F470599
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 350 | 627 | 120 |
Family's Representative Sequence
| Representative Sequence | 3300049591|Ga0501075_0207112|Ga0501075_0207112_597_1028 |
| Length | 143 |
| Sequence | MPRTRPRSIVDVRYATQASTTRRIRMAYVDGFLVPVPKSKLAEYRRMAQKAGKVWKEHGALEFRECVGDDLDVDMGRSFKEGAGLKRGETVMFSWIAYKSKAHRDRVNAKVMKDPRIAGMDEKSMPFDVDRMCYGGFKVLVDL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 13 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 14 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 15 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 16 | 3300003371 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM | Metagenome | Rhizosphere |
| 17 | 3300003382 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM | Metagenome | Rhizosphere |
| 18 | 3300003392 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM | Metagenome | Rhizosphere |
| 19 | 3300003396 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM | Metagenome | Rhizosphere |
| 20 | 3300003398 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM | Metagenome | Rhizosphere |
| 21 | 3300003399 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM | Metagenome | Rhizosphere |
| 22 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 23 | 3300003504 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM | Metagenome | Rhizosphere |
| 24 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 25 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 89 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 90 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 91 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 92 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 93 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 106 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 107 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 108 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 109 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 110 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 112 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 113 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 114 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 115 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 116 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 120 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 121 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 123 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 140 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 238 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 239 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 242 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 243 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 244 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 245 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 250 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 252 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 253 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 255 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 256 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 261 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 262 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 263 