F470599

General Info

Members Datasets Scaffolds Average Seq Length
627 350 627 120

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0207112|Ga0501075_0207112_597_1028
Length 143
Sequence MPRTRPRSIVDVRYATQASTTRRIRMAYVDGFLVPVPKSKLAEYRRMAQKAGKVWKEHGALEFRECVGDDLDVDMGRSFKEGAGLKRGETVMFSWIAYKSKAHRDRVNAKVMKDPRIAGMDEKSMPFDVDRMCYGGFKVLVDL

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
16 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
17 3300003382 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM Metagenome Rhizosphere
18 3300003392 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM Metagenome Rhizosphere
19 3300003396 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM Metagenome Rhizosphere
20 3300003398 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM Metagenome Rhizosphere
21 3300003399 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM Metagenome Rhizosphere
22 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
23 3300003504 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM Metagenome Rhizosphere
24 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
25 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
26 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
29 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
33 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
55 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
56 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
57 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
58 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
59 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
62 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
63 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
89 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
90 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
109 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
110 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
112 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
113 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
114 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
115 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
116 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
120 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
121 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
122 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
127 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
128 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
129 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
131 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
132 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
133 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
134 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
135 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
136 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
137 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
140 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
141 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
142 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
143 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
144 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
145 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
146 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
147 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
148 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
149 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
150 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
151 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
152 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
153 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
225 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
226 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
231 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
232 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
238 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
239 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
249 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
250 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
251 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
252 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
253 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
254 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
261 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
262 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
263 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
264 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
265 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
266 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
267 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
268 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
269 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
270 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
271 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
272 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
273 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
313 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
325 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
326 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
346 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
347 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
350 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.84
Metatranscriptomes 0.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.94
Nodule 0
Rhizoplane 4.63
Rhizosphere 89.63
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1545184 2162886006 Archaea 1015
2 SwRhRL3b_contig_3118854 2162886006 Archaea 5637
3 MRS1b_contig_52275 2162886011 Bacteria 2273
4 MBSR1b_contig_2599212 2162886012 Bacteria 2129
5 MBSR1b_contig_7247536 2162886012 Bacteria 1155
6 JGI24741J21665_1033634 3300001915 Unclassified 763
7 JGI24752J21851_1008799 3300001976 Bacteria 1318
8 JGI24752J21851_1009973 3300001976 Bacteria 1239
9 JGI24752J21851_1025577 3300001976 Bacteria 774
10 JGI24746J21847_1023181 3300001977 Bacteria 864
11 JGI24747J21853_1015245 3300001978 Unclassified 805
12 JGI24737J22298_10025794 3300001990 Bacteria 1857
13 JGI24737J22298_10092088 3300001990 Bacteria 899
14 JGI24743J22301_10015255 3300001991 Bacteria 1423
15 JGI24743J22301_10053080 3300001991 Bacteria 828
16 JGI24735J21928_10129251 3300002067 Bacteria 728
17 JGI24748J21848_1007059 3300002074 Bacteria 1315
18 JGI24034J26672_10002946 3300002239 Bacteria 2359
19 JGI24742J22300_10032457 3300002244 Unclassified 915
20 JGI24751J29686_10004419 3300002459 Bacteria 2854
21 JGI24751J29686_10004481 3300002459 Bacteria 2835
22 JGI26129J50193_1002582 3300003349 Unclassified 1271
23 JGI26145J50221_1002080 3300003371 Bacteria 1572
24 JGI26145J50221_1034683 3300003371 Bacteria 524
25 JGI26139J50223_100526 3300003382 Unclassified 1416
26 JGI26134J50242_100045 3300003392 Archaea 6679
27 JGI26137J50245_100040 3300003396 Archaea 6411
28 JGI26130J50248_100845 3300003398 Unclassified 982
29 JGI26130J50248_103330 3300003398 Archaea 500
30 JGI26136J50244_100012 3300003399 Archaea 6340
31 JGI26136J50244_102731 3300003399 Archaea 560
32 JGI26141J51220_1000065 3300003503 Archaea 4599
33 JGI26138J51218_100034 3300003504 Archaea 5814
34 Ga0058859_11573965 3300004798 Bacteria 660
35 Ga0065704_10002310 3300005289 Archaea 8097
36 Ga0065704_10628753 3300005289 Unclassified 560
37 Ga0065712_10079196 3300005290 Unclassified 3247
38 Ga0065712_10451385 3300005290 Bacteria 686
39 Ga0065715_10181563 3300005293 Bacteria 1473
40 Ga0065707_10001142 3300005295 Archaea 7789
41 Ga0065707_10118002 3300005295 Bacteria 2197
42 Ga0065707_10137003 3300005295 Bacteria 1826
43 Ga0070658_10116778 3300005327 Bacteria 2215
44 Ga0070658_10201857 3300005327 Bacteria 1678
45 Ga0070676_10003640 3300005328 Bacteria 8063
46 Ga0070676_10011045 3300005328 Bacteria 4908
47 Ga0070676_10014403 3300005328 Archaea 4345
48 Ga0070683_100019783 3300005329 Bacteria 5984
49 Ga0070683_100215413 3300005329 Bacteria 1825
50 Ga0070690_100000541 3300005330 Bacteria 18903
51 Ga0070690_100040473 3300005330 Bacteria 2948
52 Ga0070670_100023275 3300005331 Bacteria 5331
53 Ga0070670_100073709 3300005331 Bacteria 2932
54 Ga0070670_101312709 3300005331 Unclassified 662
55 Ga0070670_101607464 3300005331 Archaea 597
56 Ga0068869_100069126 3300005334 Bacteria 2610
57 Ga0070666_10003865 3300005335 Bacteria 9093
58 Ga0070680_100004731 3300005336 Bacteria 10247
59 Ga0070682_100005894 3300005337 Bacteria 6850
60 Ga0070682_100009937 3300005337 Bacteria 5390
61 Ga0068868_100043822 3300005338 Bacteria 3496
62 Ga0068868_100281602 3300005338 Bacteria 1407
63 Ga0070660_100001305 3300005339 Bacteria 16998
64 Ga0070660_100003403 3300005339 Bacteria 10947
65 Ga0070689_100086179 3300005340 Bacteria 2470
66 Ga0070689_100089582 3300005340 Bacteria 2423
67 Ga0070691_10000488 3300005341 Bacteria 14870
68 Ga0070691_10622892 3300005341 Unclassified 639
69 Ga0070687_100001870 3300005343 Bacteria 7636
70 Ga0070687_100070183 3300005343 Bacteria 1879
71 Ga0070661_100000292 3300005344 Bacteria 40495
72 Ga0070692_10018450 3300005345 Bacteria 3357
73 Ga0070668_100002727 3300005347 Bacteria 12993
74 Ga0070668_100016470 3300005347 Bacteria 5527
75 Ga0070669_100000436 3300005353 Bacteria 31833
76 Ga0070669_100060775 3300005353 Bacteria 2776
