteria 324960
521 Ga0496117_0001024 3300048920 Bacteria 42696
522 Ga0496118_0000034 3300048921 Bacteria 322764
523 Ga0496118_0000154 3300048921 Bacteria 122224
524 Ga0496118_0004003 3300048921 Bacteria 17936
525 Ga0496119_0036254 3300048922 Bacteria 3222
526 Ga0496119_0048681 3300048922 Bacteria 2627
527 Ga0496120_0016240 3300048923 Bacteria 4872
528 Ga0496121_0010925 3300048924 Bacteria 10142
529 Ga0496121_0018754 3300048924 Bacteria 6954
530 Ga0496122_0024680 3300048925 Bacteria 5254
531 Ga0496123_0029886 3300048926 Bacteria 4000
532 Ga0496124_0000033 3300048927 Bacteria 330586
533 Ga0496124_0000291 3300048927 Bacteria 94493
534 Ga0496125_0001248 3300048928 Bacteria 37996
535 Ga0496125_0017934 3300048928 Bacteria 6729
536 Ga0496126_0000463 3300048929 Bacteria 80860
537 Ga0496126_0001079 3300048929 Bacteria 45863
538 Ga0501031_0017718 3300049568 Bacteria 4631
539 Ga0501031_0329525 3300049568 Bacteria 989
540 Ga0501033_0022975 3300049570 Bacteria 4701
541 Ga0501034_0000286 3300049571 Bacteria 90126
542 Ga0501034_0008706 3300049571 Bacteria 10687
543 Ga0501034_0008957 3300049571 Bacteria 10519
544 Ga0501034_0051251 3300049571 Bacteria 4162
545 Ga0501034_0145554 3300049571 Bacteria 2347
546 Ga0501036_0129779 3300049572 Bacteria 2128
547 Ga0501036_0233759 3300049572 Bacteria 1542
548 Ga0501036_0278359 3300049572 Bacteria 1400
549 Ga0501037_0098885 3300049573 Bacteria 2107
550 Ga0501038_0131515 3300049574 Bacteria 2054
551 Ga0501038_0275980 3300049574 Bacteria 1324
552 Ga0501039_0022369 3300049575 Bacteria 4853
553 Ga0501046_0014467 3300049580 Bacteria 6658
554 Ga0501046_0299916 3300049580 Bacteria 1174
555 Ga0501047_0008090 3300049581 Bacteria 9923
556 Ga0501047_0079020 3300049581 Bacteria 3163
557 Ga0501047_0110150 3300049581 Bacteria 2636
558 Ga0501067_0002385 3300049583 Bacteria 10394
559 Ga0501070_0009504 3300049586 Bacteria 8219
560 Ga0501070_0070443 3300049586 Bacteria 2895
561 Ga0501071_0015263 3300049587 Bacteria 5271
562 Ga0501073_0013297 3300049589 Bacteria 5997
563 Ga0501073_0017379 3300049589 Bacteria 5210
564 Ga0501074_0014761 3300049590 Bacteria 5681
565 Ga0501079_0008105 3300049741 Bacteria 7959
566 Ga0501080_0007490 3300049742 Bacteria 9856
567 Ga0501080_0015887 3300049742 Bacteria 6943
568 Ga0501080_0062636 3300049742 Bacteria 3462
569 Ga0501080_0389956 3300049742 Bacteria 1254
570 Ga0501083_0052719 3300049744 Bacteria 2732
571 Ga0501083_0186988 3300049744 Bacteria 1352
572 Ga0501035_0002157 3300049822 Bacteria 19534
573 Ga0501035_0016301 3300049822 Bacteria 6854
574 Ga0501035_0052277 3300049822 Bacteria 3656
575 Ga0501035_0165668 3300049822 Bacteria 1911
576 Ga0501035_0235098 3300049822 Bacteria 1561
577 Ga0501044_0010959 3300049823 Bacteria 9839
578 Ga0501044_0047773 3300049823 Bacteria 4426
579 Ga0501044_0065211 3300049823 Bacteria 3715
580 Ga0501044_0072794 3300049823 Bacteria 3493
581 Ga0501044_0081622 3300049823 Bacteria 3272
582 nmdc:mga0k408_48360_c1 3300050493 Bacteria 2460
583 nmdc:mga05p37_124990_c1 3300050507 Bacteria 3159
584 nmdc:mga05p37_190858_c1 3300050507 Bacteria 2487
585 nmdc:mga05p37_564_c1 3300050507 Bacteria 40786
586 nmdc:mga09592_7130_c1 3300050508 Bacteria 9087
587 nmdc:mga0qj67_192884_c1 3300050509 Bacteria 1655
588 nmdc:mga0qj67_445_c1 3300050509 Bacteria 28226
589 nmdc:mga06r32_191_c1 3300050510 Bacteria 49056
590 nmdc:mga08y16_70447_c1 3300050511 Bacteria 3645
591 nmdc:mga08y16_89_c1 3300050511 Bacteria 76793
592 nmdc:mga0n895_102394_c1 3300050512 Bacteria 2874
593 nmdc:mga0n895_127947_c1 3300050512 Bacteria 2564
594 nmdc:mga0n895_254365_c1 3300050512 Bacteria 1782
595 nmdc:mga0n895_37597_c1 3300050512 Bacteria 4685
596 nmdc:mga0n895_54746_c1 3300050512 Bacteria 3925
597 nmdc:mga0n895_98404_c1 3300050512 Bacteria 2932
598 nmdc:mga0rr50_139249_c1 3300050513 Bacteria 1951
599 nmdc:mga0rr50_230908_c1 3300050513 Bacteria 1531
600 nmdc:mga0rr50_35907_c1 3300050513 Bacteria 3564
601 nmdc:mga0rr50_93255_c1 3300050513 Bacteria 2349
602 nmdc:mga08x19_54_c1 3300050514 Bacteria 121662
603 nmdc:mga0a205_13445_c1 3300050515 Bacteria 7622
604 Ga0500610_0000101 3300053079 Bacteria 25651
605 Ga0495595_0047830 3300053084 Bacteria 1974
606 Ga0495619_0088688 3300053085 Bacteria 2092
607 Ga0500640_051667 3300053095 Bacteria 1797
608 Ga0500593_000072 3300053117 Bacteria 37884
609 Ga0500595_005603 3300053119 Bacteria 5463
610 Ga0500597_000402 3300053120 Bacteria 9012
611 Ga0500607_011812 3300053121 Bacteria 5150
612 Ga0500642_0000830 3300053130 Bacteria 9013
613 Ga0500559_0168859 3300053136 Bacteria 1029
614 Ga0500568_0000005 3300053139 Bacteria 614296
615 Ga0500568_0004709 3300053139 Bacteria 7238
616 Ga0500624_000003 3300053157 Bacteria 253364
617 Ga0500636_0009480 3300053177 Bacteria 5660
618 Ga0500637_0000073 3300053178 Bacteria 35884
619 Ga0500645_002663 3300053730 Bacteria 7780
620 Ga0501084_0007919 3300054114 Bacteria 8746
621 Ga0501084_0438181 3300054114 Bacteria 1105
622 Ga0590071_006680 3300059421 Bacteria 2737
623 Ga0501082_0088124 3300060353 Bacteria 2678
624 Ga0466962_0001111 3300061719 Bacteria 12400

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044765 Ga0466970_0195302 Ga0466970_0195302_260_1114 260
2 3300049568 Ga0501031_0329525 Ga0501031_0329525_37_936 293
3 3300053136 Ga0500559_0168859 Ga0500559_0168859_109_1005 294
4 3300009545 Ga0105237_10135815 Ga0105237_101358152 315
5 3300009551 Ga0105238_10191083 Ga0105238_101910832 315
6 3300013104 Ga0157370_10273238 Ga0157370_102732382 315
7 3300013105 Ga0157369_10173221 Ga0157369_101732212 315
8 3300044842 Ga0466957_0141996 Ga0466957_0141996_471_1490 315
9 3300053139 Ga0500568_0004709 Ga0500568_0004709_4341_5300 315
10 3300005344 Ga0070661_100008518 Ga0070661_1000085185 316