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 264 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 265 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 266 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 267 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 268 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 269 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 270 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 271 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 272 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 273 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 274 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 347 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 348 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.84 |
| Metatranscriptomes | 0.16 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.94 |
| Nodule | 0 |
| Rhizoplane | 4.63 |
| Rhizosphere | 89.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1545184 | 2162886006 | Archaea | 1015 |
| 2 | SwRhRL3b_contig_3118854 | 2162886006 | Archaea | 5637 |
| 3 | MRS1b_contig_52275 | 2162886011 | Bacteria | 2273 |
| 4 | MBSR1b_contig_2599212 | 2162886012 | Bacteria | 2129 |
| 5 | MBSR1b_contig_7247536 | 2162886012 | Bacteria | 1155 |
| 6 | JGI24741J21665_1033634 | 3300001915 | Unclassified | 763 |
| 7 | JGI24752J21851_1008799 | 3300001976 | Bacteria | 1318 |
| 8 | JGI24752J21851_1009973 | 3300001976 | Bacteria | 1239 |
| 9 | JGI24752J21851_1025577 | 3300001976 | Bacteria | 774 |
| 10 | JGI24746J21847_1023181 | 3300001977 | Bacteria | 864 |
| 11 | JGI24747J21853_1015245 | 3300001978 | Unclassified | 805 |
| 12 | JGI24737J22298_10025794 | 3300001990 | Bacteria | 1857 |
| 13 | JGI24737J22298_10092088 | 3300001990 | Bacteria | 899 |
| 14 | JGI24743J22301_10015255 | 3300001991 | Bacteria | 1423 |
| 15 | JGI24743J22301_10053080 | 3300001991 | Bacteria | 828 |
| 16 | JGI24735J21928_10129251 | 3300002067 | Bacteria | 728 |
| 17 | JGI24748J21848_1007059 | 3300002074 | Bacteria | 1315 |
| 18 | JGI24034J26672_10002946 | 3300002239 | Bacteria | 2359 |
| 19 | JGI24742J22300_10032457 | 3300002244 | Unclassified | 915 |
| 20 | JGI24751J29686_10004419 | 3300002459 | Bacteria | 2854 |
| 21 | JGI24751J29686_10004481 | 3300002459 | Bacteria | 2835 |
| 22 | JGI26129J50193_1002582 | 3300003349 | Unclassified | 1271 |
| 23 | JGI26145J50221_1002080 | 3300003371 | Bacteria | 1572 |
| 24 | JGI26145J50221_1034683 | 3300003371 | Bacteria | 524 |
| 25 | JGI26139J50223_100526 | 3300003382 | Unclassified | 1416 |
| 26 | JGI26134J50242_100045 | 3300003392 | Archaea | 6679 |
| 27 | JGI26137J50245_100040 | 3300003396 | Archaea | 6411 |
| 28 | JGI26130J50248_100845 | 3300003398 | Unclassified | 982 |
| 29 | JGI26130J50248_103330 | 3300003398 | Archaea | 500 |
| 30 | JGI26136J50244_100012 | 3300003399 | Archaea | 6340 |
| 31 | JGI26136J50244_102731 | 3300003399 | Archaea | 560 |
| 32 | JGI26141J51220_1000065 | 3300003503 | Archaea | 4599 |
| 33 | JGI26138J51218_100034 | 3300003504 | Archaea | 5814 |
| 34 | Ga0058859_11573965 | 3300004798 | Bacteria | 660 |
| 35 | Ga0065704_10002310 | 3300005289 | Archaea | 8097 |
| 36 | Ga0065704_10628753 | 3300005289 | Unclassified | 560 |
| 37 | Ga0065712_10079196 | 3300005290 | Unclassified | 3247 |
| 38 | Ga0065712_10451385 | 3300005290 | Bacteria | 686 |