77 Ga0070669_101363559 3300005353 Bacteria 615
78 Ga0070675_100038398 3300005354 Bacteria 3902
79 Ga0070671_100093451 3300005355 Bacteria 2520
80 Ga0070671_100498449 3300005355 Bacteria 1047
81 Ga0070674_100002709 3300005356 Bacteria 9799
82 Ga0070673_100000301 3300005364 Bacteria 25841
83 Ga0070673_100369716 3300005364 Bacteria 1276
84 Ga0070688_100001500 3300005365 Bacteria 11630
85 Ga0070688_100004625 3300005365 Bacteria 7186
86 Ga0070659_100008100 3300005366 Bacteria 7664
87 Ga0070659_100034719 3300005366 Bacteria 3924
88 Ga0070659_100118747 3300005366 Archaea 2140
89 Ga0070667_100000941 3300005367 Bacteria 26761
90 Ga0070667_100623603 3300005367 Unclassified 994
91 Ga0070667_101377451 3300005367 Archaea 661
92 Ga0070709_10003268 3300005434 Bacteria 8711
93 Ga0070714_100012854 3300005435 Bacteria 6692
94 Ga0070713_100023098 3300005436 Bacteria 4819
95 Ga0070710_10002192 3300005437 Bacteria 9215
96 Ga0070701_10037467 3300005438 Bacteria 2448
97 Ga0070701_10148229 3300005438 Bacteria 1348
98 Ga0070711_100044574 3300005439 Bacteria 3012
99 Ga0070705_100001662 3300005440 Bacteria 11637
100 Ga0070705_100082362 3300005440 Archaea 1980
101 Ga0070700_100002296 3300005441 Bacteria 9725
102 Ga0070700_100014627 3300005441 Bacteria 4434
103 Ga0070694_100059393 3300005444 Bacteria 2604
104 Ga0070694_100066961 3300005444 Archaea 2464
105 Ga0070708_100157248 3300005445 Bacteria 2117
106 Ga0070663_100000631 3300005455 Bacteria 18906
107 Ga0070678_100000488 3300005456 Bacteria 18986
108 Ga0070678_100603056 3300005456 Unclassified 980
109 Ga0070662_100001505 3300005457 Bacteria 14339
110 Ga0070662_100175101 3300005457 Archaea 1687
111 Ga0070681_10122200 3300005458 Bacteria 2537
112 Ga0068867_100004533 3300005459 Bacteria 9767
113 Ga0068867_100012911 3300005459 Bacteria 5910
114 Ga0068867_100728813 3300005459 Unclassified 877
115 Ga0070685_10016898 3300005466 Bacteria 3894
116 Ga0070685_10033646 3300005466 Bacteria 2882
117 Ga0070699_100314984 3300005518 Bacteria 1405
118 Ga0070679_100362431 3300005530 Bacteria 1397
119 Ga0070679_101897722 3300005530 Unclassified 544
120 Ga0070684_100003013 3300005535 Bacteria 12544
121 Ga0070684_100033816 3300005535 Bacteria 4368
122 Ga0070697_100033146 3300005536 Bacteria 4160
123 Ga0068853_100031322 3300005539 Bacteria 4499
124 Ga0068853_100111225 3300005539 Bacteria 2433
125 Ga0070672_100020119 3300005543 Bacteria 4863
126 Ga0070672_100161640 3300005543 Bacteria 1858
127 Ga0070686_100000909 3300005544 Bacteria 17148
128 Ga0070686_100021089 3300005544 Bacteria 3866
129 Ga0070695_100015863 3300005545 Bacteria 4552
130 Ga0070695_100405546 3300005545 Archaea 1034
131 Ga0070696_100153385 3300005546 Bacteria 1692
132 Ga0070696_101812327 3300005546 Unclassified 527
133 Ga0070665_100010653 3300005548 Bacteria 9308
134 Ga0070704_101599191 3300005549 Unclassified 601
135 Ga0068855_100011601 3300005563 Bacteria 10646
136 Ga0068855_100043085 3300005563 Bacteria 5347
137 Ga0070664_100002105 3300005564 Bacteria 15909
138 Ga0070664_100084748 3300005564 Bacteria 2736
139 Ga0068857_100005254 3300005577 Bacteria 11025
140 Ga0068857_100007922 3300005577 Bacteria 9168
141 Ga0068857_100291980 3300005577 Archaea 1501
142 Ga0068857_100476427 3300005577 Unclassified 1169
143 Ga0068854_100018882 3300005578 Bacteria 4636
144 Ga0068854_100019749 3300005578 Bacteria 4547
145 Ga0068856_100042031 3300005614 Bacteria 4495
146 Ga0068856_100084493 3300005614 Bacteria 3153
147 Ga0070702_100035488 3300005615 Bacteria 2755
148 Ga0070702_100236064 3300005615 Bacteria 1231
149 Ga0070702_100721285 3300005615 Archaea 762
150 Ga0068852_100012062 3300005616 Bacteria 6542
151 Ga0068852_100014600 3300005616 Bacteria 6054
152 Ga0068852_100947802 3300005616 Archaea 879
153 Ga0068859_100244077 3300005617 Bacteria 1885
154 Ga0068859_100640178 3300005617 Bacteria 1155
155 Ga0068864_100004333 3300005618 Bacteria 11653
156 Ga0068866_10011330 3300005718 Bacteria 3855
157 Ga0068866_10013440 3300005718 Bacteria 3592
158 Ga0068861_100202678 3300005719 Bacteria 1666
159 Ga0068851_10005404 3300005834 Bacteria 5795
160 Ga0068870_10001809 3300005840 Archaea 8777
161 Ga0068858_100041522 3300005842 Bacteria 4264
162 Ga0068860_100002808 3300005843 Bacteria 18114
163 Ga0068860_100154339 3300005843 Bacteria 2212
164 Ga0068860_100232523 3300005843 Archaea 1791
165 Ga0068862_100034536 3300005844 Bacteria 4279
166 Ga0068862_100048246 3300005844 Bacteria 3635
167 Ga0068862_100232442 3300005844 Archaea 1673
168 Ga0081540_1001147 3300005983 Bacteria 23388
169 Ga0070717_10500627 3300006028 Bacteria 1098
170 Ga0075365_10325635 3300006038 Bacteria 1082
171 Ga0075365_10758956 3300006038 Bacteria 685
172 Ga0075368_10146482 3300006042 Bacteria 985
173 Ga0075368_10189777 3300006042 Bacteria 868
174 Ga0075363_100104339 3300006048 Bacteria 1571
175 Ga0075363_100288063 3300006048 Bacteria 951
176 Ga0075364_10465955 3300006051 Bacteria 863
177 Ga0075432_10010335 3300006058 Bacteria 3165
178 Ga0070715_10000531 3300006163 Bacteria 10000
179 Ga0070712_100020438 3300006175 Bacteria 4332
180 Ga0070712_101119190 3300006175 Unclassified 684
181 Ga0075362_10041992 3300006177 Bacteria 2019
182 Ga0075362_10654214 3300006177 Bacteria 546
183 Ga0075367_10152738 3300006178 Bacteria 1433
184 Ga0075369_10076842 3300006186 Bacteria 1476
185 Ga0075366_10111260 3300006195 Bacteria 1647
186 Ga0075366_10123106 3300006195 Bacteria 1563
187 Ga0075366_10563387 3300006195 Bacteria 706
188 Ga0097621_100189910 3300006237 Bacteria 1779
189 Ga0075370_10116918 3300006353 Bacteria 1550
190 Ga0075370_10900423 3300006353 Bacteria 541
191 Ga0068871_100182236 3300006358 Bacteria 1805
192 Ga0075428_100007033 3300006844 Archaea 12478
193 Ga0075428_100095078 3300006844 Bacteria 3248
194 Ga0075428_101108564 3300006844 Archaea 836
195 Ga0075430_100188687 3300006846 Bacteria 1714
196 Ga0075430_100269344 3300006846 Archaea 1410
197 Ga0075431_100130914 3300006847 Bacteria 2587
198 Ga0075431_100215537 3300006847 Unclassified 1960
199 Ga0075431_101044600 3300006847 Bacteria 783
200 Ga0075431_101182011 3300006847 Archaea 728
201 Ga0075433_10306637 3300006852 Bacteria 1405
202 Ga0075434_100598786 3300006871 Bacteria 1121
203 Ga0075429_100003497 3300006880 Archaea 13399
204 Ga0075429_100135246 3300006880 Unclassified 2157
205 Ga0075429_101113522 3300006880 Bacteria 690
206 Ga0068865_100001614 3300006881 Bacteria 13214
207 Ga0068865_100054670 3300006881 Bacteria 2775
208 Ga0075436_100222575 3300006914 Bacteria 1339
209 Ga0097620_100244068 3300006931 Bacteria 1885
210 Ga0097620_100640188 3300006931 Bacteria 1155
211 Ga0075435_100835256 3300007076 Bacteria 802
212 Ga0105244_10104999 3300009036 Bacteria 1379
213 Ga0105250_10005936 3300009092 Bacteria 5403
214 Ga0105250_10020592 3300009092 Bacteria 2665
215 Ga0105240_10254002 3300009093 Bacteria 2031
216 Ga0105240_11282419 3300009093 Archaea 773
217 Ga0111539_10032379 3300009094 Archaea 6349
218 Ga0111539_10143071 3300009094 Archaea 2800
219 Ga0111539_10235245 3300009094 Bacteria 2133
220 Ga0111539_10607999 3300009094 Bacteria 1273
221 Ga0111539_13518285 3300009094 Bacteria 502
222 Ga0105245_10018069 3300009098 Bacteria 6161
223 Ga0105245_10036759 3300009098 Bacteria 4351
224 Ga0105247_10005265 3300009101 Bacteria 8163
225 Ga0105247_10017167 3300009101 Bacteria 4344
226 Ga0114129_10015776 3300009147 Archaea 10740
227 Ga0114129_10244701 3300009147 Bacteria 2410
228 Ga0114129_10618452 3300009147 Archaea 1401
229 Ga0114129_11242009 3300009147 Unclassified 926
230 Ga0114129_11687674 3300009147 Bacteria 773
231 Ga0105243_10002877 3300009148 Bacteria 14267
232 Ga0105241_10003054 3300009174 Bacteria 12484
233 Ga0105241_10017418 3300009174 Bacteria 5281
234 Ga0105242_10018248 3300009176 Bacteria 5483
235 Ga0105242_10049675 3300009176 Bacteria 3413
236 Ga0105242_10243662 3300009176 Bacteria 1617
237 Ga0105242_13022448 3300009176 Unclassified 521
238 Ga0105248_10001545 3300009177 Bacteria 25616
239 Ga0105237_10006244 3300009545 Bacteria 13268
240 Ga0105237_10132534 3300009545 Bacteria 2486
241 Ga0105238_10059285 3300009551 Bacteria 3834
242 Ga0105238_10373411 3300009551 Bacteria 1416
243 Ga0105249_10000740 3300009553 Bacteria 29426
244 Ga0105249_10022601 3300009553 Bacteria 5635
245 Ga0105249_10333907 3300009553 Archaea 1530
246 Ga0105239_10023993 3300010375 Bacteria 6718
247 Ga0105239_10216611 3300010375 Bacteria 2147
248 Ga0105246_10001739 3300011119 Bacteria 13025
249 Ga0105246_10019764 3300011119 Bacteria 4312
250 Ga0105246_10180792 3300011119 Unclassified 1624
251 Ga0157323_1006337 3300012495 Unclassified 822
252 Ga0157373_10072677 3300013100 Bacteria 2428
253 Ga0157373_10080495 3300013100 Bacteria 2297
254 Ga0157371_10003347 3300013102 Bacteria 14608
255 Ga0157371_10026473 3300013102 Bacteria 4215
256 Ga0157369_10121632 3300013105 Bacteria 2769
257 Ga0157374_10034021 3300013296 Bacteria 4653
258 Ga0157374_10253664 3300013296 Bacteria 1731
259 Ga0157378_10055166 3300013297 Bacteria 3539
260 Ga0163162_10006077 3300013306 Bacteria 11688
261 Ga0163162_10497488 3300013306 Bacteria 1350
262 Ga0157372_10018528 3300013307 Bacteria 7486
263 Ga0157372_10225268 3300013307 Bacteria 2174
264 Ga0157375_10074868 3300013308 Bacteria 3408
265 Ga0157375_12167126 3300013308 Unclassified 662
266 Ga0163163_10037711 3300014325 Bacteria 4703
267 Ga0163163_10062871 3300014325 Bacteria 3679
268 Ga0157380_10002295 3300014326 Bacteria 12856
269 Ga0157380_10053820 3300014326 Bacteria 3192
270 Ga0157380_10581470 3300014326 Archaea 1104
271 Ga0157377_10000604 3300014745 Bacteria 14890