11 3300005356 Ga0070674_100053709 Ga0070674_1000537092 316
12 3300005539 Ga0068853_100031727 Ga0068853_1000317273 316
13 3300005543 Ga0070672_100025566 Ga0070672_1000255664 316
14 3300006881 Ga0068865_100129080 Ga0068865_1001290801 316
15 3300009545 Ga0105237_10427231 Ga0105237_104272312 316
16 3300009551 Ga0105238_10146325 Ga0105238_101463252 316
17 3300010375 Ga0105239_10040567 Ga0105239_100405674 316
18 3300013104 Ga0157370_10018947 Ga0157370_100189479 316
19 3300013105 Ga0157369_10067493 Ga0157369_100674933 316
20 3300025940 Ga0207691_10037589 Ga0207691_100375891 316
21 3300025960 Ga0207651_10064387 Ga0207651_100643872 316
22 3300037471 Ga0395905_0000108 Ga0395905_0000108_57170_58126 316
23 3300037471 Ga0395905_0051525 Ga0395905_0051525_2292_3248 316
24 3300044656 Ga0466969_0001813 Ga0466969_0001813_6221_7177 316
25 3300044684 Ga0466966_0000261 Ga0466966_0000261_18879_19835 316
26 3300044719 Ga0466971_0001002 Ga0466971_0001002_4570_5526 316
27 3300044765 Ga0466970_0004102 Ga0466970_0004102_589_1545 316
28 3300044842 Ga0466957_0003464 Ga0466957_0003464_4485_5441 316
29 3300045049 Ga0466959_0000155 Ga0466959_0000155_32180_33136 316
30 3300045049 Ga0466959_0082965 Ga0466959_0082965_591_1547 316
31 3300045836 Ga0466958_0005552 Ga0466958_0005552_3760_4716 316
32 3300049571 Ga0501034_0145554 Ga0501034_0145554_1376_2332 316
33 3300049572 Ga0501036_0129779 Ga0501036_0129779_783_1751 316
34 3300049742 Ga0501080_0062636 Ga0501080_0062636_17_985 316
35 3300049742 Ga0501080_0389956 Ga0501080_0389956_200_1162 316
36 3300049822 Ga0501035_0016301 Ga0501035_0016301_5390_6349 316
37 3300049822 Ga0501035_0235098 Ga0501035_0235098_50_1006 316
38 3300049823 Ga0501044_0072794 Ga0501044_0072794_858_1817 316
39 3300049823 Ga0501044_0081622 Ga0501044_0081622_723_1685 316
40 3300061719 Ga0466962_0001111 Ga0466962_0001111_4190_5146 316
41 3300006847 Ga0075431_100112935 Ga0075431_1001129351 317
42 3300009093 Ga0105240_10001363 Ga0105240_1000136313 317
43 3300009147 Ga0114129_10038874 Ga0114129_100388745 317
44 3300009174 Ga0105241_10018242 Ga0105241_100182426 317
45 3300009545 Ga0105237_10000746 Ga0105237_100007469 317
46 3300010375 Ga0105239_10010016 Ga0105239_100100164 317
47 3300013100 Ga0157373_10001483 Ga0157373_1000148321 317
48 3300013104 Ga0157370_10000753 Ga0157370_1000075345 317
49 3300013105 Ga0157369_10002018 Ga0157369_1000201828 317
50 3300014325 Ga0163163_10069761 Ga0163163_100697613 317
51 3300014968 Ga0157379_10002050 Ga0157379_1000205018 317
52 3300025925 Ga0207650_10074126 Ga0207650_100741262 317
53 3300037853 Ga0436364_0479880 Ga0436364_0479880_66_1034 317
54 3300039437 Ga0436365_1515960 Ga0436365_1515960_54_1022 317
55 3300039453 Ga0436362_1235945 Ga0436362_1235945_847_1821 317
56 3300046507 Ga0495606_0224367 Ga0495606_0224367_18_974 317
57 3300046648 Ga0495611_0035018 Ga0495611_0035018_289_1245 317
58 3300046660 Ga0495625_0009358 Ga0495625_0009358_1240_2196 317
59 3300046684 Ga0495669_0000628 Ga0495669_0000628_958_1914 317
60 3300046694 Ga0495649_0100773 Ga0495649_0100773_168_1124 317
61 3300047323 Ga0495683_0157615 Ga0495683_0157615_35_991 317
62 3300047443 Ga0495687_000152 Ga0495687_000152_90452_91408 317
63 3300048905 Ga0496102_0000010 Ga0496102_0000010_99300_100262 317
64 3300048905 Ga0496102_0296709 Ga0496102_0296709_140_1102 317
65 3300048906 Ga0496103_0000082 Ga0496103_0000082_10838_11800 317
66 3300048907 Ga0496104_0053857 Ga0496104_0053857_2006_2968 317
67 3300048907 Ga0496104_0185783 Ga0496104_0185783_453_1415 317
68 3300048908 Ga0496105_0190159 Ga0496105_0190159_174_1136 317
69 3300048910 Ga0496107_0189696 Ga0496107_0189696_17_988 317
70 3300048911 Ga0496108_0005359 Ga0496108_0005359_1124_2086 317
71 3300048912 Ga0496109_0001652 Ga0496109_0001652_3784_4746 317
72 3300048913 Ga0496110_0059985 Ga0496110_0059985_1618_2580 317
73 3300048914 Ga0496111_0081271 Ga0496111_0081271_611_1573 317
74 3300048916 Ga0496113_0051841 Ga0496113_0051841_1211_2173 317
75 3300048917 Ga0496114_0301064 Ga0496114_0301064_356_1318 317
76 3300048919 Ga0496116_0004459 Ga0496116_0004459_10725_11687 317
77 3300048920 Ga0496117_0000037 Ga0496117_0000037_99890_100852 317
78 3300048921 Ga0496118_0000034 Ga0496118_0000034_97694_98656 317
79 3300048923 Ga0496120_0016240 Ga0496120_0016240_1259_2221 317
80 3300048927 Ga0496124_0000033 Ga0496124_0000033_97694_98656 317
81 3300049571 Ga0501034_0051251 Ga0501034_0051251_413_1378 317
82 3300049572 Ga0501036_0233759 Ga0501036_0233759_137_1102 317
83 3300049581 Ga0501047_0008090 Ga0501047_0008090_5232_6197 317
84 3300049583 Ga0501067_0002385 Ga0501067_0002385_296_1261 317
85 3300049586 Ga0501070_0009504 Ga0501070_0009504_292_1257 317
86 3300049589 Ga0501073_0017379 Ga0501073_0017379_409_1374 317
87 3300049590 Ga0501074_0014761 Ga0501074_0014761_880_1845 317
88 3300049741 Ga0501079_0008105 Ga0501079_0008105_6587_7552 317
89 3300049742 Ga0501080_0015887 Ga0501080_0015887_5444_6409 317
90 3300049822 Ga0501035_0002157 Ga0501035_0002157_11731_12696 317
91 3300049823 Ga0501044_0010959 Ga0501044_0010959_3431_4396 317
92 3300050507 nmdc:mga05p37_124990_c1 nmdc:mga05p37_124990_c1_2089_3051 317
93 3300050511 nmdc:mga08y16_70447_c1 nmdc:mga08y16_70447_c1_1194_2153 317
94 3300053079 Ga0500610_0000101 Ga0500610_0000101_21_977 317
95 3300053084 Ga0495595_0047830 Ga0495595_0047830_363_1325 317
96 3300053085 Ga0495619_0088688 Ga0495619_0088688_594_1556 317
97 3300053730 Ga0500645_002663 Ga0500645_002663_123_1079 317
98 3300054114 Ga0501084_0007919 Ga0501084_0007919_982_1947 317
99 3300006914 Ga0075436_100306310 Ga0075436_1003063101 318
100 3300007076 Ga0075435_100019220 Ga0075435_1000192203 318
101 3300035695 Ga0373927_0015725 Ga0373927_0015725_3319_4290 318