| 39 | Ga0065715_10181563 | 3300005293 | Bacteria | 1473 |
| 40 | Ga0065707_10001142 | 3300005295 | Archaea | 7789 |
| 41 | Ga0065707_10118002 | 3300005295 | Bacteria | 2197 |
| 42 | Ga0065707_10137003 | 3300005295 | Bacteria | 1826 |
| 43 | Ga0070658_10116778 | 3300005327 | Bacteria | 2215 |
| 44 | Ga0070658_10201857 | 3300005327 | Bacteria | 1678 |
| 45 | Ga0070676_10003640 | 3300005328 | Bacteria | 8063 |
| 46 | Ga0070676_10011045 | 3300005328 | Bacteria | 4908 |
| 47 | Ga0070676_10014403 | 3300005328 | Archaea | 4345 |
| 48 | Ga0070683_100019783 | 3300005329 | Bacteria | 5984 |
| 49 | Ga0070683_100215413 | 3300005329 | Bacteria | 1825 |
| 50 | Ga0070690_100000541 | 3300005330 | Bacteria | 18903 |
| 51 | Ga0070690_100040473 | 3300005330 | Bacteria | 2948 |
| 52 | Ga0070670_100023275 | 3300005331 | Bacteria | 5331 |
| 53 | Ga0070670_100073709 | 3300005331 | Bacteria | 2932 |
| 54 | Ga0070670_101312709 | 3300005331 | Unclassified | 662 |
| 55 | Ga0070670_101607464 | 3300005331 | Archaea | 597 |
| 56 | Ga0068869_100069126 | 3300005334 | Bacteria | 2610 |
| 57 | Ga0070666_10003865 | 3300005335 | Bacteria | 9093 |
| 58 | Ga0070680_100004731 | 3300005336 | Bacteria | 10247 |
| 59 | Ga0070682_100005894 | 3300005337 | Bacteria | 6850 |
| 60 | Ga0070682_100009937 | 3300005337 | Bacteria | 5390 |
| 61 | Ga0068868_100043822 | 3300005338 | Bacteria | 3496 |
| 62 | Ga0068868_100281602 | 3300005338 | Bacteria | 1407 |
| 63 | Ga0070660_100001305 | 3300005339 | Bacteria | 16998 |
| 64 | Ga0070660_100003403 | 3300005339 | Bacteria | 10947 |
| 65 | Ga0070689_100086179 | 3300005340 | Bacteria | 2470 |
| 66 | Ga0070689_100089582 | 3300005340 | Bacteria | 2423 |
| 67 | Ga0070691_10000488 | 3300005341 | Bacteria | 14870 |
| 68 | Ga0070691_10622892 | 3300005341 | Unclassified | 639 |
| 69 | Ga0070687_100001870 | 3300005343 | Bacteria | 7636 |
| 70 | Ga0070687_100070183 | 3300005343 | Bacteria | 1879 |
| 71 | Ga0070661_100000292 | 3300005344 | Bacteria | 40495 |
| 72 | Ga0070692_10018450 | 3300005345 | Bacteria | 3357 |
| 73 | Ga0070668_100002727 | 3300005347 | Bacteria | 12993 |
| 74 | Ga0070668_100016470 | 3300005347 | Bacteria | 5527 |
| 75 | Ga0070669_100000436 | 3300005353 | Bacteria | 31833 |
| 76 | Ga0070669_100060775 | 3300005353 | Bacteria | 2776 |
| 77 | Ga0070669_101363559 | 3300005353 | Bacteria | 615 |
| 78 | Ga0070675_100038398 | 3300005354 | Bacteria | 3902 |
| 79 | Ga0070671_100093451 | 3300005355 | Bacteria | 2520 |
| 80 | Ga0070671_100498449 | 3300005355 | Bacteria | 1047 |
| 81 | Ga0070674_100002709 | 3300005356 | Bacteria | 9799 |
| 82 | Ga0070673_100000301 | 3300005364 | Bacteria | 25841 |
| 83 | Ga0070673_100369716 | 3300005364 | Bacteria | 1276 |
| 84 | Ga0070688_100001500 | 3300005365 | Bacteria | 11630 |
| 85 | Ga0070688_100004625 | 3300005365 | Bacteria | 7186 |
| 86 | Ga0070659_100008100 | 3300005366 | Bacteria | 7664 |
| 87 | Ga0070659_100034719 | 3300005366 | Bacteria | 3924 |
| 88 | Ga0070659_100118747 | 3300005366 | Archaea | 2140 |
| 89 | Ga0070667_100000941 | 3300005367 | Bacteria | 26761 |
| 90 | Ga0070667_100623603 | 3300005367 | Unclassified | 994 |
| 91 | Ga0070667_101377451 | 3300005367 | Archaea | 661 |
| 92 | Ga0070709_10003268 | 3300005434 | Bacteria | 8711 |
| 93 | Ga0070714_100012854 | 3300005435 | Bacteria | 6692 |
| 94 | Ga0070713_100023098 | 3300005436 | Bacteria | 4819 |