272 Ga0157377_10017066 3300014745 Bacteria 3750
273 Ga0157379_10041479 3300014968 Bacteria 4108
274 Ga0157379_10214274 3300014968 Bacteria 1744
275 Ga0157376_10029924 3300014969 Bacteria 4340
276 Ga0163161_10000777 3300017792 Bacteria 25062
277 Ga0163161_10010955 3300017792 Bacteria 6284
278 Ga0207697_10009651 3300025315 Bacteria 4157
279 Ga0207656_10007939 3300025321 Bacteria 3890
280 Ga0207656_10059954 3300025321 Bacteria 1667
281 Ga0207696_1046759 3300025711 Bacteria 1248
282 Ga0207653_10121532 3300025885 Bacteria 940
283 Ga0207692_10039147 3300025898 Bacteria 2330
284 Ga0207642_10024011 3300025899 Bacteria 2445
285 Ga0207642_10107206 3300025899 Bacteria 1415
286 Ga0207710_10014677 3300025900 Bacteria 3307
287 Ga0207710_10113975 3300025900 Bacteria 1286
288 Ga0207688_10012936 3300025901 Bacteria 4535
289 Ga0207688_10155657 3300025901 Bacteria 1352
290 Ga0207680_10022429 3300025903 Bacteria 3433
291 Ga0207680_10069511 3300025903 Bacteria 2176
292 Ga0207647_10000413 3300025904 Bacteria 35152
293 Ga0207647_10014154 3300025904 Bacteria 5507
294 Ga0207685_10011418 3300025905 Bacteria 2669
295 Ga0207699_10000914 3300025906 Bacteria 14122
296 Ga0207645_10003125 3300025907 Bacteria 12696
297 Ga0207645_10005574 3300025907 Archaea 9108
298 Ga0207643_10000939 3300025908 Archaea 17479
299 Ga0207643_10001093 3300025908 Bacteria 16060
300 Ga0207705_10048442 3300025909 Bacteria 3057
301 Ga0207705_11124156 3300025909 Bacteria 605
302 Ga0207654_10106425 3300025911 Unclassified 1737
303 Ga0207671_10019791 3300025914 Bacteria 5139
304 Ga0207671_10245864 3300025914 Bacteria 1406
305 Ga0207693_10000200 3300025915 Bacteria 54560
306 Ga0207663_10002481 3300025916 Bacteria 8881
307 Ga0207660_10062130 3300025917 Bacteria 2690
308 Ga0207662_10003669 3300025918 Bacteria 7954
309 Ga0207662_10048294 3300025918 Bacteria 2521
310 Ga0207657_10000248 3300025919 Bacteria 57425
311 Ga0207657_10002871 3300025919 Bacteria 18515
312 Ga0207649_10001017 3300025920 Bacteria 17305
313 Ga0207649_10035146 3300025920 Bacteria 3009
314 Ga0207652_10068798 3300025921 Bacteria 3072
315 Ga0207652_11267189 3300025921 Archaea 640
316 Ga0207646_10748030 3300025922 Bacteria 872
317 Ga0207681_10025337 3300025923 Bacteria 3814
318 Ga0207681_10206143 3300025923 Bacteria 1512
319 Ga0207694_10191739 3300025924 Bacteria 1660
320 Ga0207694_11555842 3300025924 Unclassified 558
321 Ga0207650_10000051 3300025925 Bacteria 168652
322 Ga0207650_10013639 3300025925 Bacteria 5632
323 Ga0207659_10012088 3300025926 Bacteria 5475
324 Ga0207659_10039047 3300025926 Bacteria 3307
325 Ga0207687_10061356 3300025927 Bacteria 2655
326 Ga0207687_11096492 3300025927 Bacteria 684
327 Ga0207700_10141785 3300025928 Bacteria 1975
328 Ga0207664_10701261 3300025929 Bacteria 910
329 Ga0207644_10006972 3300025931 Bacteria 7358
330 Ga0207644_10031827 3300025931 Bacteria 3677
331 Ga0207690_10002135 3300025932 Bacteria 12105
332 Ga0207690_10083758 3300025932 Archaea 2234
333 Ga0207690_10372348 3300025932 Bacteria 1133
334 Ga0207706_10000886 3300025933 Bacteria 30754
335 Ga0207706_10006949 3300025933 Bacteria 10464
336 Ga0207706_10128092 3300025933 Archaea 2232
337 Ga0207686_10042390 3300025934 Bacteria 2782
338 Ga0207686_10107319 3300025934 Bacteria 1876
339 Ga0207709_10016910 3300025935 Bacteria 4064
340 Ga0207670_10020207 3300025936 Bacteria 4087
341 Ga0207670_10047520 3300025936 Bacteria 2859
342 Ga0207669_10001242 3300025937 Bacteria 10853
343 Ga0207704_10011337 3300025938 Bacteria 4385
344 Ga0207704_10145496 3300025938 Bacteria 1664
345 Ga0207665_10000748 3300025939 Bacteria 21878
346 Ga0207691_10078171 3300025940 Bacteria 2978
347 Ga0207711_10104857 3300025941 Bacteria 2506
348 Ga0207689_10000184 3300025942 Bacteria 54232
349 Ga0207689_10415676 3300025942 Bacteria 1122
350 Ga0207661_10000122 3300025944 Bacteria 49562
351 Ga0207661_10084012 3300025944 Bacteria 2636
352 Ga0207679_10000101 3300025945 Bacteria 71096
353 Ga0207679_10006004 3300025945 Bacteria 7640
354 Ga0207667_10247518 3300025949 Bacteria 1824
355 Ga0207651_10001356 3300025960 Bacteria 11086
356 Ga0207651_10384222 3300025960 Bacteria 1190
357 Ga0207712_10082579 3300025961 Bacteria 2343
358 Ga0207712_10702225 3300025961 Bacteria 883
359 Ga0207668_10057386 3300025972 Bacteria 2715
360 Ga0207668_10112860 3300025972 Bacteria 2042
361 Ga0207640_10024018 3300025981 Bacteria 3672
362 Ga0207640_10150886 3300025981 Bacteria 1707
363 Ga0207658_10023411 3300025986 Bacteria 4310
364 Ga0207658_10619422 3300025986 Bacteria 973
365 Ga0207703_10020545 3300026035 Bacteria 5165
366 Ga0207639_10024616 3300026041 Bacteria 4359
367 Ga0207639_10038436 3300026041 Bacteria 3560
368 Ga0207678_10002318 3300026067 Bacteria 17253
369 Ga0207678_10033626 3300026067 Bacteria 4466
370 Ga0207678_10583126 3300026067 Archaea 980
371 Ga0207708_10009620 3300026075 Bacteria 7167
372 Ga0207708_10036747 3300026075 Bacteria 3730
373 Ga0207702_10029252 3300026078 Bacteria 4584
374 Ga0207702_10302115 3300026078 Bacteria 1519
375 Ga0207641_10000006 3300026088 Bacteria 442569
376 Ga0207641_10046134 3300026088 Bacteria 3672
377 Ga0207648_10006908 3300026089 Bacteria 11245
378 Ga0207648_10356014 3300026089 Bacteria 1320
379 Ga0207648_11218395 3300026089 Unclassified 707
380 Ga0207676_10000155 3300026095 Bacteria 59757
381 Ga0207674_10000537 3300026116 Bacteria 49684
382 Ga0207674_10001082 3300026116 Bacteria 35408
383 Ga0207674_10474259 3300026116 Unclassified 1209
384 Ga0207674_10607681 3300026116 Unclassified 1056
385 Ga0207675_100000602 3300026118 Bacteria 35101
386 Ga0207675_100392337 3300026118 Bacteria 1367
387 Ga0207683_10000236 3300026121 Bacteria 48996
388 Ga0207683_10010359 3300026121 Bacteria 7953
389 Ga0207698_10204435 3300026142 Bacteria 1771
390 Ga0207698_10528769 3300026142 Bacteria 1152
391 Ga0209973_1000443 3300027252 Archaea 3122
392 Ga0209973_1007292 3300027252 Unclassified 1232
393 Ga0209969_1065446 3300027360 Bacteria 576
394 Ga0209967_1000075 3300027364 Archaea 13452
395 Ga0209981_1000656 3300027378 Archaea 4368
396 Ga0209996_1000096 3300027395 Archaea 11659
397 Ga0210000_1053577 3300027462 Bacteria 649
398 Ga0209995_1000119 3300027471 Archaea 12334
399 Ga0209968_1000063 3300027526 Archaea 19330
400 Ga0209968_1047395 3300027526 Bacteria 742
401 Ga0209970_1027855 3300027614 Bacteria 974
402 Ga0210002_1000481 3300027617 Archaea 5429
403 Ga0209983_1001089 3300027665 Archaea 5987
404 Ga0209983_1008692 3300027665 Bacteria 2074
405 Ga0209971_1011244 3300027682 Bacteria 2120
406 Ga0209966_1000316 3300027695 Archaea 15768
407 Ga0209813_10135094 3300027866 Bacteria 871
408 Ga0209813_10170366 3300027866 Bacteria 791
409 Ga0209974_10013670 3300027876 Bacteria 2703
410 Ga0207428_10033121 3300027907 Archaea 4246
411 Ga0207428_10043378 3300027907 Bacteria 3633
412 Ga0268266_10011780 3300028379 Bacteria 7582
413 Ga0268265_10012466 3300028380 Bacteria 5760
414 Ga0268265_10146743 3300028380 Bacteria 1983
415 Ga0268264_10002713 3300028381 Bacteria 15451
416 Ga0268264_10033024 3300028381 Archaea 4248
417 Ga0268264_10050928 3300028381 Bacteria 3449
418 Ga0307515_10043657 3300028794 Bacteria 6959
419 Ga0307513_10362351 3300031456 Bacteria 1194
420 Ga0307508_10000071 3300031616 Bacteria 118790
421 Ga0307410_10000001 3300031852 Bacteria 162839
422 Ga0307410_11288133 3300031852 Unclassified 639
423 Ga0307406_10926339 3300031901 Bacteria 743
424 Ga0307407_10008057 3300031903 Bacteria 4810
425 Ga0307407_10099493 3300031903 Bacteria 1801
426 Ga0307412_10022081 3300031911 Bacteria 3895
427 Ga0307409_100000127 3300031995 Bacteria 28561
428 Ga0307416_100000075 3300032002 Bacteria 77549
429 Ga0307416_102289675 3300032002 Bacteria 641
430 Ga0307416_102551931 3300032002 Bacteria 609
431 Ga0307411_10777636 3300032005 Unclassified 841
432 Ga0307411_11751101 3300032005 Unclassified 576
433 Ga0307415_100667811 3300032126 Bacteria 934
434 Ga0373951_0016042 3300035091 Bacteria 1689
435 Ga0373952_0013851 3300035092 Bacteria 1606
436 Ga0373932_0030459 3300035112 Bacteria 1496
437 Ga0373939_0293776 3300035114 Bacteria 646
438 Ga0373960_0028627 3300035121 Bacteria 1539
439 Ga0373942_0245664 3300035207 Bacteria 607
440 Ga0373962_0045159 3300035242 Bacteria 1254
441 Ga0373931_0006598 3300035691 Bacteria 5433
442 Ga0395899_0649984 3300037312 Bacteria 666
443 Ga0395900_0016010 3300037418 Bacteria 7640
444 Ga0395900_1816755 3300037418 Bacteria 520
445 Ga0395898_0043972 3300037466 Bacteria 4400
446 Ga0395905_0001179 3300037471 Bacteria 32664
447 Ga0395901_0003815 3300038443 Bacteria 15189
448 Ga0451797_0165799 3300041453 Unclassified 573
449 Ga0439441_000659 3300042001 Archaea 3946
450 Ga0439443_022468 3300042003 Archaea 1001
451 Ga0439450_000400 3300042008 Archaea 5554
452 Ga0439451_003231 3300042009 Archaea 3312
453 Ga0439454_000030 3300042011 Archaea 9334
454 Ga0439463_001438 3300042016 Archaea 6321
455 Ga0439434_0241335 3300042435 Bacteria 616
456 Ga0439434_0272363 3300042435 Bacteria 582
457 Ga0439435_0002613 3300042436 Unclassified 3611
458 Ga0439435_0317211 3300042436 Bacteria 536
459 Ga0439444_0004325 3300042437 Archaea 2058
460 Ga0439464_0032819 3300042439 Archaea 1459
461 Ga0439460_0006124 3300042461 Unclassified 2970
462 Ga0451576_0029623 3300045051 Bacteria 5857
463 Ga0495592_0816927 3300046454 Bacteria 553
464 Ga0495590_0346278 3300046457 Bacteria 564
465 Ga0495608_0297198 3300046511 Bacteria 1000
466 Ga0495656_0293967 3300046615 Bacteria 831
467 Ga0495656_0452267 3300046615 Unclassified 677
468 Ga0495669_0060387 3300046684 Bacteria 1714
469 Ga0495680_0210059 3300047322 Bacteria 1394