102 3300050512 nmdc:mga0n895_127947_c1 nmdc:mga0n895_127947_c1_1511_2485 318
103 3300050513 nmdc:mga0rr50_35907_c1 nmdc:mga0rr50_35907_c1_318_1292 318
104 3300053095 Ga0500640_051667 Ga0500640_051667_581_1543 318
105 3300031249 Ga0265339_10099610 Ga0265339_100996101 323
106 3300031712 Ga0265342_10051682 Ga0265342_100516822 323
107 3300042013 Ga0439456_000012 Ga0439456_000012_71194_72237 324
108 iso_pu_bacteria 2912963787 2912966696 328
109 iso_pu_bacteria 2939651529 2939655741 328
110 iso_pu_bacteria 8055878733 8055880397 328
111 3300009093 Ga0105240_10282089 Ga0105240_102820892 329
112 3300046507 Ga0495606_0156780 Ga0495606_0156780_188_1183 330
113 3300046558 Ga0495633_0000494 Ga0495633_0000494_1051_2046 330
114 3300046660 Ga0495625_0167472 Ga0495625_0167472_140_1135 330
115 3300046692 Ga0495671_0093788 Ga0495671_0093788_139_1134 330
116 3300005355 Ga0070671_100010764 Ga0070671_1000107642 331
117 3300009094 Ga0111539_10001089 Ga0111539_100010893 331
118 3300009147 Ga0114129_10000062 Ga0114129_1000006225 331
119 3300009148 Ga0105243_10004582 Ga0105243_1000458211 331
120 3300009176 Ga0105242_10495002 Ga0105242_104950021 331
121 3300025931 Ga0207644_10006974 Ga0207644_100069747 331
122 3300031595 Ga0265313_10021851 Ga0265313_100218512 331
123 3300046516 Ga0495628_0016870 Ga0495628_0016870_2766_3821 331
124 3300047471 Ga0495684_0061653 Ga0495684_0061653_143_1198 331
125 3300049587 Ga0501071_0015263 Ga0501071_0015263_2593_3612 331
126 3300050507 nmdc:mga05p37_564_c1 nmdc:mga05p37_564_c1_18458_19462 331
127 3300050508 nmdc:mga09592_7130_c1 nmdc:mga09592_7130_c1_1552_2556 331
128 3300050509 nmdc:mga0qj67_192884_c1 nmdc:mga0qj67_192884_c1_130_1134 331
129 3300050510 nmdc:mga06r32_191_c1 nmdc:mga06r32_191_c1_43788_44792 331
130 3300050511 nmdc:mga08y16_89_c1 nmdc:mga08y16_89_c1_58969_59973 331
131 3300005355 Ga0070671_100002133 Ga0070671_1000021338 332
132 3300005842 Ga0068858_100000418 Ga0068858_10000041819 332
133 3300009093 Ga0105240_10196292 Ga0105240_101962923 332
134 3300009147 Ga0114129_10099120 Ga0114129_100991202 332
135 3300009553 Ga0105249_10010570 Ga0105249_100105702 332
136 3300025900 Ga0207710_10001601 Ga0207710_100016019 332
137 3300025941 Ga0207711_10163211 Ga0207711_101632112 332
138 3300025961 Ga0207712_10019682 Ga0207712_100196822 332
139 3300025986 Ga0207658_10056784 Ga0207658_100567843 332
140 3300026035 Ga0207703_10003927 Ga0207703_100039278 332
141 3300026088 Ga0207641_10064687 Ga0207641_100646873 332
142 3300050507 nmdc:mga05p37_190858_c1 nmdc:mga05p37_190858_c1_1298_2311 332
143 3300050512 nmdc:mga0n895_254365_c1 nmdc:mga0n895_254365_c1_453_1466 332
144 3300014968 Ga0157379_10013521 Ga0157379_100135212 333
145 3300048929 Ga0496126_0000463 Ga0496126_0000463_49987_51006 334
146 3300021361 Ga0213872_10008768 Ga0213872_100087684 335
147 3300025920 Ga0207649_10000016 Ga0207649_10000016155 335
148 3300032005 Ga0307411_10078968 Ga0307411_100789682 335
149 3300039447 Ga0436361_0163275 Ga0436361_0163275_14210_15235 335
150 iso_pu_bacteria 2643221736 2644746485 335
151 iso_pu_bacteria 2739367756 2739792737 335
152 3300009101 Ga0105247_10000267 Ga0105247_1000026733 336
153 3300009177 Ga0105248_10019052 Ga0105248_100190525 336
154 3300013297 Ga0157378_10085814 Ga0157378_100858142 336
155 3300031250 Ga0265331_10000067 Ga0265331_1000006731 336
156 3300031711 Ga0265314_10049117 Ga0265314_100491172 336
157 3300035691 Ga0373931_0004736 Ga0373931_0004736_3377_4399 336
158 3300035692 Ga0373935_0013458 Ga0373935_0013458_1563_2585 336
159 3300044656 Ga0466969_0136845 Ga0466969_0136845_94_1122 336
160 3300044684 Ga0466966_0108505 Ga0466966_0108505_624_1652 336
161 3300045836 Ga0466958_0117236 Ga0466958_0117236_280_1308 336
162 3300048905 Ga0496102_0088810 Ga0496102_0088810_1066_2133 336
163 3300048914 Ga0496111_0257477 Ga0496111_0257477_86_1114 336
164 3300048922 Ga0496119_0048681 Ga0496119_0048681_1491_2558 336
165 3300048924 Ga0496121_0018754 Ga0496121_0018754_1121_2188 336
166 3300048928 Ga0496125_0017934 Ga0496125_0017934_4796_5863 336
167 iso_pu_bacteria 2643221629 2644164753 336
168 iso_pu_bacteria 2643221662 2644345975 336
169 iso_pu_bacteria 2841911363 2841912482 336
170 iso_pu_bacteria 2841917233 2841918237 336
171 3300003214 JGI25165J46597_1000035 JGI25165J46597_1000035136 337
172 3300005328 Ga0070676_10017083 Ga0070676_100170832 337
173 3300005338 Ga0068868_100051809 Ga0068868_1000518091 337
174 3300005535 Ga0070684_100057818 Ga0070684_1000578182 337
175 3300005563 Ga0068855_100173168 Ga0068855_1001731682 337
176 3300006881 Ga0068865_100333935 Ga0068865_1003339351 337
177 3300025924 Ga0207694_10061427 Ga0207694_100614273 337
178 3300025925 Ga0207650_10205773 Ga0207650_102057732 337
179 3300025949 Ga0207667_10102808 Ga0207667_101028083 337
180 3300046689 Ga0495613_0006941 Ga0495613_0006941_6866_7897 337
181 3300049571 Ga0501034_0000286 Ga0501034_0000286_49093_50115 337
182 3300049744 Ga0501083_0052719 Ga0501083_0052719_137_1159 337
183 3300049744 Ga0501083_0186988 Ga0501083_0186988_127_1149 337
184 3300050512 nmdc:mga0n895_54746_c1 nmdc:mga0n895_54746_c1_2297_3322 337
185 3300050513 nmdc:mga0rr50_93255_c1 nmdc:mga0rr50_93255_c1_238_1263 337
186 3300060353 Ga0501082_0088124 Ga0501082_0088124_51_1073 337
187 3300003320 rootH2_10032630 rootH2_100326302 338
188 3300003320 rootH2_10047068 rootH2_100470681 338
189 3300003322 rootL2_10101751 rootL2_101017514 338
190 3300003323 rootH1_10037990 rootH1_100379901 338
191 3300005344 Ga0070661_100000254 Ga0070661_1000002542 338
192 3300005535 Ga0070684_100127310 Ga0070684_1001273102 338
193 3300006846 Ga0075430_100015106 Ga0075430_1000151069 338
194 3300015684 Ga0183365_10001 Ga0183365_10001495 338
195 3300025920 Ga0207649_10000026 Ga0207649_1000002622 338