| 95 | Ga0070710_10002192 | 3300005437 | Bacteria | 9215 |
| 96 | Ga0070701_10037467 | 3300005438 | Bacteria | 2448 |
| 97 | Ga0070701_10148229 | 3300005438 | Bacteria | 1348 |
| 98 | Ga0070711_100044574 | 3300005439 | Bacteria | 3012 |
| 99 | Ga0070705_100001662 | 3300005440 | Bacteria | 11637 |
| 100 | Ga0070705_100082362 | 3300005440 | Archaea | 1980 |
| 101 | Ga0070700_100002296 | 3300005441 | Bacteria | 9725 |
| 102 | Ga0070700_100014627 | 3300005441 | Bacteria | 4434 |
| 103 | Ga0070694_100059393 | 3300005444 | Bacteria | 2604 |
| 104 | Ga0070694_100066961 | 3300005444 | Archaea | 2464 |
| 105 | Ga0070708_100157248 | 3300005445 | Bacteria | 2117 |
| 106 | Ga0070663_100000631 | 3300005455 | Bacteria | 18906 |
| 107 | Ga0070678_100000488 | 3300005456 | Bacteria | 18986 |
| 108 | Ga0070678_100603056 | 3300005456 | Unclassified | 980 |
| 109 | Ga0070662_100001505 | 3300005457 | Bacteria | 14339 |
| 110 | Ga0070662_100175101 | 3300005457 | Archaea | 1687 |
| 111 | Ga0070681_10122200 | 3300005458 | Bacteria | 2537 |
| 112 | Ga0068867_100004533 | 3300005459 | Bacteria | 9767 |
| 113 | Ga0068867_100012911 | 3300005459 | Bacteria | 5910 |
| 114 | Ga0068867_100728813 | 3300005459 | Unclassified | 877 |
| 115 | Ga0070685_10016898 | 3300005466 | Bacteria | 3894 |
| 116 | Ga0070685_10033646 | 3300005466 | Bacteria | 2882 |
| 117 | Ga0070699_100314984 | 3300005518 | Bacteria | 1405 |
| 118 | Ga0070679_100362431 | 3300005530 | Bacteria | 1397 |
| 119 | Ga0070679_101897722 | 3300005530 | Unclassified | 544 |
| 120 | Ga0070684_100003013 | 3300005535 | Bacteria | 12544 |
| 121 | Ga0070684_100033816 | 3300005535 | Bacteria | 4368 |
| 122 | Ga0070697_100033146 | 3300005536 | Bacteria | 4160 |
| 123 | Ga0068853_100031322 | 3300005539 | Bacteria | 4499 |
| 124 | Ga0068853_100111225 | 3300005539 | Bacteria | 2433 |
| 125 | Ga0070672_100020119 | 3300005543 | Bacteria | 4863 |
| 126 | Ga0070672_100161640 | 3300005543 | Bacteria | 1858 |
| 127 | Ga0070686_100000909 | 3300005544 | Bacteria | 17148 |
| 128 | Ga0070686_100021089 | 3300005544 | Bacteria | 3866 |
| 129 | Ga0070695_100015863 | 3300005545 | Bacteria | 4552 |
| 130 | Ga0070695_100405546 | 3300005545 | Archaea | 1034 |
| 131 | Ga0070696_100153385 | 3300005546 | Bacteria | 1692 |
| 132 | Ga0070696_101812327 | 3300005546 | Unclassified | 527 |
| 133 | Ga0070665_100010653 | 3300005548 | Bacteria | 9308 |
| 134 | Ga0070704_101599191 | 3300005549 | Unclassified | 601 |
| 135 | Ga0068855_100011601 | 3300005563 | Bacteria | 10646 |
| 136 | Ga0068855_100043085 | 3300005563 | Bacteria | 5347 |
| 137 | Ga0070664_100002105 | 3300005564 | Bacteria | 15909 |
| 138 | Ga0070664_100084748 | 3300005564 | Bacteria | 2736 |
| 139 | Ga0068857_100005254 | 3300005577 | Bacteria | 11025 |
| 140 | Ga0068857_100007922 | 3300005577 | Bacteria | 9168 |
| 141 | Ga0068857_100291980 | 3300005577 | Archaea | 1501 |
| 142 | Ga0068857_100476427 | 3300005577 | Unclassified | 1169 |
| 143 | Ga0068854_100018882 | 3300005578 | Bacteria | 4636 |
| 144 | Ga0068854_100019749 | 3300005578 | Bacteria | 4547 |
| 145 | Ga0068856_100042031 | 3300005614 | Bacteria | 4495 |
| 146 | Ga0068856_100084493 | 3300005614 | Bacteria | 3153 |
| 147 | Ga0070702_100035488 | 3300005615 | Bacteria | 2755 |
| 148 | Ga0070702_100236064 | 3300005615 | Bacteria | 1231 |
| 149 | Ga0070702_100721285 | 3300005615 | Archaea | 762 |