470 Ga0496100_0006494 3300048903 Bacteria 6377
471 Ga0496100_0155337 3300048903 Bacteria 1636
472 Ga0496101_0029740 3300048904 Bacteria 3821
473 Ga0496101_1551331 3300048904 Bacteria 515
474 Ga0496102_0673575 3300048905 Bacteria 957
475 Ga0496103_0037973 3300048906 Bacteria 2953
476 Ga0496104_0718763 3300048907 Bacteria 906
477 Ga0496104_1586682 3300048907 Unclassified 557
478 Ga0496105_0158146 3300048908 Bacteria 1860
479 Ga0496106_0020480 3300048909 Bacteria 4908
480 Ga0496107_0023098 3300048910 Bacteria 4395
481 Ga0496108_0000258 3300048911 Bacteria 45782
482 Ga0496108_0134482 3300048911 Bacteria 2126
483 Ga0496108_0562388 3300048911 Bacteria 994
484 Ga0496109_0000126 3300048912 Bacteria 77920
485 Ga0496109_0041667 3300048912 Bacteria 4158
486 Ga0496109_0596600 3300048912 Bacteria 1040
487 Ga0496110_0025514 3300048913 Bacteria 5052
488 Ga0496110_0031645 3300048913 Bacteria 4565
489 Ga0496111_0000724 3300048914 Bacteria 17595
490 Ga0496112_0000081 3300048915 Bacteria 62594
491 Ga0496112_0040764 3300048915 Bacteria 4541
492 Ga0496112_0067209 3300048915 Bacteria 3537
493 Ga0496113_0001980 3300048916 Bacteria 11735
494 Ga0496113_0076000 3300048916 Bacteria 2564
495 Ga0496113_0697124 3300048916 Bacteria 810
496 Ga0496114_0270221 3300048917 Bacteria 1498
497 Ga0496114_0809357 3300048917 Unclassified 816
498 Ga0496126_0010210 3300048929 Bacteria 9873
499 Ga0501031_0021104 3300049568 Bacteria 4248
500 Ga0501031_0532011 3300049568 Unclassified 757
501 Ga0501032_0125136 3300049569 Unclassified 1698
502 Ga0501032_0221158 3300049569 Archaea 1232
503 Ga0501033_0006425 3300049570 Bacteria 9205
504 Ga0501034_0156684 3300049571 Unclassified 2251
505 Ga0501034_0264645 3300049571 Unclassified 1662
506 Ga0501036_0001556 3300049572 Bacteria 17726
507 Ga0501036_0275270 3300049572 Archaea 1409
508 Ga0501037_0039995 3300049573 Eukaryota 3451
509 Ga0501037_0107235 3300049573 Archaea 2013
510 Ga0501038_0034122 3300049574 Eukaryota 4476
511 Ga0501038_0383925 3300049574 Bacteria 1089
512 Ga0501039_0000989 3300049575 Bacteria 20675
513 Ga0501039_0394416 3300049575 Archaea 1087
514 Ga0501040_0000351 3300049576 Bacteria 27003
515 Ga0501040_0675428 3300049576 Archaea 747
516 Ga0501041_0001230 3300049577 Bacteria 14040
517 Ga0501041_0212270 3300049577 Archaea 1214
518 Ga0501042_0002805 3300049578 Bacteria 10781
519 Ga0501042_0036838 3300049578 Archaea 3471
520 Ga0501042_0090118 3300049578 Archaea 2201
521 Ga0501042_1042389 3300049578 Bacteria 596
522 Ga0501043_0071401 3300049579 Unclassified 2727
523 Ga0501043_0622702 3300049579 Unclassified 795
524 Ga0501046_0002565 3300049580 Bacteria 16995
525 Ga0501046_0033621 3300049580 Archaea 4141
526 Ga0501046_0458314 3300049580 Archaea 916
527 Ga0501046_0909090 3300049580 Bacteria 614
528 Ga0501046_1046268 3300049580 Bacteria 565
529 Ga0501047_1247446 3300049581 Bacteria 557
530 Ga0501048_0012837 3300049582 Bacteria 6222
531 Ga0501048_0318874 3300049582 Archaea 1107
532 Ga0501068_0001484 3300049584 Bacteria 12485
533 Ga0501068_0014073 3300049584 Bacteria 4567
534 Ga0501069_0203302 3300049585 Bacteria 1148
535 Ga0501070_0174108 3300049586 Unclassified 1772
536 Ga0501071_0000159 3300049587 Bacteria 28852
537 Ga0501071_0252999 3300049587 Bacteria 1330
538 Ga0501071_0259384 3300049587 Archaea 1313
539 Ga0501071_0672540 3300049587 Bacteria 797
540 Ga0501071_1462430 3300049587 Unclassified 527
541 Ga0501072_0008151 3300049588 Bacteria 7951
542 Ga0501072_0647513 3300049588 Bacteria 832
543 Ga0501073_0094930 3300049589 Bacteria 2071
544 Ga0501073_0133733 3300049589 Bacteria 1719
545 Ga0501073_0397350 3300049589 Bacteria 952
546 Ga0501074_0005569 3300049590 Bacteria 9061
547 Ga0501074_0259768 3300049590 Archaea 1235
548 Ga0501075_0014450 3300049591 Eukaryota 5657
549 Ga0501075_0207112 3300049591 Bacteria 1496
550 Ga0501075_0554631 3300049591 Bacteria 877
551 Ga0501076_0009874 3300049592 Bacteria 7056
552 Ga0501076_0122370 3300049592 Bacteria 2107
553 Ga0501076_0350977 3300049592 Archaea 1211
554 Ga0501076_0505397 3300049592 Archaea 996
555 Ga0501077_0000351 3300049593 Bacteria 27245
556 Ga0501077_0598191 3300049593 Bacteria 708
557 Ga0501253_180624 3300049683 Bacteria 548
558 Ga0501079_0052024 3300049741 Unclassified 3162
559 Ga0501079_0295863 3300049741 Bacteria 1266
560 Ga0501079_0536969 3300049741 Archaea 919
561 Ga0501079_1390327 3300049741 Archaea 552
562 Ga0501080_0001579 3300049742 Bacteria 19301
563 Ga0501080_0126175 3300049742 Bacteria 2370
564 Ga0501080_1610613 3300049742 Unclassified 550
565 Ga0501081_0001463 3300049743 Bacteria 14467
566 Ga0501083_0083495 3300049744 Unclassified 2116
567 Ga0501083_0899824 3300049744 Bacteria 576
568 Ga0501270_058524 3300049767 Bacteria 717
569 Ga0501035_0003075 3300049822 Bacteria 16014
570 Ga0501035_0608000 3300049822 Bacteria 890
571 Ga0501035_0953021 3300049822 Archaea 677
572 Ga0501044_0690482 3300049823 Unclassified 907
573 Ga0501045_0013636 3300049824 Bacteria 5744
574 Ga0501045_0521455 3300049824 Bacteria 882
575 Ga0501045_0612283 3300049824 Archaea 806
576 nmdc:mga03n38_707267_c1 3300050490 Bacteria 581
577 nmdc:mga00v17_185209_c1 3300050491 Bacteria 1344
578 nmdc:mga00v17_381134_c1 3300050491 Bacteria 917
579 nmdc:mga0yw44_123493_c1 3300050492 Bacteria 1670
580 nmdc:mga0k408_248665_c1 3300050493 Bacteria 1062
581 nmdc:mga0k408_74257_c1 3300050493 Bacteria 1987
582 nmdc:mga06z11_122783_c1 3300050494 Bacteria 1451
583 nmdc:mga06z11_368647_c1 3300050494 Bacteria 862
584 nmdc:mga04h51_174525_c1 3300050495 Bacteria 834
585 nmdc:mga04h51_260903_c1 3300050495 Bacteria 697
586 nmdc:mga05p37_1167905_c1 3300050507 Unclassified 799
587 nmdc:mga05p37_291418_c1 3300050507 Bacteria 1943
588 nmdc:mga05p37_6406_c2 3300050507 Archaea 12251
589 nmdc:mga05p37_89340_c1 3300050507 Archaea 3797
590 nmdc:mga09592_150935_c1 3300050508 Archaea 2005
591 nmdc:mga09592_1603_c1 3300050508 Archaea 18240
592 nmdc:mga09592_201729_c1 3300050508 Unclassified 1723
593 nmdc:mga09592_653359_c1 3300050508 Bacteria 898
594 nmdc:mga0qj67_1567190_c1 3300050509 Bacteria 506
595 nmdc:mga0qj67_25579_c1 3300050509 Archaea 4562
596 nmdc:mga0qj67_283328_c1 3300050509 Archaea 1343
597 nmdc:mga0qj67_993632_c1 3300050509 Unclassified 658
598 nmdc:mga06r32_2035748_c1 3300050510 Unclassified 508
599 nmdc:mga06r32_224702_c1 3300050510 Bacteria 1866
600 nmdc:mga06r32_310987_c1 3300050510 Unclassified 1561
601 nmdc:mga06r32_35589_c2 3300050510 Archaea 1084
602 nmdc:mga06r32_8121_c1 3300050510 Archaea 9446
603 nmdc:mga08y16_114802_c1 3300050511 Bacteria 2804
604 nmdc:mga08y16_1234810_c1 3300050511 Unclassified 717
605 nmdc:mga08y16_136996_c1 3300050511 Archaea 2545
606 nmdc:mga08y16_209766_c1 3300050511 Archaea 2017
607 nmdc:mga08y16_303750_c1 3300050511 Bacteria 1644
608 nmdc:mga08y16_961159_c1 3300050511 Unclassified 837
609 nmdc:mga08y16_966_c2 3300050511 Archaea 21251
610 nmdc:mga0n895_1037600_c1 3300050512 Bacteria 800
611 nmdc:mga0rr50_119968_c1 3300050513 Bacteria 2092
612 nmdc:mga0a205_55612_c1 3300050515 Bacteria 3822
613 nmdc:mga0sz30_64716_c1 3300050516 Bacteria 1567
614 Ga0495655_0000442 3300053083 Bacteria 6980
615 Ga0500660_208864 3300053100 Bacteria 660
616 Ga0500645_026689 3300053730 Unclassified 1756
617 Ga0501084_0003638 3300054114 Bacteria 12517
618 Ga0501084_0152193 3300054114 Bacteria 1950
619 Ga0501084_0575962 3300054114 Bacteria 951
620 Ga0501084_0772144 3300054114 Bacteria 810
621 Ga0501084_0951499 3300054114 Bacteria 722
622 Ga0501082_0019926 3300060353 Bacteria 5780
623 Ga0501082_0225397 3300060353 Archaea 1631
624 Ga0501082_0860039 3300060353 Unclassified 793
625 Ga0530510_0005094 3300061734 Bacteria 9064
626 Ga0530510_0080761 3300061734 Archaea 2367
627 Ga0530510_0216571 3300061734 Archaea 1423

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006038 Ga0075365_10758956 Ga0075365_107589561 116
2 3300006195 Ga0075366_10563387 Ga0075366_105633872 116
3 3300006353 Ga0075370_10900423 Ga0075370_109004231 116
4 3300025885 Ga0207653_10121532 Ga0207653_101215321 116
5 3300049578 Ga0501042_1042389 Ga0501042_1042389_43_396 116
6 3300049592 Ga0501076_0122370 Ga0501076_0122370_560_913 116
7 3300049593 Ga0501077_0598191 Ga0501077_0598191_209_562 116
8 3300049741 Ga0501079_0295863 Ga0501079_0295863_883_1236 116
9 3300049744 Ga0501083_0899824 Ga0501083_0899824_22_375 116
10 3300049822 Ga0501035_0608000 Ga0501035_0608000_354_707 116
11 3300054114 Ga0501084_0152193 Ga0501084_0152193_515_868 116
12 3300005290 Ga0065712_10451385 Ga0065712_104513852 117
13 3300006038 Ga0075365_10325635 Ga0075365_103256352 117
14 3300006042 Ga0075368_10146482 Ga0075368_101464822 117
15 3300006048 Ga0075363_100104339 Ga0075363_1001043392 117
16 3300006051 Ga0075364_10465955 Ga0075364_104659552 117
17 3300006177 Ga0075362_10041992 Ga0075362_100419922 117
18 3300006177 Ga0075362_10654214 Ga0075362_106542142 117
19 3300006186 Ga0075369_10076842 Ga0075369_100768421 117
20 3300006195 Ga0075366_10111260 Ga0075366_101112603 117
21 3300006353 Ga0075370_10116918 Ga0075370_101169183 117
22 3300027866 Ga0209813_10170366 Ga0209813_101703661 117
23 3300042435 Ga0439434_0241335 Ga0439434_0241335_85_438 117
24 3300042435 Ga0439434_0272363 Ga0439434_0272363_94_447 117
25 3300049585 Ga0501069_0203302 Ga0501069_0203302_236_592 117
26 3300049587 Ga0501071_0252999 Ga0501071_0252999_295_651 117
27 3300054114 Ga0501084_0772144 Ga0501084_0772144_354_707 117
28 3300001976 JGI24752J21851_1025577 JGI24752J21851_10255771 118
29 3300001977 JGI24746J21847_1023181 JGI24746J21847_10231812 118
30 3300001990 JGI24737J22298_10025794 JGI24737J22298_100257944 118