196 3300029957 Ga0265324_10048288 Ga0265324_100482881 338
197 3300031250 Ga0265331_10000008 Ga0265331_10000008144 338
198 3300031251 Ga0265327_10000036 Ga0265327_1000003624 338
199 3300039447 Ga0436361_0765979 Ga0436361_0765979_3195_4223 338
200 3300049570 Ga0501033_0022975 Ga0501033_0022975_1092_2129 338
201 3300049571 Ga0501034_0008706 Ga0501034_0008706_4189_5247 338
202 3300049573 Ga0501037_0098885 Ga0501037_0098885_267_1325 338
203 3300049574 Ga0501038_0275980 Ga0501038_0275980_113_1150 338
204 3300049580 Ga0501046_0014467 Ga0501046_0014467_4928_5965 338
205 3300049580 Ga0501046_0299916 Ga0501046_0299916_39_1076 338
206 3300049581 Ga0501047_0110150 Ga0501047_0110150_40_1077 338
207 3300049586 Ga0501070_0070443 Ga0501070_0070443_482_1519 338
208 3300049589 Ga0501073_0013297 Ga0501073_0013297_2028_3065 338
209 3300049822 Ga0501035_0052277 Ga0501035_0052277_322_1359 338
210 3300049823 Ga0501044_0065211 Ga0501044_0065211_1384_2442 338
211 3300050509 nmdc:mga0qj67_445_c1 nmdc:mga0qj67_445_c1_18397_19422 338
212 3300053117 Ga0500593_000072 Ga0500593_000072_14586_15617 338
213 3300053139 Ga0500568_0000005 Ga0500568_0000005_218912_219943 338
214 3300005338 Ga0068868_100121511 Ga0068868_1001215113 339
215 3300005341 Ga0070691_10000033 Ga0070691_1000003339 339
216 3300005344 Ga0070661_100172027 Ga0070661_1001720271 339
217 3300005366 Ga0070659_100033544 Ga0070659_1000335443 339
218 3300005434 Ga0070709_10000408 Ga0070709_1000040820 339
219 3300005436 Ga0070713_100000333 Ga0070713_10000033325 339
220 3300005439 Ga0070711_100072538 Ga0070711_1000725381 339
221 3300005440 Ga0070705_100053020 Ga0070705_1000530201 339
222 3300005539 Ga0068853_100001647 Ga0068853_1000016472 339
223 3300005548 Ga0070665_100215364 Ga0070665_1002153642 339
224 3300005563 Ga0068855_100262254 Ga0068855_1002622542 339
225 3300005577 Ga0068857_100001587 Ga0068857_10000158719 339
226 3300005578 Ga0068854_100047630 Ga0068854_1000476302 339
227 3300005578 Ga0068854_100262141 Ga0068854_1002621412 339
228 3300005614 Ga0068856_100001518 Ga0068856_10000151824 339
229 3300005614 Ga0068856_100031963 Ga0068856_1000319633 339
230 3300005614 Ga0068856_100050666 Ga0068856_1000506665 339
231 3300005616 Ga0068852_100023036 Ga0068852_1000230366 339
232 3300005616 Ga0068852_100059581 Ga0068852_1000595814 339
233 3300005842 Ga0068858_100009723 Ga0068858_1000097239 339
234 3300005842 Ga0068858_100207204 Ga0068858_1002072042 339
235 3300006175 Ga0070712_100000023 Ga0070712_10000002357 339
236 3300006175 Ga0070712_100000803 Ga0070712_10000080319 339
237 3300006914 Ga0075436_100000211 Ga0075436_1000002116 339
238 3300007076 Ga0075435_100243105 Ga0075435_1002431052 339
239 3300009174 Ga0105241_10027427 Ga0105241_100274274 339
240 3300009551 Ga0105238_10299226 Ga0105238_102992262 339
241 3300010375 Ga0105239_10069699 Ga0105239_100696992 339
242 3300014968 Ga0157379_10015138 Ga0157379_100151389 339
243 3300014968 Ga0157379_10035127 Ga0157379_100351272 339
244 3300025906 Ga0207699_10000280 Ga0207699_1000028011 339
245 3300025909 Ga0207705_10039852 Ga0207705_100398522 339
246 3300025909 Ga0207705_10044154 Ga0207705_100441543 339
247 3300025912 Ga0207707_10190318 Ga0207707_101903181 339
248 3300025915 Ga0207693_10000018 Ga0207693_10000018120 339
249 3300025915 Ga0207693_10000534 Ga0207693_1000053419 339
250 3300025916 Ga0207663_10011828 Ga0207663_100118284 339
251 3300025916 Ga0207663_10255552 Ga0207663_102555522 339
252 3300025919 Ga0207657_10037832 Ga0207657_100378323 339
253 3300025920 Ga0207649_10105962 Ga0207649_101059622 339
254 3300025920 Ga0207649_10129052 Ga0207649_101290521 339
255 3300025924 Ga0207694_10039727 Ga0207694_100397272 339
256 3300025924 Ga0207694_10117694 Ga0207694_101176942 339
257 3300025928 Ga0207700_10000026 Ga0207700_1000002641 339
258 3300025949 Ga0207667_10010243 Ga0207667_100102434 339
259 3300025949 Ga0207667_10192437 Ga0207667_101924371 339
260 3300025981 Ga0207640_10169283 Ga0207640_101692832 339
261 3300026023 Ga0207677_10465194 Ga0207677_104651941 339
262 3300026035 Ga0207703_10006685 Ga0207703_100066859 339
263 3300026078 Ga0207702_10000592 Ga0207702_100005925 339
264 3300026078 Ga0207702_10003947 Ga0207702_1000394713 339
265 3300026078 Ga0207702_10086962 Ga0207702_100869624 339
266 3300026078 Ga0207702_10094682 Ga0207702_100946822 339
267 3300026116 Ga0207674_10000134 Ga0207674_1000013448 339
268 3300026116 Ga0207674_10034643 Ga0207674_100346433 339
269 3300026142 Ga0207698_10013227 Ga0207698_100132276 339
270 3300026142 Ga0207698_10039343 Ga0207698_100393432 339
271 3300028563 Ga0265319_1033409 Ga0265319_10334092 339
272 3300028577 Ga0265318_10016634 Ga0265318_100166343 339
273 3300031238 Ga0265332_10056104 Ga0265332_100561042 339
274 3300031241 Ga0265325_10000365 Ga0265325_1000036517 339
275 3300031249 Ga0265339_10006412 Ga0265339_100064128 339
276 3300031344 Ga0265316_10013136 Ga0265316_100131368 339
277 3300031595 Ga0265313_10006830 Ga0265313_100068302 339
278 3300035172 Ga0373955_0119421 Ga0373955_0119421_410_1444 339
279 3300036401 Ga0373937_0023121 Ga0373937_0023121_4008_5042 339
280 3300048910 Ga0496107_0253421 Ga0496107_0253421_49_1083 339
281 3300048914 Ga0496111_0224106 Ga0496111_0224106_175_1209 339
282 3300049568 Ga0501031_0017718 Ga0501031_0017718_1239_2270 339
283 3300049572 Ga0501036_0278359 Ga0501036_0278359_44_1072 339
284 3300049574 Ga0501038_0131515 Ga0501038_0131515_697_1725 339
285 3300049575 Ga0501039_0022369 Ga0501039_0022369_1239_2270 339
286 3300049581 Ga0501047_0079020 Ga0501047_0079020_695_1726 339
287 3300049742 Ga0501080_0007490 Ga0501080_0007490_1651_2685 339
288 3300049822 Ga0501035_0165668 Ga0501035_0165668_806_1834 339
289 3300050512 nmdc:mga0n895_102394_c1 nmdc:mga0n895_102394_c1_1756_2790 339