| 150 | Ga0068852_100012062 | 3300005616 | Bacteria | 6542 |
| 151 | Ga0068852_100014600 | 3300005616 | Bacteria | 6054 |
| 152 | Ga0068852_100947802 | 3300005616 | Archaea | 879 |
| 153 | Ga0068859_100244077 | 3300005617 | Bacteria | 1885 |
| 154 | Ga0068859_100640178 | 3300005617 | Bacteria | 1155 |
| 155 | Ga0068864_100004333 | 3300005618 | Bacteria | 11653 |
| 156 | Ga0068866_10011330 | 3300005718 | Bacteria | 3855 |
| 157 | Ga0068866_10013440 | 3300005718 | Bacteria | 3592 |
| 158 | Ga0068861_100202678 | 3300005719 | Bacteria | 1666 |
| 159 | Ga0068851_10005404 | 3300005834 | Bacteria | 5795 |
| 160 | Ga0068870_10001809 | 3300005840 | Archaea | 8777 |
| 161 | Ga0068858_100041522 | 3300005842 | Bacteria | 4264 |
| 162 | Ga0068860_100002808 | 3300005843 | Bacteria | 18114 |
| 163 | Ga0068860_100154339 | 3300005843 | Bacteria | 2212 |
| 164 | Ga0068860_100232523 | 3300005843 | Archaea | 1791 |
| 165 | Ga0068862_100034536 | 3300005844 | Bacteria | 4279 |
| 166 | Ga0068862_100048246 | 3300005844 | Bacteria | 3635 |
| 167 | Ga0068862_100232442 | 3300005844 | Archaea | 1673 |
| 168 | Ga0081540_1001147 | 3300005983 | Bacteria | 23388 |
| 169 | Ga0070717_10500627 | 3300006028 | Bacteria | 1098 |
| 170 | Ga0075365_10325635 | 3300006038 | Bacteria | 1082 |
| 171 | Ga0075365_10758956 | 3300006038 | Bacteria | 685 |
| 172 | Ga0075368_10146482 | 3300006042 | Bacteria | 985 |
| 173 | Ga0075368_10189777 | 3300006042 | Bacteria | 868 |
| 174 | Ga0075363_100104339 | 3300006048 | Bacteria | 1571 |
| 175 | Ga0075363_100288063 | 3300006048 | Bacteria | 951 |
| 176 | Ga0075364_10465955 | 3300006051 | Bacteria | 863 |
| 177 | Ga0075432_10010335 | 3300006058 | Bacteria | 3165 |
| 178 | Ga0070715_10000531 | 3300006163 | Bacteria | 10000 |
| 179 | Ga0070712_100020438 | 3300006175 | Bacteria | 4332 |
| 180 | Ga0070712_101119190 | 3300006175 | Unclassified | 684 |
| 181 | Ga0075362_10041992 | 3300006177 | Bacteria | 2019 |
| 182 | Ga0075362_10654214 | 3300006177 | Bacteria | 546 |
| 183 | Ga0075367_10152738 | 3300006178 | Bacteria | 1433 |
| 184 | Ga0075369_10076842 | 3300006186 | Bacteria | 1476 |
| 185 | Ga0075366_10111260 | 3300006195 | Bacteria | 1647 |
| 186 | Ga0075366_10123106 | 3300006195 | Bacteria | 1563 |
| 187 | Ga0075366_10563387 | 3300006195 | Bacteria | 706 |
| 188 | Ga0097621_100189910 | 3300006237 | Bacteria | 1779 |
| 189 | Ga0075370_10116918 | 3300006353 | Bacteria | 1550 |
| 190 | Ga0075370_10900423 | 3300006353 | Bacteria | 541 |
| 191 | Ga0068871_100182236 | 3300006358 | Bacteria | 1805 |
| 192 | Ga0075428_100007033 | 3300006844 | Archaea | 12478 |
| 193 | Ga0075428_100095078 | 3300006844 | Bacteria | 3248 |
| 194 | Ga0075428_101108564 | 3300006844 | Archaea | 836 |
| 195 | Ga0075430_100188687 | 3300006846 | Bacteria | 1714 |
| 196 | Ga0075430_100269344 | 3300006846 | Archaea | 1410 |
| 197 | Ga0075431_100130914 | 3300006847 | Bacteria | 2587 |
| 198 | Ga0075431_100215537 | 3300006847 | Unclassified | 1960 |
| 199 | Ga0075431_101044600 | 3300006847 | Bacteria | 783 |
| 200 | Ga0075431_101182011 | 3300006847 | Archaea | 728 |
| 201 | Ga0075433_10306637 | 3300006852 | Bacteria | 1405 |
| 202 | Ga0075434_100598786 | 3300006871 | Bacteria | 1121 |
| 203 | Ga0075429_100003497 | 3300006880 | Archaea | 13399 |
| 204 | Ga0075429_100135246 | 3300006880 | Unclassified | 2157 |
| 205 | Ga0075429_101113522 | 3300006880 | Bacteria | 690 |