31 3300001991 JGI24743J22301_10053080 JGI24743J22301_100530802 118
32 3300002067 JGI24735J21928_10129251 JGI24735J21928_101292511 118
33 3300003371 JGI26145J50221_1034683 JGI26145J50221_10346831 118
34 3300004798 Ga0058859_11573965 Ga0058859_115739652 118
35 3300005295 Ga0065707_10118002 Ga0065707_101180023 118
36 3300005327 Ga0070658_10201857 Ga0070658_102018573 118
37 3300005328 Ga0070676_10003640 Ga0070676_100036405 118
38 3300005329 Ga0070683_100215413 Ga0070683_1002154132 118
39 3300005330 Ga0070690_100000541 Ga0070690_1000005413 118
40 3300005331 Ga0070670_100023275 Ga0070670_1000232756 118
41 3300005334 Ga0068869_100069126 Ga0068869_1000691262 118
42 3300005335 Ga0070666_10003865 Ga0070666_1000386512 118
43 3300005336 Ga0070680_100004731 Ga0070680_1000047319 118
44 3300005337 Ga0070682_100009937 Ga0070682_1000099376 118
45 3300005338 Ga0068868_100043822 Ga0068868_1000438223 118
46 3300005339 Ga0070660_100003403 Ga0070660_10000340314 118
47 3300005340 Ga0070689_100089582 Ga0070689_1000895824 118
48 3300005341 Ga0070691_10000488 Ga0070691_100004884 118
49 3300005343 Ga0070687_100001870 Ga0070687_10000187010 118
50 3300005344 Ga0070661_100000292 Ga0070661_10000029229 118
51 3300005345 Ga0070692_10018450 Ga0070692_100184503 118
52 3300005347 Ga0070668_100002727 Ga0070668_10000272711 118
53 3300005353 Ga0070669_100000436 Ga0070669_10000043626 118
54 3300005353 Ga0070669_101363559 Ga0070669_1013635592 118
55 3300005355 Ga0070671_100093451 Ga0070671_1000934512 118
56 3300005356 Ga0070674_100002709 Ga0070674_1000027092 118
57 3300005364 Ga0070673_100000301 Ga0070673_10000030116 118
58 3300005365 Ga0070688_100001500 Ga0070688_10000150015 118
59 3300005366 Ga0070659_100034719 Ga0070659_1000347194 118
60 3300005367 Ga0070667_100000941 Ga0070667_10000094114 118
61 3300005434 Ga0070709_10003268 Ga0070709_100032688 118
62 3300005435 Ga0070714_100012854 Ga0070714_1000128542 118
63 3300005436 Ga0070713_100023098 Ga0070713_1000230986 118
64 3300005437 Ga0070710_10002192 Ga0070710_100021928 118
65 3300005438 Ga0070701_10037467 Ga0070701_100374674 118
66 3300005439 Ga0070711_100044574 Ga0070711_1000445743 118
67 3300005440 Ga0070705_100001662 Ga0070705_1000016622 118
68 3300005441 Ga0070700_100002296 Ga0070700_1000022964 118
69 3300005444 Ga0070694_100059393 Ga0070694_1000593934 118
70 3300005445 Ga0070708_100157248 Ga0070708_1001572484 118
71 3300005455 Ga0070663_100000631 Ga0070663_10000063115 118
72 3300005456 Ga0070678_100000488 Ga0070678_10000048811 118
73 3300005457 Ga0070662_100001505 Ga0070662_10000150515 118
74 3300005458 Ga0070681_10122200 Ga0070681_101222004 118
75 3300005459 Ga0068867_100012911 Ga0068867_1000129113 118
76 3300005466 Ga0070685_10033646 Ga0070685_100336465 118
77 3300005518 Ga0070699_100314984 Ga0070699_1003149841 118
78 3300005530 Ga0070679_100362431 Ga0070679_1003624312 118
79 3300005535 Ga0070684_100003013 Ga0070684_1000030133 118
80 3300005536 Ga0070697_100033146 Ga0070697_1000331464 118
81 3300005539 Ga0068853_100031322 Ga0068853_1000313225 118
82 3300005543 Ga0070672_100020119 Ga0070672_1000201195 118
83 3300005544 Ga0070686_100000909 Ga0070686_1000009094 118
84 3300005545 Ga0070695_100015863 Ga0070695_1000158635 118
85 3300005546 Ga0070696_100153385 Ga0070696_1001533854 118
86 3300005548 Ga0070665_100010653 Ga0070665_1000106534 118
87 3300005563 Ga0068855_100011601 Ga0068855_1000116013 118
88 3300005564 Ga0070664_100002105 Ga0070664_10000210512 118
89 3300005577 Ga0068857_100007922 Ga0068857_1000079229 118
90 3300005578 Ga0068854_100019749 Ga0068854_1000197497 118
91 3300005614 Ga0068856_100084493 Ga0068856_1000844932 118
92 3300005615 Ga0070702_100035488 Ga0070702_1000354885 118
93 3300005616 Ga0068852_100012062 Ga0068852_1000120629 118
94 3300005617 Ga0068859_100244077 Ga0068859_1002440773 118
95 3300005618 Ga0068864_100004333 Ga0068864_1000043332 118
96 3300005718 Ga0068866_10013440 Ga0068866_100134404 118
97 3300005842 Ga0068858_100041522 Ga0068858_1000415225 118
98 3300005843 Ga0068860_100002808 Ga0068860_10000280815 118
99 3300005844 Ga0068862_100034536 Ga0068862_1000345365 118
100 3300005983 Ga0081540_1001147 Ga0081540_10011476 118
101 3300006028 Ga0070717_10500627 Ga0070717_105006272 118
102 3300006042 Ga0075368_10189777 Ga0075368_101897772 118
103 3300006048 Ga0075363_100288063 Ga0075363_1002880632 118
104 3300006058 Ga0075432_10010335 Ga0075432_100103356 118
105 3300006163 Ga0070715_10000531 Ga0070715_1000053112 118
106 3300006175 Ga0070712_100020438 Ga0070712_1000204385 118
107 3300006178 Ga0075367_10152738 Ga0075367_101527382 118
108 3300006195 Ga0075366_10123106 Ga0075366_101231062 118
109 3300006237 Ga0097621_100189910 Ga0097621_1001899102 118
110 3300006844 Ga0075428_100095078 Ga0075428_1000950782 118
111 3300006846 Ga0075430_100188687 Ga0075430_1001886871 118
112 3300006847 Ga0075431_100130914 Ga0075431_1001309145 118
113 3300006847 Ga0075431_100215537 Ga0075431_1002155371 118
114 3300006852 Ga0075433_10306637 Ga0075433_103066372 118
115 3300006871 Ga0075434_100598786 Ga0075434_1005987863 118
116 3300006880 Ga0075429_101113522 Ga0075429_1011135221 118
117 3300006881 Ga0068865_100001614 Ga0068865_1000016144 118
118 3300006914 Ga0075436_100222575 Ga0075436_1002225752 118
119 3300006931 Ga0097620_100244068 Ga0097620_1002440683 118
120 3300007076 Ga0075435_100835256 Ga0075435_1008352562 118
121 3300009036 Ga0105244_10104999 Ga0105244_101049993 118
122 3300009092 Ga0105250_10005936 Ga0105250_100059365 118
123 3300009093 Ga0105240_10254002 Ga0105240_102540024 118
124 3300009094 Ga0111539_13518285 Ga0111539_135182851 118
125 3300009098 Ga0105245_10036759 Ga0105245_100367598 118
126 3300009101 Ga0105247_10017167 Ga0105247_100171675 118
127 3300009147 Ga0114129_11242009 Ga0114129_112420092 118
128 3300009148 Ga0105243_10002877 Ga0105243_1000287717 118
129 3300009174 Ga0105241_10003054 Ga0105241_100030549 118
130 3300009176 Ga0105242_10049675 Ga0105242_100496753 118
131 3300009177 Ga0105248_10001545 Ga0105248_100015454 118
132 3300009545 Ga0105237_10006244 Ga0105237_100062441 118
133 3300009551 Ga0105238_10059285 Ga0105238_100592854 118
134 3300009553 Ga0105249_10000740 Ga0105249_1000074014 118
135 3300010375 Ga0105239_10216611 Ga0105239_102166111 118
136 3300011119 Ga0105246_10001739 Ga0105246_1000173914 118
137 3300013100 Ga0157373_10080495 Ga0157373_100804951 118
138 3300013102 Ga0157371_10003347 Ga0157371_100033474 118
139 3300013296 Ga0157374_10034021 Ga0157374_100340217 118
140 3300013297 Ga0157378_10055166 Ga0157378_100551664 118
141 3300013306 Ga0163162_10006077 Ga0163162_1000607711 118
142 3300013307 Ga0157372_10018528 Ga0157372_100185284 118
143 3300013308 Ga0157375_10074868 Ga0157375_100748686 118
144 3300014325 Ga0163163_10062871 Ga0163163_100628715 118
145 3300014326 Ga0157380_10002295 Ga0157380_100022958 118
146 3300014745 Ga0157377_10017066 Ga0157377_100170663 118
147 3300014968 Ga0157379_10041479 Ga0157379_100414794 118
148 3300014969 Ga0157376_10029924 Ga0157376_100299244 118
149 3300017792 Ga0163161_10000777 Ga0163161_1000077716 118
150 3300025315 Ga0207697_10009651 Ga0207697_100096512 118
151 3300025321 Ga0207656_10059954 Ga0207656_100599544 118
152 3300025711 Ga0207696_1046759 Ga0207696_10467592 118
153 3300025898 Ga0207692_10039147 Ga0207692_100391474 118
154 3300025899 Ga0207642_10024011 Ga0207642_100240113 118
155 3300025900 Ga0207710_10014677 Ga0207710_100146773 118
156 3300025901 Ga0207688_10012936 Ga0207688_100129368 118
157 3300025903 Ga0207680_10022429 Ga0207680_100224294 118
158 3300025904 Ga0207647_10000413 Ga0207647_1000041318 118
159 3300025905 Ga0207685_10011418 Ga0207685_100114182 118
160 3300025906 Ga0207699_10000914 Ga0207699_1000091415 118
161 3300025909 Ga0207705_11124156 Ga0207705_111241562 118
162 3300025914 Ga0207671_10019791 Ga0207671_100197914 118
163 3300025915 Ga0207693_10000200 Ga0207693_1000020029 118
164 3300025916 Ga0207663_10002481 Ga0207663_1000248110 118
165 3300025917 Ga0207660_10062130 Ga0207660_100621305 118
166 3300025918 Ga0207662_10003669 Ga0207662_100036696 118
167 3300025919 Ga0207657_10000248 Ga0207657_1000024830 118
168 3300025920 Ga0207649_10035146 Ga0207649_100351465 118
169 3300025921 Ga0207652_10068798 Ga0207652_100687985 118
170 3300025922 Ga0207646_10748030 Ga0207646_107480302 118
171 3300025923 Ga0207681_10206143 Ga0207681_102061433 118
172 3300025924 Ga0207694_10191739 Ga0207694_101917394 118
173 3300025925 Ga0207650_10013639 Ga0207650_1001363910 118
174 3300025926 Ga0207659_10039047 Ga0207659_100390475 118
175 3300025927 Ga0207687_11096492 Ga0207687_110964921 118
176 3300025928 Ga0207700_10141785 Ga0207700_101417853 118
177 3300025929 Ga0207664_10701261 Ga0207664_107012612 118
178 3300025931 Ga0207644_10031827 Ga0207644_100318274 118
179 3300025932 Ga0207690_10002135 Ga0207690_100021354 118
180 3300025933 Ga0207706_10000886 Ga0207706_1000088617 118
181 3300025934 Ga0207686_10042390 Ga0207686_100423902 118
182 3300025935 Ga0207709_10016910 Ga0207709_100169104 118
183 3300025936 Ga0207670_10047520 Ga0207670_100475202 118
184 3300025937 Ga0207669_10001242 Ga0207669_100012424 118
185 3300025938 Ga0207704_10011337 Ga0207704_100113374 118
186 3300025939 Ga0207665_10000748 Ga0207665_1000074823 118
187 3300025940 Ga0207691_10078171 Ga0207691_100781711 118
188 3300025942 Ga0207689_10415676 Ga0207689_104156763 118
189 3300025944 Ga0207661_10084012 Ga0207661_100840124 118
190 3300025945 Ga0207679_10006004 Ga0207679_100060048 118
191 3300025960 Ga0207651_10001356 Ga0207651_1000135612 118
192 3300025961 Ga0207712_10702225 Ga0207712_107022252 118