290 3300050513 nmdc:mga0rr50_230908_c1 nmdc:mga0rr50_230908_c1_397_1431 339
291 3300050514 nmdc:mga08x19_54_c1 nmdc:mga08x19_54_c1_84824_85858 339
292 3300053120 Ga0500597_000402 Ga0500597_000402_305_1330 339
293 3300053157 Ga0500624_000003 Ga0500624_000003_88140_89165 339
294 3300053178 Ga0500637_0000073 Ga0500637_0000073_2743_3768 339
295 3300006871 Ga0075434_100367380 Ga0075434_1003673802 340
296 3300025904 Ga0207647_10173592 Ga0207647_101735922 340
297 3300039438 Ga0436360_0298857 Ga0436360_0298857_3663_4736 340
298 3300039447 Ga0436361_0606425 Ga0436361_0606425_838_1911 340
299 3300059421 Ga0590071_006680 Ga0590071_006680_122_1159 340
300 3300005548 Ga0070665_100011861 Ga0070665_1000118616 341
301 3300005617 Ga0068859_100018002 Ga0068859_10001800211 341
302 3300005719 Ga0068861_100368274 Ga0068861_1003682741 341
303 3300006871 Ga0075434_100048864 Ga0075434_1000488643 341
304 3300021358 Ga0213873_10000216 Ga0213873_100002163 341
305 3300021384 Ga0213876_10000056 Ga0213876_10000056140 341
306 3300021384 Ga0213876_10000258 Ga0213876_1000025841 341
307 3300026118 Ga0207675_100293639 Ga0207675_1002936393 341
308 3300028381 Ga0268264_10028296 Ga0268264_100282964 341
309 3300039437 Ga0436365_0083543 Ga0436365_0083543_2056_3081 341
310 3300039437 Ga0436365_0456925 Ga0436365_0456925_4498_5523 341
311 3300039453 Ga0436362_1001952 Ga0436362_1001952_2063_3088 341
312 3300050512 nmdc:mga0n895_98404_c1 nmdc:mga0n895_98404_c1_1094_2119 341
313 3300005330 Ga0070690_100000690 Ga0070690_1000006907 342
314 3300005331 Ga0070670_100003735 Ga0070670_10000373515 342
315 3300005334 Ga0068869_100066800 Ga0068869_1000668001 342
316 3300005335 Ga0070666_10000975 Ga0070666_100009755 342
317 3300005337 Ga0070682_100000564 Ga0070682_10000056410 342
318 3300005338 Ga0068868_100003140 Ga0068868_10000314011 342
319 3300005339 Ga0070660_100000165 Ga0070660_10000016523 342
320 3300005340 Ga0070689_100000246 Ga0070689_10000024624 342
321 3300005341 Ga0070691_10011597 Ga0070691_100115973 342
322 3300005343 Ga0070687_100000312 Ga0070687_10000031213 342
323 3300005344 Ga0070661_100001432 Ga0070661_1000014324 342
324 3300005345 Ga0070692_10009631 Ga0070692_100096314 342
325 3300005347 Ga0070668_100006205 Ga0070668_1000062057 342
326 3300005354 Ga0070675_100000971 Ga0070675_10000097124 342
327 3300005356 Ga0070674_100005136 Ga0070674_1000051363 342
328 3300005364 Ga0070673_100003617 Ga0070673_10000361710 342
329 3300005365 Ga0070688_100000574 Ga0070688_10000057421 342
330 3300005366 Ga0070659_100058602 Ga0070659_1000586022 342
331 3300005406 Ga0070703_10003711 Ga0070703_100037114 342
332 3300005435 Ga0070714_100005811 Ga0070714_1000058116 342
333 3300005436 Ga0070713_100312760 Ga0070713_1003127602 342
334 3300005437 Ga0070710_10080590 Ga0070710_100805901 342
335 3300005438 Ga0070701_10001677 Ga0070701_100016777 342
336 3300005439 Ga0070711_100009937 Ga0070711_1000099375 342
337 3300005441 Ga0070700_100000481 Ga0070700_10000048117 342
338 3300005444 Ga0070694_100001363 Ga0070694_1000013634 342
339 3300005455 Ga0070663_100000282 Ga0070663_1000002829 342
340 3300005456 Ga0070678_100003280 Ga0070678_10000328010 342
341 3300005457 Ga0070662_100012028 Ga0070662_1000120285 342
342 3300005466 Ga0070685_10014004 Ga0070685_100140044 342
343 3300005518 Ga0070699_100068566 Ga0070699_1000685664 342
344 3300005530 Ga0070679_100045870 Ga0070679_1000458702 342
345 3300005536 Ga0070697_100005504 Ga0070697_10000550411 342
346 3300005543 Ga0070672_100010669 Ga0070672_1000106692 342
347 3300005544 Ga0070686_100002667 Ga0070686_1000026678 342
348 3300005545 Ga0070695_100071581 Ga0070695_1000715813 342
349 3300005546 Ga0070696_100005997 Ga0070696_1000059975 342
350 3300005547 Ga0070693_100000877 Ga0070693_10000087710 342
351 3300005549 Ga0070704_100000285 Ga0070704_1000002853 342
352 3300005563 Ga0068855_100030880 Ga0068855_1000308803 342
353 3300005564 Ga0070664_100003522 Ga0070664_10000352210 342
354 3300005577 Ga0068857_100006351 Ga0068857_10000635111 342
355 3300005578 Ga0068854_100000765 Ga0068854_1000007657 342
356 3300005614 Ga0068856_100001586 Ga0068856_10000158620 342
357 3300005615 Ga0070702_100001487 Ga0070702_1000014877 342
358 3300005617 Ga0068859_100064866 Ga0068859_1000648666 342
359 3300005618 Ga0068864_100006600 Ga0068864_1000066006 342
360 3300005718 Ga0068866_10027542 Ga0068866_100275423 342
361 3300005719 Ga0068861_100045965 Ga0068861_1000459653 342
362 3300005834 Ga0068851_10087373 Ga0068851_100873732 342
363 3300005841 Ga0068863_100000964 Ga0068863_1000009649 342
364 3300005841 Ga0068863_100285650 Ga0068863_1002856502 342
365 3300005842 Ga0068858_100013968 Ga0068858_1000139688 342
366 3300005844 Ga0068862_100000734 Ga0068862_10000073421 342
367 3300006163 Ga0070715_10000723 Ga0070715_100007233 342
368 3300006173 Ga0070716_100000247 Ga0070716_10000024711 342
369 3300006175 Ga0070712_100001127 Ga0070712_1000011275 342
370 3300006237 Ga0097621_100008931 Ga0097621_1000089314 342
371 3300006358 Ga0068871_100045364 Ga0068871_1000453643 342
372 3300006844 Ga0075428_100000606 Ga0075428_1000006062 342
373 3300006847 Ga0075431_100000032 Ga0075431_10000003252 342
374 3300006847 Ga0075431_100003366 Ga0075431_10000336616 342
375 3300006852 Ga0075433_10126003 Ga0075433_101260031 342
376 3300006871 Ga0075434_100121785 Ga0075434_1001217851 342
377 3300006880 Ga0075429_100008370 Ga0075429_1000083703 342
378 3300006881 Ga0068865_100002428 Ga0068865_10000242811 342
379 3300006914 Ga0075436_100001146 Ga0075436_10000114611 342
380 3300006931 Ga0097620_100064871 Ga0097620_1000648716 342
381 3300009098 Ga0105245_10001371 Ga0105245_1000137128 342
382 3300009101 Ga0105247_10000490 Ga0105247_1000049015 342