| 206 | Ga0068865_100001614 | 3300006881 | Bacteria | 13214 |
| 207 | Ga0068865_100054670 | 3300006881 | Bacteria | 2775 |
| 208 | Ga0075436_100222575 | 3300006914 | Bacteria | 1339 |
| 209 | Ga0097620_100244068 | 3300006931 | Bacteria | 1885 |
| 210 | Ga0097620_100640188 | 3300006931 | Bacteria | 1155 |
| 211 | Ga0075435_100835256 | 3300007076 | Bacteria | 802 |
| 212 | Ga0105244_10104999 | 3300009036 | Bacteria | 1379 |
| 213 | Ga0105250_10005936 | 3300009092 | Bacteria | 5403 |
| 214 | Ga0105250_10020592 | 3300009092 | Bacteria | 2665 |
| 215 | Ga0105240_10254002 | 3300009093 | Bacteria | 2031 |
| 216 | Ga0105240_11282419 | 3300009093 | Archaea | 773 |
| 217 | Ga0111539_10032379 | 3300009094 | Archaea | 6349 |
| 218 | Ga0111539_10143071 | 3300009094 | Archaea | 2800 |
| 219 | Ga0111539_10235245 | 3300009094 | Bacteria | 2133 |
| 220 | Ga0111539_10607999 | 3300009094 | Bacteria | 1273 |
| 221 | Ga0111539_13518285 | 3300009094 | Bacteria | 502 |
| 222 | Ga0105245_10018069 | 3300009098 | Bacteria | 6161 |
| 223 | Ga0105245_10036759 | 3300009098 | Bacteria | 4351 |
| 224 | Ga0105247_10005265 | 3300009101 | Bacteria | 8163 |
| 225 | Ga0105247_10017167 | 3300009101 | Bacteria | 4344 |
| 226 | Ga0114129_10015776 | 3300009147 | Archaea | 10740 |
| 227 | Ga0114129_10244701 | 3300009147 | Bacteria | 2410 |
| 228 | Ga0114129_10618452 | 3300009147 | Archaea | 1401 |
| 229 | Ga0114129_11242009 | 3300009147 | Unclassified | 926 |
| 230 | Ga0114129_11687674 | 3300009147 | Bacteria | 773 |
| 231 | Ga0105243_10002877 | 3300009148 | Bacteria | 14267 |
| 232 | Ga0105241_10003054 | 3300009174 | Bacteria | 12484 |
| 233 | Ga0105241_10017418 | 3300009174 | Bacteria | 5281 |
| 234 | Ga0105242_10018248 | 3300009176 | Bacteria | 5483 |
| 235 | Ga0105242_10049675 | 3300009176 | Bacteria | 3413 |
| 236 | Ga0105242_10243662 | 3300009176 | Bacteria | 1617 |
| 237 | Ga0105242_13022448 | 3300009176 | Unclassified | 521 |
| 238 | Ga0105248_10001545 | 3300009177 | Bacteria | 25616 |
| 239 | Ga0105237_10006244 | 3300009545 | Bacteria | 13268 |
| 240 | Ga0105237_10132534 | 3300009545 | Bacteria | 2486 |
| 241 | Ga0105238_10059285 | 3300009551 | Bacteria | 3834 |
| 242 | Ga0105238_10373411 | 3300009551 | Bacteria | 1416 |
| 243 | Ga0105249_10000740 | 3300009553 | Bacteria | 29426 |
| 244 | Ga0105249_10022601 | 3300009553 | Bacteria | 5635 |
| 245 | Ga0105249_10333907 | 3300009553 | Archaea | 1530 |
| 246 | Ga0105239_10023993 | 3300010375 | Bacteria | 6718 |
| 247 | Ga0105239_10216611 | 3300010375 | Bacteria | 2147 |
| 248 | Ga0105246_10001739 | 3300011119 | Bacteria | 13025 |
| 249 | Ga0105246_10019764 | 3300011119 | Bacteria | 4312 |
| 250 | Ga0105246_10180792 | 3300011119 | Unclassified | 1624 |
| 251 | Ga0157323_1006337 | 3300012495 | Unclassified | 822 |
| 252 | Ga0157373_10072677 | 3300013100 | Bacteria | 2428 |
| 253 | Ga0157373_10080495 | 3300013100 | Bacteria | 2297 |
| 254 | Ga0157371_10003347 | 3300013102 | Bacteria | 14608 |
| 255 | Ga0157371_10026473 | 3300013102 | Bacteria | 4215 |
| 256 | Ga0157369_10121632 | 3300013105 | Bacteria | 2769 |
| 257 | Ga0157374_10034021 | 3300013296 | Bacteria | 4653 |
| 258 | Ga0157374_10253664 | 3300013296 | Bacteria | 1731 |
| 259 | Ga0157378_10055166 | 3300013297 | Bacteria | 3539 |
| 260 | Ga0163162_10006077 | 3300013306 | Bacteria | 11688 |