193 3300025972 Ga0207668_10112860 Ga0207668_101128603 118
194 3300025981 Ga0207640_10150886 Ga0207640_101508862 118
195 3300025986 Ga0207658_10619422 Ga0207658_106194222 118
196 3300026035 Ga0207703_10020545 Ga0207703_100205454 118
197 3300026041 Ga0207639_10024616 Ga0207639_100246164 118
198 3300026067 Ga0207678_10002318 Ga0207678_100023184 118
199 3300026075 Ga0207708_10009620 Ga0207708_1000962011 118
200 3300026078 Ga0207702_10029252 Ga0207702_100292525 118
201 3300026088 Ga0207641_10046134 Ga0207641_100461344 118
202 3300026089 Ga0207648_10356014 Ga0207648_103560143 118
203 3300026116 Ga0207674_10001082 Ga0207674_1000108212 118
204 3300026118 Ga0207675_100000602 Ga0207675_10000060229 118
205 3300026121 Ga0207683_10000236 Ga0207683_1000023618 118
206 3300026142 Ga0207698_10204435 Ga0207698_102044351 118
207 3300027252 Ga0209973_1007292 Ga0209973_10072921 118
208 3300027360 Ga0209969_1065446 Ga0209969_10654461 118
209 3300027462 Ga0210000_1053577 Ga0210000_10535771 118
210 3300027526 Ga0209968_1047395 Ga0209968_10473952 118
211 3300027614 Ga0209970_1027855 Ga0209970_10278552 118
212 3300027665 Ga0209983_1008692 Ga0209983_10086922 118
213 3300027682 Ga0209971_1011244 Ga0209971_10112442 118
214 3300027866 Ga0209813_10135094 Ga0209813_101350942 118
215 3300027876 Ga0209974_10013670 Ga0209974_100136703 118
216 3300027907 Ga0207428_10043378 Ga0207428_100433784 118
217 3300028380 Ga0268265_10146743 Ga0268265_101467434 118
218 3300028381 Ga0268264_10002713 Ga0268264_100027138 118
219 3300028794 Ga0307515_10043657 Ga0307515_100436576 118
220 3300031456 Ga0307513_10362351 Ga0307513_103623512 118
221 3300032005 Ga0307411_11751101 Ga0307411_117511011 118
222 3300035091 Ga0373951_0016042 Ga0373951_0016042_1283_1639 118
223 3300035092 Ga0373952_0013851 Ga0373952_0013851_962_1318 118
224 3300035112 Ga0373932_0030459 Ga0373932_0030459_351_707 118
225 3300035114 Ga0373939_0293776 Ga0373939_0293776_56_412 118
226 3300035121 Ga0373960_0028627 Ga0373960_0028627_284_640 118
227 3300035207 Ga0373942_0245664 Ga0373942_0245664_92_448 118
228 3300035242 Ga0373962_0045159 Ga0373962_0045159_786_1142 118
229 3300035691 Ga0373931_0006598 Ga0373931_0006598_1175_1531 118
230 3300037312 Ga0395899_0649984 Ga0395899_0649984_269_625 118
231 3300037418 Ga0395900_0016010 Ga0395900_0016010_323_679 118
232 3300037418 Ga0395900_1816755 Ga0395900_1816755_106_462 118
233 3300037466 Ga0395898_0043972 Ga0395898_0043972_1922_2278 118
234 3300037471 Ga0395905_0001179 Ga0395905_0001179_6313_6669 118
235 3300038443 Ga0395901_0003815 Ga0395901_0003815_11209_11565 118
236 3300046454 Ga0495592_0816927 Ga0495592_0816927_176_535 118
237 3300046457 Ga0495590_0346278 Ga0495590_0346278_21_377 118
238 3300046511 Ga0495608_0297198 Ga0495608_0297198_309_668 118
239 3300046615 Ga0495656_0293967 Ga0495656_0293967_265_624 118
240 3300046615 Ga0495656_0452267 Ga0495656_0452267_142_510 118
241 3300047322 Ga0495680_0210059 Ga0495680_0210059_476_835 118
242 3300048903 Ga0496100_0006494 Ga0496100_0006494_255_611 118
243 3300048904 Ga0496101_0029740 Ga0496101_0029740_2036_2392 118
244 3300048906 Ga0496103_0037973 Ga0496103_0037973_27_383 118
245 3300048907 Ga0496104_0718763 Ga0496104_0718763_516_872 118
246 3300048908 Ga0496105_0158146 Ga0496105_0158146_1430_1786 118
247 3300048909 Ga0496106_0020480 Ga0496106_0020480_1430_1786 118
248 3300048910 Ga0496107_0023098 Ga0496107_0023098_1215_1571 118
249 3300048911 Ga0496108_0134482 Ga0496108_0134482_455_811 118
250 3300048911 Ga0496108_0562388 Ga0496108_0562388_255_611 118
251 3300048912 Ga0496109_0041667 Ga0496109_0041667_2051_2407 118
252 3300048912 Ga0496109_0596600 Ga0496109_0596600_542_898 118
253 3300048913 Ga0496110_0031645 Ga0496110_0031645_2995_3351 118
254 3300048915 Ga0496112_0040764 Ga0496112_0040764_2034_2390 118
255 3300048915 Ga0496112_0067209 Ga0496112_0067209_1430_1786 118
256 3300048916 Ga0496113_0076000 Ga0496113_0076000_1697_2053 118
257 3300048916 Ga0496113_0697124 Ga0496113_0697124_70_426 118
258 3300048917 Ga0496114_0270221 Ga0496114_0270221_286_642 118
259 3300048929 Ga0496126_0010210 Ga0496126_0010210_3797_4162 118
260 3300049568 Ga0501031_0021104 Ga0501031_0021104_1440_1799 118
261 3300049569 Ga0501032_0125136 Ga0501032_0125136_826_1185 118
262 3300049570 Ga0501033_0006425 Ga0501033_0006425_1709_2068 118
263 3300049571 Ga0501034_0156684 Ga0501034_0156684_122_481 118
264 3300049572 Ga0501036_0001556 Ga0501036_0001556_17033_17392 118
265 3300049573 Ga0501037_0039995 Ga0501037_0039995_2344_2703 118
266 3300049574 Ga0501038_0034122 Ga0501038_0034122_735_1094 118
267 3300049574 Ga0501038_0383925 Ga0501038_0383925_112_468 118
268 3300049575 Ga0501039_0000989 Ga0501039_0000989_3896_4255 118
269 3300049576 Ga0501040_0000351 Ga0501040_0000351_6011_6370 118
270 3300049577 Ga0501041_0001230 Ga0501041_0001230_3569_3928 118
271 3300049578 Ga0501042_0002805 Ga0501042_0002805_520_879 118
272 3300049579 Ga0501043_0071401 Ga0501043_0071401_445_804 118
273 3300049580 Ga0501046_0002565 Ga0501046_0002565_4119_4478 118
274 3300049580 Ga0501046_1046268 Ga0501046_1046268_152_508 118
275 3300049581 Ga0501047_1247446 Ga0501047_1247446_90_449 118
276 3300049582 Ga0501048_0012837 Ga0501048_0012837_30_389 118
277 3300049584 Ga0501068_0001484 Ga0501068_0001484_9880_10239 118
278 3300049584 Ga0501068_0014073 Ga0501068_0014073_4095_4454 118
279 3300049586 Ga0501070_0174108 Ga0501070_0174108_265_624 118
280 3300049587 Ga0501071_0000159 Ga0501071_0000159_20105_20464 118
281 3300049587 Ga0501071_0672540 Ga0501071_0672540_154_510 118
282 3300049588 Ga0501072_0008151 Ga0501072_0008151_4322_4681 118
283 3300049589 Ga0501073_0094930 Ga0501073_0094930_1338_1697 118
284 3300049589 Ga0501073_0397350 Ga0501073_0397350_174_533 118
285 3300049590 Ga0501074_0005569 Ga0501074_0005569_7399_7758 118
286 3300049591 Ga0501075_0014450 Ga0501075_0014450_2043_2402 118
287 3300049592 Ga0501076_0009874 Ga0501076_0009874_4450_4809 118
288 3300049593 Ga0501077_0000351 Ga0501077_0000351_24676_25035 118
289 3300049683 Ga0501253_180624 Ga0501253_180624_10_369 118
290 3300049741 Ga0501079_0052024 Ga0501079_0052024_1827_2186 118
291 3300049742 Ga0501080_0001579 Ga0501080_0001579_4760_5119 118
292 3300049742 Ga0501080_0126175 Ga0501080_0126175_1600_1959 118
293 3300049743 Ga0501081_0001463 Ga0501081_0001463_12392_12751 118
294 3300049744 Ga0501083_0083495 Ga0501083_0083495_695_1063 118
295 3300049767 Ga0501270_058524 Ga0501270_058524_205_564 118
296 3300049822 Ga0501035_0003075 Ga0501035_0003075_1936_2295 118
297 3300049824 Ga0501045_0013636 Ga0501045_0013636_644_1003 118
298 3300050490 nmdc:mga03n38_707267_c1 nmdc:mga03n38_707267_c1_50_418 118
299 3300050491 nmdc:mga00v17_381134_c1 nmdc:mga00v17_381134_c1_289_648 118
300 3300050493 nmdc:mga0k408_74257_c1 nmdc:mga0k408_74257_c1_1173_1532 118
301 3300050494 nmdc:mga06z11_122783_c1 nmdc:mga06z11_122783_c1_250_609 118
302 3300050495 nmdc:mga04h51_260903_c1 nmdc:mga04h51_260903_c1_311_670 118
303 3300050507 nmdc:mga05p37_1167905_c1 nmdc:mga05p37_1167905_c1_320_688 118
304 3300050507 nmdc:mga05p37_291418_c1 nmdc:mga05p37_291418_c1_992_1348 118
305 3300050508 nmdc:mga09592_653359_c1 nmdc:mga09592_653359_c1_411_767 118
306 3300050509 nmdc:mga0qj67_1567190_c1 nmdc:mga0qj67_1567190_c1_110_466 118
307 3300050509 nmdc:mga0qj67_993632_c1 nmdc:mga0qj67_993632_c1_286_645 118
308 3300050510 nmdc:mga06r32_224702_c1 nmdc:mga06r32_224702_c1_1043_1399 118
309 3300050510 nmdc:mga06r32_310987_c1 nmdc:mga06r32_310987_c1_1175_1534 118
310 3300050511 nmdc:mga08y16_114802_c1 nmdc:mga08y16_114802_c1_1233_1589 118
311 3300050511 nmdc:mga08y16_1234810_c1 nmdc:mga08y16_1234810_c1_173_541 118
312 3300050512 nmdc:mga0n895_1037600_c1 nmdc:mga0n895_1037600_c1_312_668 118
313 3300050513 nmdc:mga0rr50_119968_c1 nmdc:mga0rr50_119968_c1_1397_1753 118
314 3300050515 nmdc:mga0a205_55612_c1 nmdc:mga0a205_55612_c1_1401_1757 118
315 3300053083 Ga0495655_0000442 Ga0495655_0000442_189_545 118
316 3300053730 Ga0500645_026689 Ga0500645_026689_437_796 118
317 3300054114 Ga0501084_0003638 Ga0501084_0003638_10332_10691 118
318 3300054114 Ga0501084_0575962 Ga0501084_0575962_439_798 118
319 3300060353 Ga0501082_0019926 Ga0501082_0019926_807_1166 118
320 3300061734 Ga0530510_0005094 Ga0530510_0005094_6663_7022 118
321 2162886011 MRS1b_contig_52275 MRS1b_0322.00002100 119
322 2162886012 MBSR1b_contig_2599212 MBSR1b_0785.00005550 119
323 2162886012 MBSR1b_contig_7247536 MBSR1b_0137.00004660 119
324 3300001915 JGI24741J21665_1033634 JGI24741J21665_10336341 119
325 3300001976 JGI24752J21851_1008799 JGI24752J21851_10087992 119
326 3300001976 JGI24752J21851_1009973 JGI24752J21851_10099731 119
327 3300001978 JGI24747J21853_1015245 JGI24747J21853_10152452 119
328 3300001990 JGI24737J22298_10092088 JGI24737J22298_100920882 119
329 3300001991 JGI24743J22301_10015255 JGI24743J22301_100152552 119
330 3300002074 JGI24748J21848_1007059 JGI24748J21848_10070592 119
331 3300002239 JGI24034J26672_10002946 JGI24034J26672_100029464 119
332 3300002244 JGI24742J22300_10032457 JGI24742J22300_100324572 119
333 3300002459 JGI24751J29686_10004419 JGI24751J29686_100044193 119
334 3300002459 JGI24751J29686_10004481 JGI24751J29686_100044813 119
335 3300005289 Ga0065704_10628753 Ga0065704_106287531 119
336 3300005290 Ga0065712_10079196 Ga0065712_100791962 119
337 3300005293 Ga0065715_10181563 Ga0065715_101815632 119
338 3300005295 Ga0065707_10137003 Ga0065707_101370031 119
339 3300005327 Ga0070658_10116778 Ga0070658_101167784 119
340 3300005328 Ga0070676_10011045 Ga0070676_100110457 119