383 3300009148 Ga0105243_10012302 Ga0105243_100123026 342
384 3300009174 Ga0105241_10004507 Ga0105241_100045075 342
385 3300009177 Ga0105248_10000546 Ga0105248_1000054656 342
386 3300009551 Ga0105238_10064606 Ga0105238_100646063 342
387 3300010375 Ga0105239_10014493 Ga0105239_100144934 342
388 3300011119 Ga0105246_10000573 Ga0105246_1000057322 342
389 3300013100 Ga0157373_10002592 Ga0157373_100025926 342
390 3300013102 Ga0157371_10052012 Ga0157371_100520122 342
391 3300013105 Ga0157369_10001029 Ga0157369_100010299 342
392 3300013307 Ga0157372_10002818 Ga0157372_1000281823 342
393 3300013308 Ga0157375_10032115 Ga0157375_100321153 342
394 3300014325 Ga0163163_10018194 Ga0163163_100181946 342
395 3300014745 Ga0157377_10002609 Ga0157377_100026093 342
396 3300014968 Ga0157379_10001147 Ga0157379_100011472 342
397 3300014969 Ga0157376_10024439 Ga0157376_100244395 342
398 3300025899 Ga0207642_10082837 Ga0207642_100828372 342
399 3300025901 Ga0207688_10000468 Ga0207688_1000046811 342
400 3300025903 Ga0207680_10127066 Ga0207680_101270661 342
401 3300025904 Ga0207647_10002881 Ga0207647_100028815 342
402 3300025906 Ga0207699_10018169 Ga0207699_100181692 342
403 3300025915 Ga0207693_10000267 Ga0207693_1000026727 342
404 3300025916 Ga0207663_10000947 Ga0207663_1000094711 342
405 3300025918 Ga0207662_10000454 Ga0207662_1000045411 342
406 3300025919 Ga0207657_10000170 Ga0207657_1000017046 342
407 3300025920 Ga0207649_10032359 Ga0207649_100323591 342
408 3300025921 Ga0207652_10008354 Ga0207652_100083542 342
409 3300025923 Ga0207681_10237794 Ga0207681_102377941 342
410 3300025924 Ga0207694_10034592 Ga0207694_100345923 342
411 3300025927 Ga0207687_10018502 Ga0207687_100185025 342
412 3300025931 Ga0207644_10008396 Ga0207644_100083963 342
413 3300025932 Ga0207690_10002244 Ga0207690_1000224414 342
414 3300025933 Ga0207706_10000421 Ga0207706_1000042115 342
415 3300025934 Ga0207686_10003249 Ga0207686_1000324910 342
416 3300025935 Ga0207709_10110538 Ga0207709_101105382 342
417 3300025936 Ga0207670_10012918 Ga0207670_100129183 342
418 3300025937 Ga0207669_10014939 Ga0207669_100149394 342
419 3300025938 Ga0207704_10013657 Ga0207704_100136575 342
420 3300025939 Ga0207665_10000696 Ga0207665_100006965 342
421 3300025940 Ga0207691_10019645 Ga0207691_100196458 342
422 3300025941 Ga0207711_10037179 Ga0207711_100371793 342
423 3300025942 Ga0207689_10210012 Ga0207689_102100121 342
424 3300025945 Ga0207679_10143335 Ga0207679_101433351 342
425 3300025949 Ga0207667_10015513 Ga0207667_100155138 342
426 3300025960 Ga0207651_10022299 Ga0207651_100222994 342
427 3300025961 Ga0207712_10007229 Ga0207712_100072294 342
428 3300025972 Ga0207668_10001754 Ga0207668_100017543 342
429 3300026023 Ga0207677_10020778 Ga0207677_100207781 342
430 3300026067 Ga0207678_10000210 Ga0207678_1000021034 342
431 3300026078 Ga0207702_10040468 Ga0207702_100404683 342
432 3300026088 Ga0207641_10002237 Ga0207641_1000223713 342
433 3300026088 Ga0207641_10055921 Ga0207641_100559214 342
434 3300026095 Ga0207676_10013348 Ga0207676_100133482 342
435 3300026116 Ga0207674_10001169 Ga0207674_100011693 342
436 3300026118 Ga0207675_100000311 Ga0207675_10000031134 342
437 3300026121 Ga0207683_10000192 Ga0207683_1000019226 342
438 3300028380 Ga0268265_10010125 Ga0268265_100101257 342
439 3300031250 Ga0265331_10024816 Ga0265331_100248163 342
440 3300031711 Ga0265314_10002746 Ga0265314_100027468 342
441 3300035092 Ga0373952_0012269 Ga0373952_0012269_12_1061 342
442 3300035114 Ga0373939_0010689 Ga0373939_0010689_433_1482 342
443 3300035207 Ga0373942_0015942 Ga0373942_0015942_253_1302 342
444 3300035691 Ga0373931_0007222 Ga0373931_0007222_3657_4706 342
445 3300037418 Ga0395900_0024597 Ga0395900_0024597_3653_4702 342
446 3300037466 Ga0395898_0011788 Ga0395898_0011788_5072_6121 342
447 3300037471 Ga0395905_0001746 Ga0395905_0001746_21138_22187 342
448 3300038443 Ga0395901_0029521 Ga0395901_0029521_4571_5620 342
449 3300041441 Ga0451787_345757 Ga0451787_345757_73_1101 342
450 3300048903 Ga0496100_0011653 Ga0496100_0011653_1973_3022 342
451 3300048904 Ga0496101_0031856 Ga0496101_0031856_1919_2968 342
452 3300048905 Ga0496102_0336537 Ga0496102_0336537_282_1331 342
453 3300048906 Ga0496103_0024985 Ga0496103_0024985_2047_3096 342
454 3300048907 Ga0496104_0037107 Ga0496104_0037107_1519_2568 342
455 3300048908 Ga0496105_0046110 Ga0496105_0046110_630_1679 342
456 3300048909 Ga0496106_0056041 Ga0496106_0056041_1208_2257 342
457 3300048910 Ga0496107_0019441 Ga0496107_0019441_512_1561 342
458 3300048913 Ga0496110_0197855 Ga0496110_0197855_512_1561 342
459 3300048914 Ga0496111_0041330 Ga0496111_0041330_1519_2568 342
460 3300048915 Ga0496112_0069480 Ga0496112_0069480_1919_2968 342
461 3300048916 Ga0496113_0007975 Ga0496113_0007975_2581_3630 342
462 3300048917 Ga0496114_0002662 Ga0496114_0002662_3128_4177 342
463 3300048917 Ga0496114_0016017 Ga0496114_0016017_3998_5029 342
464 3300048918 Ga0496115_0041710 Ga0496115_0041710_1086_2135 342
465 3300050512 nmdc:mga0n895_37597_c1 nmdc:mga0n895_37597_c1_1193_2242 342
466 3300050513 nmdc:mga0rr50_139249_c1 nmdc:mga0rr50_139249_c1_90_1139 342
467 3300050515 nmdc:mga0a205_13445_c1 nmdc:mga0a205_13445_c1_4053_5102 342
468 3300053177 Ga0500636_0009480 Ga0500636_0009480_3700_4731 342
469 3300005337 Ga0070682_100085548 Ga0070682_1000855483 343
470 3300005455 Ga0070663_100020507 Ga0070663_1000205074 343
471 3300005458 Ga0070681_10083693 Ga0070681_100836932 343
472 3300005547 Ga0070693_100048717 Ga0070693_1000487173 343
473 3300005615 Ga0070702_100256000 Ga0070702_1002560001 343
474 3300013297 Ga0157378_10325268 Ga0157378_103252681 343
475 3300013307 Ga0157372_10419041 Ga0157372_104190411 343
476 3300013308 Ga0157375_10412256 Ga0157375_104122561 343