| 261 | Ga0163162_10497488 | 3300013306 | Bacteria | 1350 |
| 262 | Ga0157372_10018528 | 3300013307 | Bacteria | 7486 |
| 263 | Ga0157372_10225268 | 3300013307 | Bacteria | 2174 |
| 264 | Ga0157375_10074868 | 3300013308 | Bacteria | 3408 |
| 265 | Ga0157375_12167126 | 3300013308 | Unclassified | 662 |
| 266 | Ga0163163_10037711 | 3300014325 | Bacteria | 4703 |
| 267 | Ga0163163_10062871 | 3300014325 | Bacteria | 3679 |
| 268 | Ga0157380_10002295 | 3300014326 | Bacteria | 12856 |
| 269 | Ga0157380_10053820 | 3300014326 | Bacteria | 3192 |
| 270 | Ga0157380_10581470 | 3300014326 | Archaea | 1104 |
| 271 | Ga0157377_10000604 | 3300014745 | Bacteria | 14890 |
| 272 | Ga0157377_10017066 | 3300014745 | Bacteria | 3750 |
| 273 | Ga0157379_10041479 | 3300014968 | Bacteria | 4108 |
| 274 | Ga0157379_10214274 | 3300014968 | Bacteria | 1744 |
| 275 | Ga0157376_10029924 | 3300014969 | Bacteria | 4340 |
| 276 | Ga0163161_10000777 | 3300017792 | Bacteria | 25062 |
| 277 | Ga0163161_10010955 | 3300017792 | Bacteria | 6284 |
| 278 | Ga0207697_10009651 | 3300025315 | Bacteria | 4157 |
| 279 | Ga0207656_10007939 | 3300025321 | Bacteria | 3890 |
| 280 | Ga0207656_10059954 | 3300025321 | Bacteria | 1667 |
| 281 | Ga0207696_1046759 | 3300025711 | Bacteria | 1248 |
| 282 | Ga0207653_10121532 | 3300025885 | Bacteria | 940 |
| 283 | Ga0207692_10039147 | 3300025898 | Bacteria | 2330 |
| 284 | Ga0207642_10024011 | 3300025899 | Bacteria | 2445 |
| 285 | Ga0207642_10107206 | 3300025899 | Bacteria | 1415 |
| 286 | Ga0207710_10014677 | 3300025900 | Bacteria | 3307 |
| 287 | Ga0207710_10113975 | 3300025900 | Bacteria | 1286 |
| 288 | Ga0207688_10012936 | 3300025901 | Bacteria | 4535 |
| 289 | Ga0207688_10155657 | 3300025901 | Bacteria | 1352 |
| 290 | Ga0207680_10022429 | 3300025903 | Bacteria | 3433 |
| 291 | Ga0207680_10069511 | 3300025903 | Bacteria | 2176 |
| 292 | Ga0207647_10000413 | 3300025904 | Bacteria | 35152 |
| 293 | Ga0207647_10014154 | 3300025904 | Bacteria | 5507 |
| 294 | Ga0207685_10011418 | 3300025905 | Bacteria | 2669 |
| 295 | Ga0207699_10000914 | 3300025906 | Bacteria | 14122 |
| 296 | Ga0207645_10003125 | 3300025907 | Bacteria | 12696 |
| 297 | Ga0207645_10005574 | 3300025907 | Archaea | 9108 |
| 298 | Ga0207643_10000939 | 3300025908 | Archaea | 17479 |
| 299 | Ga0207643_10001093 | 3300025908 | Bacteria | 16060 |
| 300 | Ga0207705_10048442 | 3300025909 | Bacteria | 3057 |
| 301 | Ga0207705_11124156 | 3300025909 | Bacteria | 605 |
| 302 | Ga0207654_10106425 | 3300025911 | Unclassified | 1737 |
| 303 | Ga0207671_10019791 | 3300025914 | Bacteria | 5139 |
| 304 | Ga0207671_10245864 | 3300025914 | Bacteria | 1406 |
| 305 | Ga0207693_10000200 | 3300025915 | Bacteria | 54560 |
| 306 | Ga0207663_10002481 | 3300025916 | Bacteria | 8881 |
| 307 | Ga0207660_10062130 | 3300025917 | Bacteria | 2690 |
| 308 | Ga0207662_10003669 | 3300025918 | Bacteria | 7954 |
| 309 | Ga0207662_10048294 | 3300025918 | Bacteria | 2521 |
| 310 | Ga0207657_10000248 | 3300025919 | Bacteria | 57425 |
| 311 | Ga0207657_10002871 | 3300025919 | Bacteria | 18515 |
| 312 | Ga0207649_10001017 | 3300025920 | Bacteria | 17305 |
| 313 | Ga0207649_10035146 | 3300025920 | Bacteria | 3009 |
| 314 | Ga0207652_10068798 | 3300025921 | Bacteria | 3072 |
| 315 | Ga0207652_11267189 | 3300025921 | Archaea | 640 |
| 316 | Ga0207646_10748030 | 3300025922 | Bacteria | 872 |