341 3300005329 Ga0070683_100019783 Ga0070683_1000197838 119
342 3300005330 Ga0070690_100040473 Ga0070690_1000404732 119
343 3300005331 Ga0070670_100073709 Ga0070670_1000737093 119
344 3300005337 Ga0070682_100005894 Ga0070682_1000058944 119
345 3300005338 Ga0068868_100281602 Ga0068868_1002816022 119
346 3300005339 Ga0070660_100001305 Ga0070660_10000130510 119
347 3300005340 Ga0070689_100086179 Ga0070689_1000861792 119
348 3300005343 Ga0070687_100070183 Ga0070687_1000701832 119
349 3300005347 Ga0070668_100016470 Ga0070668_1000164703 119
350 3300005353 Ga0070669_100060775 Ga0070669_1000607753 119
351 3300005354 Ga0070675_100038398 Ga0070675_1000383986 119
352 3300005355 Ga0070671_100498449 Ga0070671_1004984492 119
353 3300005364 Ga0070673_100369716 Ga0070673_1003697162 119
354 3300005365 Ga0070688_100004625 Ga0070688_1000046251 119
355 3300005366 Ga0070659_100008100 Ga0070659_1000081009 119
356 3300005367 Ga0070667_100623603 Ga0070667_1006236032 119
357 3300005438 Ga0070701_10148229 Ga0070701_101482291 119
358 3300005441 Ga0070700_100014627 Ga0070700_1000146275 119
359 3300005456 Ga0070678_100603056 Ga0070678_1006030562 119
360 3300005459 Ga0068867_100004533 Ga0068867_1000045333 119
361 3300005466 Ga0070685_10016898 Ga0070685_100168983 119
362 3300005535 Ga0070684_100033816 Ga0070684_1000338162 119
363 3300005539 Ga0068853_100111225 Ga0068853_1001112252 119
364 3300005543 Ga0070672_100161640 Ga0070672_1001616402 119
365 3300005544 Ga0070686_100021089 Ga0070686_1000210896 119
366 3300005546 Ga0070696_101812327 Ga0070696_1018123271 119
367 3300005549 Ga0070704_101599191 Ga0070704_1015991911 119
368 3300005563 Ga0068855_100043085 Ga0068855_1000430853 119
369 3300005564 Ga0070664_100084748 Ga0070664_1000847482 119
370 3300005577 Ga0068857_100005254 Ga0068857_10000525411 119
371 3300005578 Ga0068854_100018882 Ga0068854_1000188826 119
372 3300005614 Ga0068856_100042031 Ga0068856_1000420316 119
373 3300005615 Ga0070702_100236064 Ga0070702_1002360642 119
374 3300005616 Ga0068852_100014600 Ga0068852_1000146009 119
375 3300005617 Ga0068859_100640178 Ga0068859_1006401782 119
376 3300005718 Ga0068866_10011330 Ga0068866_100113302 119
377 3300005719 Ga0068861_100202678 Ga0068861_1002026782 119
378 3300005834 Ga0068851_10005404 Ga0068851_100054043 119
379 3300005843 Ga0068860_100154339 Ga0068860_1001543392 119
380 3300005844 Ga0068862_100048246 Ga0068862_1000482463 119
381 3300006175 Ga0070712_101119190 Ga0070712_1011191901 119
382 3300006358 Ga0068871_100182236 Ga0068871_1001822363 119
383 3300006847 Ga0075431_101044600 Ga0075431_1010446001 119
384 3300006881 Ga0068865_100054670 Ga0068865_1000546702 119
385 3300006931 Ga0097620_100640188 Ga0097620_1006401882 119
386 3300009092 Ga0105250_10020592 Ga0105250_100205922 119
387 3300009094 Ga0111539_10235245 Ga0111539_102352452 119
388 3300009094 Ga0111539_10607999 Ga0111539_106079992 119
389 3300009098 Ga0105245_10018069 Ga0105245_100180695 119
390 3300009101 Ga0105247_10005265 Ga0105247_100052658 119
391 3300009147 Ga0114129_10244701 Ga0114129_102447015 119
392 3300009147 Ga0114129_11687674 Ga0114129_116876742 119
393 3300009174 Ga0105241_10017418 Ga0105241_100174187 119
394 3300009176 Ga0105242_10018248 Ga0105242_100182486 119
395 3300009176 Ga0105242_10243662 Ga0105242_102436622 119
396 3300009176 Ga0105242_13022448 Ga0105242_130224481 119
397 3300009545 Ga0105237_10132534 Ga0105237_101325342 119
398 3300009551 Ga0105238_10373411 Ga0105238_103734113 119
399 3300009553 Ga0105249_10022601 Ga0105249_100226016 119
400 3300010375 Ga0105239_10023993 Ga0105239_100239936 119
401 3300011119 Ga0105246_10019764 Ga0105246_100197647 119
402 3300012495 Ga0157323_1006337 Ga0157323_10063372 119
403 3300013100 Ga0157373_10072677 Ga0157373_100726772 119
404 3300013102 Ga0157371_10026473 Ga0157371_100264737 119
405 3300013105 Ga0157369_10121632 Ga0157369_101216323 119
406 3300013296 Ga0157374_10253664 Ga0157374_102536642 119
407 3300013306 Ga0163162_10497488 Ga0163162_104974882 119
408 3300013307 Ga0157372_10225268 Ga0157372_102252682 119
409 3300013308 Ga0157375_12167126 Ga0157375_121671262 119
410 3300014325 Ga0163163_10037711 Ga0163163_100377115 119
411 3300014326 Ga0157380_10053820 Ga0157380_100538205 119
412 3300014745 Ga0157377_10000604 Ga0157377_1000060412 119
413 3300014968 Ga0157379_10214274 Ga0157379_102142742 119
414 3300017792 Ga0163161_10010955 Ga0163161_100109557 119
415 3300025321 Ga0207656_10007939 Ga0207656_100079395 119
416 3300025899 Ga0207642_10107206 Ga0207642_101072062 119
417 3300025900 Ga0207710_10113975 Ga0207710_101139752 119
418 3300025901 Ga0207688_10155657 Ga0207688_101556572 119
419 3300025903 Ga0207680_10069511 Ga0207680_100695115 119
420 3300025904 Ga0207647_10014154 Ga0207647_100141545 119
421 3300025907 Ga0207645_10003125 Ga0207645_1000312513 119
422 3300025908 Ga0207643_10001093 Ga0207643_1000109313 119
423 3300025909 Ga0207705_10048442 Ga0207705_100484422 119
424 3300025911 Ga0207654_10106425 Ga0207654_101064252 119
425 3300025914 Ga0207671_10245864 Ga0207671_102458642 119
426 3300025918 Ga0207662_10048294 Ga0207662_100482943 119
427 3300025919 Ga0207657_10002871 Ga0207657_1000287111 119
428 3300025920 Ga0207649_10001017 Ga0207649_1000101716 119
429 3300025923 Ga0207681_10025337 Ga0207681_100253373 119
430 3300025924 Ga0207694_11555842 Ga0207694_115558422 119
431 3300025925 Ga0207650_10000051 Ga0207650_10000051156 119
432 3300025926 Ga0207659_10012088 Ga0207659_100120885 119
433 3300025927 Ga0207687_10061356 Ga0207687_100613565 119
434 3300025931 Ga0207644_10006972 Ga0207644_100069728 119
435 3300025932 Ga0207690_10372348 Ga0207690_103723481 119
436 3300025933 Ga0207706_10006949 Ga0207706_1000694911 119
437 3300025934 Ga0207686_10107319 Ga0207686_101073192 119
438 3300025936 Ga0207670_10020207 Ga0207670_100202075 119
439 3300025938 Ga0207704_10145496 Ga0207704_101454962 119
440 3300025941 Ga0207711_10104857 Ga0207711_101048572 119
441 3300025942 Ga0207689_10000184 Ga0207689_100001847 119
442 3300025944 Ga0207661_10000122 Ga0207661_1000012245 119
443 3300025945 Ga0207679_10000101 Ga0207679_1000010146 119
444 3300025949 Ga0207667_10247518 Ga0207667_102475183 119
445 3300025960 Ga0207651_10384222 Ga0207651_103842222 119
446 3300025961 Ga0207712_10082579 Ga0207712_100825793 119
447 3300025972 Ga0207668_10057386 Ga0207668_100573863 119
448 3300025981 Ga0207640_10024018 Ga0207640_100240185 119
449 3300025986 Ga0207658_10023411 Ga0207658_100234116 119
450 3300026041 Ga0207639_10038436 Ga0207639_100384364 119
451 3300026067 Ga0207678_10033626 Ga0207678_100336262 119
452 3300026075 Ga0207708_10036747 Ga0207708_100367474 119
453 3300026078 Ga0207702_10302115 Ga0207702_103021152 119
454 3300026088 Ga0207641_10000006 Ga0207641_10000006366 119
455 3300026089 Ga0207648_10006908 Ga0207648_1000690811 119
456 3300026095 Ga0207676_10000155 Ga0207676_1000015534 119
457 3300026116 Ga0207674_10000537 Ga0207674_1000053719 119
458 3300026118 Ga0207675_100392337 Ga0207675_1003923372 119
459 3300026121 Ga0207683_10010359 Ga0207683_100103592 119
460 3300026142 Ga0207698_10528769 Ga0207698_105287692 119
461 3300028379 Ga0268266_10011780 Ga0268266_1001178010 119
462 3300028380 Ga0268265_10012466 Ga0268265_100124665 119
463 3300028381 Ga0268264_10050928 Ga0268264_100509285 119
464 3300031616 Ga0307508_10000071 Ga0307508_1000007145 119
465 3300031852 Ga0307410_10000001 Ga0307410_10000001111 119
466 3300031852 Ga0307410_11288133 Ga0307410_112881332 119
467 3300031901 Ga0307406_10926339 Ga0307406_109263392 119
468 3300031903 Ga0307407_10008057 Ga0307407_100080573 119
469 3300031903 Ga0307407_10099493 Ga0307407_100994932 119
470 3300031911 Ga0307412_10022081 Ga0307412_100220813 119
471 3300031995 Ga0307409_100000127 Ga0307409_1000001278 119
472 3300032002 Ga0307416_100000075 Ga0307416_10000007550 119
473 3300032002 Ga0307416_102289675 Ga0307416_1022896752 119
474 3300032002 Ga0307416_102551931 Ga0307416_1025519312 119
475 3300032005 Ga0307411_10777636 Ga0307411_107776361 119
476 3300032126 Ga0307415_100667811 Ga0307415_1006678112 119
477 3300041453 Ga0451797_0165799 Ga0451797_0165799_114_476 119
478 3300042436 Ga0439435_0317211 Ga0439435_0317211_79_447 119
479 3300046684 Ga0495669_0060387 Ga0495669_0060387_1183_1542 119
480 3300048903 Ga0496100_0155337 Ga0496100_0155337_768_1127 119
481 3300048904 Ga0496101_1551331 Ga0496101_1551331_43_405 119
482 3300048905 Ga0496102_0673575 Ga0496102_0673575_431_790 119
483 3300048907 Ga0496104_1586682 Ga0496104_1586682_110_469 119
484 3300048911 Ga0496108_0000258 Ga0496108_0000258_32223_32582 119
485 3300048912 Ga0496109_0000126 Ga0496109_0000126_15954_16313 119
486 3300048913 Ga0496110_0025514 Ga0496110_0025514_3381_3740 119
487 3300048914 Ga0496111_0000724 Ga0496111_0000724_10585_10944 119
488 3300048915 Ga0496112_0000081 Ga0496112_0000081_43337_43696 119
489 3300048916 Ga0496113_0001980 Ga0496113_0001980_6354_6713 119
490 3300048917 Ga0496114_0809357 Ga0496114_0809357_103_462 119
491 3300049580 Ga0501046_0909090 Ga0501046_0909090_84_446 119
492 3300049591 Ga0501075_0554631 Ga0501075_0554631_14_376 119
493 3300049823 Ga0501044_0690482 Ga0501044_0690482_241_600 119
494 3300050511 nmdc:mga08y16_303750_c1 nmdc:mga08y16_303750_c1_111_473 119
495 3300053100 Ga0500660_208864 Ga0500660_208864_234_596 119
496 3300049576 Ga0501040_0675428 Ga0501040_0675428_15_395 120
497 3300049588 Ga0501072_0647513 Ga0501072_0647513_412_792 120
498 3300049824 Ga0501045_0521455 Ga0501045_0521455_389_769 120
499 3300054114 Ga0501084_0951499 Ga0501084_0951499_123_503 120
500 3300050491 nmdc:mga00v17_185209_c1 nmdc:mga00v17_185209_c1_441_809 121