477 3300026067 Ga0207678_10118717 Ga0207678_101187172 343
478 3300027876 Ga0209974_10011378 Ga0209974_100113782 343
479 3300044842 Ga0466957_0049582 Ga0466957_0049582_99_1130 343
480 3300048910 Ga0496107_0118510 Ga0496107_0118510_622_1674 343
481 3300048918 Ga0496115_0047342 Ga0496115_0047342_644_1696 343
482 3300031235 Ga0265330_10114450 Ga0265330_101144501 344
483 3300049571 Ga0501034_0008957 Ga0501034_0008957_8590_9660 344
484 3300049823 Ga0501044_0047773 Ga0501044_0047773_2298_3368 344
485 3300054114 Ga0501084_0438181 Ga0501084_0438181_49_1095 344
486 3300025735 Ga0207713_1024811 Ga0207713_10248111 345
487 3300025913 Ga0207695_10051375 Ga0207695_100513753 345
488 3300001979 JGI24740J21852_10003772 JGI24740J21852_100037727 346
489 3300001990 JGI24737J22298_10002929 JGI24737J22298_100029292 346
490 3300003215 JGI25153J46596_10001130 JGI25153J46596_1000113019 346
491 3300003759 Ga0055525_1000118 Ga0055525_100011862 346
492 3300003762 Ga0055542_1000076 Ga0055542_100007631 346
493 3300003763 Ga0055529_1000004 Ga0055529_1000004113 346
494 3300005327 Ga0070658_10115022 Ga0070658_101150222 346
495 3300005331 Ga0070670_100187560 Ga0070670_1001875601 346
496 3300005356 Ga0070674_100139041 Ga0070674_1001390411 346
497 3300005367 Ga0070667_100040302 Ga0070667_1000403023 346
498 3300005455 Ga0070663_100108502 Ga0070663_1001085022 346
499 3300005456 Ga0070678_100010458 Ga0070678_1000104583 346
500 3300005457 Ga0070662_100267714 Ga0070662_1002677141 346
501 3300005543 Ga0070672_100059310 Ga0070672_1000593102 346
502 3300005548 Ga0070665_100000043 Ga0070665_100000043278 346
503 3300005548 Ga0070665_100373194 Ga0070665_1003731941 346
504 3300005564 Ga0070664_100063592 Ga0070664_1000635922 346
505 3300005617 Ga0068859_100250946 Ga0068859_1002509462 346
506 3300005834 Ga0068851_10097427 Ga0068851_100974271 346
507 3300006186 Ga0075369_10024851 Ga0075369_100248511 346
508 3300006195 Ga0075366_10042391 Ga0075366_100423911 346
509 3300006358 Ga0068871_100071010 Ga0068871_1000710102 346
510 3300009148 Ga0105243_10000490 Ga0105243_1000049020 346
511 3300009174 Ga0105241_10006458 Ga0105241_1000645812 346
512 3300009545 Ga0105237_10240008 Ga0105237_102400082 346
513 3300009551 Ga0105238_10214035 Ga0105238_102140352 346
514 3300010375 Ga0105239_10570602 Ga0105239_105706021 346
515 3300012506 Ga0157324_1000358 Ga0157324_10003583 346
516 3300013100 Ga0157373_10093369 Ga0157373_100933692 346
517 3300013102 Ga0157371_10000062 Ga0157371_1000006280 346
518 3300013105 Ga0157369_10420092 Ga0157369_104200922 346
519 3300013307 Ga0157372_10419686 Ga0157372_104196861 346
520 3300025230 Ga0209563_100070 Ga0209563_10007061 346
521 3300025246 Ga0209646_1009815 Ga0209646_10098152 346
522 3300025254 Ga0209148_1000008 Ga0209148_1000008605 346
523 3300025261 Ga0209233_1032486 Ga0209233_10324861 346
524 3300025272 Ga0209455_1000002 Ga0209455_1000002819 346
525 3300025297 Ga0209758_1000007 Ga0209758_1000007720 346
526 3300025321 Ga0207656_10000493 Ga0207656_100004933 346
527 3300025907 Ga0207645_10201891 Ga0207645_102018911 346
528 3300025911 Ga0207654_10000226 Ga0207654_1000022612 346
529 3300025913 Ga0207695_10016920 Ga0207695_100169203 346
530 3300025914 Ga0207671_10032982 Ga0207671_100329822 346
531 3300025919 Ga0207657_10009722 Ga0207657_100097223 346
532 3300025920 Ga0207649_10011028 Ga0207649_100110286 346
533 3300025924 Ga0207694_10027016 Ga0207694_100270163 346
534 3300025925 Ga0207650_10031979 Ga0207650_100319791 346
535 3300025932 Ga0207690_10003226 Ga0207690_100032263 346
536 3300025933 Ga0207706_10084929 Ga0207706_100849293 346
537 3300025935 Ga0207709_10000005 Ga0207709_10000005580 346
538 3300025937 Ga0207669_10005383 Ga0207669_100053836 346
539 3300025940 Ga0207691_10044642 Ga0207691_100446424 346
540 3300025945 Ga0207679_10025050 Ga0207679_100250503 346
541 3300025949 Ga0207667_10000001 Ga0207667_100000011099 346
542 3300025949 Ga0207667_10009832 Ga0207667_1000983212 346
543 3300025981 Ga0207640_10002461 Ga0207640_100024613 346
544 3300025986 Ga0207658_10018107 Ga0207658_100181074 346
545 3300026041 Ga0207639_10007127 Ga0207639_100071278 346
546 3300026067 Ga0207678_10007090 Ga0207678_1000709012 346
547 3300026078 Ga0207702_10000862 Ga0207702_1000086214 346
548 3300026116 Ga0207674_10013140 Ga0207674_100131403 346
549 3300026121 Ga0207683_10002482 Ga0207683_100024826 346
550 3300026121 Ga0207683_10355248 Ga0207683_103552482 346
551 3300026142 Ga0207698_10001942 Ga0207698_1000194214 346
552 3300028379 Ga0268266_10000002 Ga0268266_10000002314 346
553 3300028379 Ga0268266_10036274 Ga0268266_100362744 346
554 3300028786 Ga0307517_10012984 Ga0307517_1001298412 346
555 3300028786 Ga0307517_10052987 Ga0307517_100529873 346
556 3300031456 Ga0307513_10080372 Ga0307513_100803722 346
557 3300037312 Ga0395899_0169452 Ga0395899_0169452_454_1497 346
558 3300037471 Ga0395905_0492486 Ga0395905_0492486_12_1055 346
559 3300046459 Ga0495629_0020819 Ga0495629_0020819_1907_2950 346
560 3300046471 Ga0495650_0012193 Ga0495650_0012193_854_1897 346
561 3300046491 Ga0495584_0133840 Ga0495584_0133840_76_1119 346
562 3300046492 Ga0495585_0019768 Ga0495585_0019768_1924_2967 346
563 3300046492 Ga0495585_0096486 Ga0495585_0096486_158_1201 346
564 3300046506 Ga0495583_0051520 Ga0495583_0051520_482_1525 346
565 3300046507 Ga0495606_0002116 Ga0495606_0002116_19917_20960 346
566 3300046520 Ga0495637_0012078 Ga0495637_0012078_472_1515 346
567 3300046522 Ga0495643_0001994 Ga0495643_0001994_8649_9692 346
568 3300046524 Ga0495648_0000323 Ga0495648_0000323_27495_28538 346
569 3300046525 Ga0495663_0008715 Ga0495663_0008715_353_1396 346
570 3300046528 Ga0495642_0011218 Ga0495642_0011218_1125_2168 346
571 3300046536 Ga0495587_0040230 Ga0495587_0040230_939_1982 346
572 3300046542 Ga0495597_0089462 Ga0495597_0089462_108_1151 346
573 3300046557 Ga0495622_0012236 Ga0495622_0012236_1105_2148 346
574 3300046616 Ga0495668_0000059 Ga0495668_0000059_146423_147466 346
575 3300046648 Ga0495611_0051772 Ga0495611_0051772_104_1147 346
576 3300046648 Ga0495611_0121531 Ga0495611_0121531_122_1165 346
577 3300046660 Ga0495625_0000559 Ga0495625_0000559_43248_44291 346
578 3300046660 Ga0495625_0093589 Ga0495625_0093589_71_1114 346
579 3300046680 Ga0495646_0114196 Ga0495646_0114196_367_1410 346
580 3300046689 Ga0495613_0254987 Ga0495613_0254987_150_1193 346
581 3300046691 Ga0495670_0099123 Ga0495670_0099123_159_1202 346
582 3300046694 Ga0495649_0033503 Ga0495649_0033503_1036_2079 346
583 3300046809 Ga0495600_0006647 Ga0495600_0006647_1887_2930 346
584 3300047323 Ga0495683_0047147 Ga0495683_0047147_937_1980 346
585 3300047323 Ga0495683_0069502 Ga0495683_0069502_134_1177 346
586 3300047443 Ga0495687_000517 Ga0495687_000517_1157_2200 346
587 3300047445 Ga0495677_0009651 Ga0495677_0009651_1263_2306 346
588 3300047469 Ga0495673_0044873 Ga0495673_0044873_92_1135 346
589 3300047470 Ga0495681_0006423 Ga0495681_0006423_1113_2156 346
590 3300047472 Ga0495686_0000209 Ga0495686_0000209_48759_49802 346
591 3300048905 Ga0496102_0000184 Ga0496102_0000184_81531_82574 346
592 3300048906 Ga0496103_0000099 Ga0496103_0000099_1327_2370 346
593 3300048907 Ga0496104_0002902 Ga0496104_0002902_952_1995 346
594 3300048908 Ga0496105_0000589 Ga0496105_0000589_21930_22973 346
595 3300048913 Ga0496110_0080817 Ga0496110_0080817_925_1968 346
596 3300048916 Ga0496113_0059974 Ga0496113_0059974_1637_2680 346
597 3300048918 Ga0496115_0000066 Ga0496115_0000066_91632_92675 346
598 3300048919 Ga0496116_0020607 Ga0496116_0020607_126_1169 346
599 3300048920 Ga0496117_0001024 Ga0496117_0001024_1657_2700 346
600 3300048921 Ga0496118_0000154 Ga0496118_0000154_78216_79259 346
601 3300048922 Ga0496119_0036254 Ga0496119_0036254_438_1481 346
602 3300048924 Ga0496121_0010925 Ga0496121_0010925_1953_2996 346
603 3300048925 Ga0496122_0024680 Ga0496122_0024680_3407_4450 346
604 3300048926 Ga0496123_0029886 Ga0496123_0029886_470_1513 346
605 3300048927 Ga0496124_0000291 Ga0496124_0000291_91430_92473 346
606 3300048928 Ga0496125_0001248 Ga0496125_0001248_35282_36325 346
607 3300048929 Ga0496126_0001079 Ga0496126_0001079_42936_43979 346
608 3300050493 nmdc:mga0k408_48360_c1 nmdc:mga0k408_48360_c1_510_1553 346
609 3300053119 Ga0500595_005603 Ga0500595_005603_2524_3567 346
610 3300053121 Ga0500607_011812 Ga0500607_011812_3852_4895 346
611 3300053130 Ga0500642_0000830 Ga0500642_0000830_758_1801 346
612 3300021361 Ga0213872_10016799 Ga0213872_100167994 347
613 3300039447 Ga0436361_1004845 Ga0436361_1004845_5488_6579 347
614 3300032004 Ga0307414_10000567 Ga0307414_1000056713 348
615 3300044656 Ga0466969_0048192 Ga0466969_0048192_525_1706 348
616 3300001979 JGI24740J21852_10025944 JGI24740J21852_100259443 349
617 3300009011 Ga0105251_10003975 Ga0105251_100039752 349
618 3300039447 Ga0436361_0570909 Ga0436361_0570909_613_1920 350
619 3300037068 Ga0373925_0273977 Ga0373925_0273977_155_1306 353
620 3300048921 Ga0496118_0004003 Ga0496118_0004003_15471_16541 353
621 3300001904 JGI24736J21556_1005710 JGI24736J21556_10057103 354
622 3300001989 JGI24739J22299_10000250 JGI24739J22299_1000025013 354
623 3300001990 JGI24737J22298_10003302 JGI24737J22298_100033026 354
624 3300002067 JGI24735J21928_10000409 JGI24735J21928_100004098 354
625 3300002075 JGI24738J21930_10000103 JGI24738J21930_1000010315 354
626 3300003316 rootH1_10079800 rootH1_100798001 354
627 3300005366 Ga0070659_100140258 Ga0070659_1001402581 354
628 3300005457 Ga0070662_100048172 Ga0070662_1000481721 354
629 3300005539 Ga0068853_100119846 Ga0068853_1001198463 354
630 3300025904 Ga0207647_10000782 Ga0207647_1000078218 354
631 3300025933 Ga0207706_10063657 Ga0207706_100636573 354
632 3300044842 Ga0466957_0091550 Ga0466957_0091550_199_1272 354
633 3300047443 Ga0495687_028628 Ga0495687_028628_569_1642 354

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

27

211

0.96

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

203

422

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r3s-assembly1.cif.gz_A uroporphyrinogen decarboxylase single mutant d86g in complex with coproporphyrinogen-i 0.9606 20 353
1r3q-assembly1.cif.gz_A uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i 0.9601 20 353
1r3w-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase y164f mutant in complex with coproporphyrinogen-iii 0.9596 20 353
1jph-assembly1.cif.gz_A-2 ile260thr mutant of human urod, human uroporphyrinogen iii decarboxylase 0.9594 20 353
3gw3-assembly1.cif.gz_A-2 human urod mutant k297n 0.9591 20 353
ID Description Score Start End Superfamily
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9606 20 353 3.20.20.210
af_P9WFE1_2_357_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9397 13 353 3.20.20.210
af_P32347_4_362_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9393 12 352 3.20.20.210
2ejaB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9266 20 354 3.20.20.210
2infD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9207 18 353 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A6N0WZN4-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9953 18 354 GO:0004853
GO:0005829
GO:0019353
AF-A0A520ESE8-F1-model_v4 deleted 0.9945 248 353
AF-A0A519EBC1-F1-model_v4 deleted 0.9942 254 354
AF-A0A6L4A2C3-F1-model_v4 deleted 0.9941 186 353
AF-A0A844Z894-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9934 18 353 GO:0004853
GO:0005829
GO:0019353

Feature Viewer

pLDDT pTM Quality
93.3 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map