501 3300050492 nmdc:mga0yw44_123493_c1 nmdc:mga0yw44_123493_c1_1158_1526 121
502 3300050493 nmdc:mga0k408_248665_c1 nmdc:mga0k408_248665_c1_484_852 121
503 3300050494 nmdc:mga06z11_368647_c1 nmdc:mga06z11_368647_c1_350_718 121
504 3300050495 nmdc:mga04h51_174525_c1 nmdc:mga04h51_174525_c1_159_527 121
505 3300050516 nmdc:mga0sz30_64716_c1 nmdc:mga0sz30_64716_c1_695_1063 121
506 3300049568 Ga0501031_0532011 Ga0501031_0532011_286_657 123
507 3300049569 Ga0501032_0221158 Ga0501032_0221158_39_410 123
508 3300049572 Ga0501036_0275270 Ga0501036_0275270_180_551 123
509 3300049573 Ga0501037_0107235 Ga0501037_0107235_1371_1742 123
510 3300049577 Ga0501041_0212270 Ga0501041_0212270_147_518 123
511 3300049578 Ga0501042_0036838 Ga0501042_0036838_2938_3309 123
512 3300049579 Ga0501043_0622702 Ga0501043_0622702_280_651 123
513 3300049580 Ga0501046_0033621 Ga0501046_0033621_2105_2476 123
514 3300049582 Ga0501048_0318874 Ga0501048_0318874_626_997 123
515 3300049587 Ga0501071_1462430 Ga0501071_1462430_12_383 123
516 3300049590 Ga0501074_0259768 Ga0501074_0259768_714_1085 123
517 3300049592 Ga0501076_0350977 Ga0501076_0350977_180_551 123
518 3300049741 Ga0501079_1390327 Ga0501079_1390327_110_481 123
519 3300049742 Ga0501080_1610613 Ga0501080_1610613_100_471 123
520 3300049822 Ga0501035_0953021 Ga0501035_0953021_175_546 123
521 3300060353 Ga0501082_0860039 Ga0501082_0860039_61_432 123
522 3300049589 Ga0501073_0133733 Ga0501073_0133733_462_881 124
523 3300049591 Ga0501075_0207112 Ga0501075_0207112_597_1028 124
524 2162886006 SwRhRL3b_contig_1545184 SwRhRL3b_0520.00000270 125
525 2162886006 SwRhRL3b_contig_3118854 SwRhRL3b_0451.00001520 125
526 3300003349 JGI26129J50193_1002582 JGI26129J50193_10025821 125
527 3300003371 JGI26145J50221_1002080 JGI26145J50221_10020801 125
528 3300003382 JGI26139J50223_100526 JGI26139J50223_1005261 125
529 3300003392 JGI26134J50242_100045 JGI26134J50242_1000454 125
530 3300003396 JGI26137J50245_100040 JGI26137J50245_1000404 125
531 3300003398 JGI26130J50248_100845 JGI26130J50248_1008452 125
532 3300003398 JGI26130J50248_103330 JGI26130J50248_1033301 125
533 3300003399 JGI26136J50244_100012 JGI26136J50244_1000126 125
534 3300003399 JGI26136J50244_102731 JGI26136J50244_1027311 125
535 3300003503 JGI26141J51220_1000065 JGI26141J51220_10000651 125
536 3300003504 JGI26138J51218_100034 JGI26138J51218_1000342 125
537 3300005289 Ga0065704_10002310 Ga0065704_1000231012 125
538 3300005295 Ga0065707_10001142 Ga0065707_1000114210 125
539 3300005328 Ga0070676_10014403 Ga0070676_100144036 125
540 3300005331 Ga0070670_101312709 Ga0070670_1013127091 125
541 3300005331 Ga0070670_101607464 Ga0070670_1016074641 125
542 3300005341 Ga0070691_10622892 Ga0070691_106228921 125
543 3300005366 Ga0070659_100118747 Ga0070659_1001187473 125
544 3300005367 Ga0070667_101377451 Ga0070667_1013774511 125
545 3300005440 Ga0070705_100082362 Ga0070705_1000823623 125
546 3300005444 Ga0070694_100066961 Ga0070694_1000669613 125
547 3300005457 Ga0070662_100175101 Ga0070662_1001751012 125
548 3300005459 Ga0068867_100728813 Ga0068867_1007288132 125
549 3300005530 Ga0070679_101897722 Ga0070679_1018977221 125
550 3300005545 Ga0070695_100405546 Ga0070695_1004055461 125
551 3300005577 Ga0068857_100291980 Ga0068857_1002919802 125
552 3300005577 Ga0068857_100476427 Ga0068857_1004764272 125
553 3300005615 Ga0070702_100721285 Ga0070702_1007212852 125
554 3300005616 Ga0068852_100947802 Ga0068852_1009478021 125
555 3300005840 Ga0068870_10001809 Ga0068870_100018098 125
556 3300005843 Ga0068860_100232523 Ga0068860_1002325233 125
557 3300005844 Ga0068862_100232442 Ga0068862_1002324422 125
558 3300006844 Ga0075428_100007033 Ga0075428_1000070338 125
559 3300006844 Ga0075428_101108564 Ga0075428_1011085642 125
560 3300006846 Ga0075430_100269344 Ga0075430_1002693443 125
561 3300006847 Ga0075431_101182011 Ga0075431_1011820112 125
562 3300006880 Ga0075429_100003497 Ga0075429_10000349711 125
563 3300006880 Ga0075429_100135246 Ga0075429_1001352464 125
564 3300009093 Ga0105240_11282419 Ga0105240_112824191 125
565 3300009094 Ga0111539_10032379 Ga0111539_100323797 125
566 3300009094 Ga0111539_10143071 Ga0111539_101430712 125
567 3300009147 Ga0114129_10015776 Ga0114129_1001577610 125
568 3300009147 Ga0114129_10618452 Ga0114129_106184521 125
569 3300009553 Ga0105249_10333907 Ga0105249_103339071 125
570 3300011119 Ga0105246_10180792 Ga0105246_101807922 125
571 3300014326 Ga0157380_10581470 Ga0157380_105814702 125
572 3300025907 Ga0207645_10005574 Ga0207645_100055746 125
573 3300025908 Ga0207643_10000939 Ga0207643_1000093914 125
574 3300025921 Ga0207652_11267189 Ga0207652_112671891 125
575 3300025932 Ga0207690_10083758 Ga0207690_100837581 125
576 3300025933 Ga0207706_10128092 Ga0207706_101280923 125
577 3300026067 Ga0207678_10583126 Ga0207678_105831262 125
578 3300026089 Ga0207648_11218395 Ga0207648_112183951 125
579 3300026116 Ga0207674_10474259 Ga0207674_104742592 125
580 3300026116 Ga0207674_10607681 Ga0207674_106076811 125
581 3300027252 Ga0209973_1000443 Ga0209973_10004433 125
582 3300027364 Ga0209967_1000075 Ga0209967_100007510 125
583 3300027378 Ga0209981_1000656 Ga0209981_10006562 125
584 3300027395 Ga0209996_1000096 Ga0209996_10000968 125
585 3300027471 Ga0209995_1000119 Ga0209995_10001198 125
586 3300027526 Ga0209968_1000063 Ga0209968_10000638 125
587 3300027617 Ga0210002_1000481 Ga0210002_10004818 125
588 3300027665 Ga0209983_1001089 Ga0209983_10010892 125
589 3300027695 Ga0209966_1000316 Ga0209966_10003168 125
590 3300027907 Ga0207428_10033121 Ga0207428_100331211 125
591 3300028381 Ga0268264_10033024 Ga0268264_100330241 125
592 3300042001 Ga0439441_000659 Ga0439441_000659_2116_2517 125
593 3300042003 Ga0439443_022468 Ga0439443_022468_519_920 125
594 3300042008 Ga0439450_000400 Ga0439450_000400_3806_4207 125
595 3300042009 Ga0439451_003231 Ga0439451_003231_1194_1595 125
596 3300042011 Ga0439454_000030 Ga0439454_000030_1354_1755 125
597 3300042016 Ga0439463_001438 Ga0439463_001438_2811_3212 125
598 3300042436 Ga0439435_0002613 Ga0439435_0002613_3122_3523 125
599 3300042437 Ga0439444_0004325 Ga0439444_0004325_1199_1600 125
600 3300042439 Ga0439464_0032819 Ga0439464_0032819_519_920 125
601 3300042461 Ga0439460_0006124 Ga0439460_0006124_2488_2889 125
602 3300045051 Ga0451576_0029623 Ga0451576_0029623_1545_1937 125
603 3300049571 Ga0501034_0264645 Ga0501034_0264645_522_914 125
604 3300049575 Ga0501039_0394416 Ga0501039_0394416_236_613 125
605 3300049578 Ga0501042_0090118 Ga0501042_0090118_832_1209 125
606 3300049580 Ga0501046_0458314 Ga0501046_0458314_187_564 125
607 3300049587 Ga0501071_0259384 Ga0501071_0259384_600_977 125
608 3300049592 Ga0501076_0505397 Ga0501076_0505397_324_701 125
609 3300049741 Ga0501079_0536969 Ga0501079_0536969_205_582 125
610 3300049824 Ga0501045_0612283 Ga0501045_0612283_262_639 125
611 3300050507 nmdc:mga05p37_6406_c2 nmdc:mga05p37_6406_c2_11613_11990 125
612 3300050507 nmdc:mga05p37_89340_c1 nmdc:mga05p37_89340_c1_504_881 125
613 3300050508 nmdc:mga09592_150935_c1 nmdc:mga09592_150935_c1_1125_1502 125
614 3300050508 nmdc:mga09592_1603_c1 nmdc:mga09592_1603_c1_6465_6842 125
615 3300050508 nmdc:mga09592_201729_c1 nmdc:mga09592_201729_c1_33_410 125
616 3300050509 nmdc:mga0qj67_25579_c1 nmdc:mga0qj67_25579_c1_504_881 125
617 3300050509 nmdc:mga0qj67_283328_c1 nmdc:mga0qj67_283328_c1_865_1242 125
618 3300050510 nmdc:mga06r32_2035748_c1 nmdc:mga06r32_2035748_c1_87_464 125
619 3300050510 nmdc:mga06r32_35589_c2 nmdc:mga06r32_35589_c2_294_671 125
620 3300050510 nmdc:mga06r32_8121_c1 nmdc:mga06r32_8121_c1_621_998 125
621 3300050511 nmdc:mga08y16_136996_c1 nmdc:mga08y16_136996_c1_522_899 125
622 3300050511 nmdc:mga08y16_209766_c1 nmdc:mga08y16_209766_c1_789_1166 125
623 3300050511 nmdc:mga08y16_961159_c1 nmdc:mga08y16_961159_c1_426_803 125
624 3300050511 nmdc:mga08y16_966_c2 nmdc:mga08y16_966_c2_7839_8216 125
625 3300060353 Ga0501082_0225397 Ga0501082_0225397_291_668 125
626 3300061734 Ga0530510_0080761 Ga0530510_0080761_130_507 125
627 3300061734 Ga0530510_0216571 Ga0530510_0216571_779_1156 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07237

DUF1428

Protein of unknown function (DUF1428)

27

129

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9255 7 124
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.9213 4 124
2okq-assembly1.cif.gz_A crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8795 4 124
2okq-assembly1.cif.gz_B crystal structure of unknown conserved ybaa protein from shigella flexneri 0.8521 7 124
8ecx-assembly1.cif.gz_B pa0709 with glyoxal and bme modifications 0.7625 6 99
ID Description Score Start End Superfamily
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9189 8 124 3.30.70.100
af_P0AAQ6_1_117_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9041 8 124 3.30.70.100
3qmqB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.728 9 123 3.30.70.100
af_F6NVH9_176_279_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7278 6 124 3.30.70.100
1xbwA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7183 8 125 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A3N5W334-F1-model_v4 DUF1428 domain-containing protein 0.9878 1 125
AF-A0A2N3EFM6-F1-model_v4 DUF1428 domain-containing protein 0.9804 8 124
AF-A0A7W0LC78-F1-model_v4 DUF1428 domain-containing protein 0.979 6 124
AF-A0A2V9R7F6-F1-model_v4 DUF1428 domain-containing protein 0.9776 8 125
AF-A0A7T9J2T4-F1-model_v4 deleted 0.9708 6 124

Feature Viewer

pLDDT pTM Quality
93.21 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map