| 317 | Ga0207681_10025337 | 3300025923 | Bacteria | 3814 |
| 318 | Ga0207681_10206143 | 3300025923 | Bacteria | 1512 |
| 319 | Ga0207694_10191739 | 3300025924 | Bacteria | 1660 |
| 320 | Ga0207694_11555842 | 3300025924 | Unclassified | 558 |
| 321 | Ga0207650_10000051 | 3300025925 | Bacteria | 168652 |
| 322 | Ga0207650_10013639 | 3300025925 | Bacteria | 5632 |
| 323 | Ga0207659_10012088 | 3300025926 | Bacteria | 5475 |
| 324 | Ga0207659_10039047 | 3300025926 | Bacteria | 3307 |
| 325 | Ga0207687_10061356 | 3300025927 | Bacteria | 2655 |
| 326 | Ga0207687_11096492 | 3300025927 | Bacteria | 684 |
| 327 | Ga0207700_10141785 | 3300025928 | Bacteria | 1975 |
| 328 | Ga0207664_10701261 | 3300025929 | Bacteria | 910 |
| 329 | Ga0207644_10006972 | 3300025931 | Bacteria | 7358 |
| 330 | Ga0207644_10031827 | 3300025931 | Bacteria | 3677 |
| 331 | Ga0207690_10002135 | 3300025932 | Bacteria | 12105 |
| 332 | Ga0207690_10083758 | 3300025932 | Archaea | 2234 |
| 333 | Ga0207690_10372348 | 3300025932 | Bacteria | 1133 |
| 334 | Ga0207706_10000886 | 3300025933 | Bacteria | 30754 |
| 335 | Ga0207706_10006949 | 3300025933 | Bacteria | 10464 |
| 336 | Ga0207706_10128092 | 3300025933 | Archaea | 2232 |
| 337 | Ga0207686_10042390 | 3300025934 | Bacteria | 2782 |
| 338 | Ga0207686_10107319 | 3300025934 | Bacteria | 1876 |
| 339 | Ga0207709_10016910 | 3300025935 | Bacteria | 4064 |
| 340 | Ga0207670_10020207 | 3300025936 | Bacteria | 4087 |
| 341 | Ga0207670_10047520 | 3300025936 | Bacteria | 2859 |
| 342 | Ga0207669_10001242 | 3300025937 | Bacteria | 10853 |
| 343 | Ga0207704_10011337 | 3300025938 | Bacteria | 4385 |
| 344 | Ga0207704_10145496 | 3300025938 | Bacteria | 1664 |
| 345 | Ga0207665_10000748 | 3300025939 | Bacteria | 21878 |
| 346 | Ga0207691_10078171 | 3300025940 | Bacteria | 2978 |
| 347 | Ga0207711_10104857 | 3300025941 | Bacteria | 2506 |
| 348 | Ga0207689_10000184 | 3300025942 | Bacteria | 54232 |
| 349 | Ga0207689_10415676 | 3300025942 | Bacteria | 1122 |
| 350 | Ga0207661_10000122 | 3300025944 | Bacteria | 49562 |
| 351 | Ga0207661_10084012 | 3300025944 | Bacteria | 2636 |
| 352 | Ga0207679_10000101 | 3300025945 | Bacteria | 71096 |
| 353 | Ga0207679_10006004 | 3300025945 | Bacteria | 7640 |
| 354 | Ga0207667_10247518 | 3300025949 | Bacteria | 1824 |
| 355 | Ga0207651_10001356 | 3300025960 | Bacteria | 11086 |
| 356 | Ga0207651_10384222 | 3300025960 | Bacteria | 1190 |
| 357 | Ga0207712_10082579 | 3300025961 | Bacteria | 2343 |
| 358 | Ga0207712_10702225 | 3300025961 | Bacteria | 883 |
| 359 | Ga0207668_10057386 | 3300025972 | Bacteria | 2715 |
| 360 | Ga0207668_10112860 | 3300025972 | Bacteria | 2042 |
| 361 | Ga0207640_10024018 | 3300025981 | Bacteria | 3672 |
| 362 | Ga0207640_10150886 | 3300025981 | Bacteria | 1707 |
| 363 | Ga0207658_10023411 | 3300025986 | Bacteria | 4310 |
| 364 | Ga0207658_10619422 | 3300025986 | Bacteria | 973 |
| 365 | Ga0207703_10020545 | 3300026035 | Bacteria | 5165 |
| 366 | Ga0207639_10024616 | 3300026041 | Bacteria | 4359 |
| 367 | Ga0207639_10038436 | 3300026041 | Bacteria | 3560 |
| 368 | Ga0207678_10002318 | 3300026067 | Bacteria | 17253 |
| 369 | Ga0207678_10033626 | 3300026067 | Bacteria | 4466 |
| 370 | Ga0207678_10583126 | 3300026067 | Archaea | 980 |
| 371 | Ga0207708_10009620 | 3300026075 | Bacteria | 7167 |
| 372 | Ga0207708_10036747 | 3300026075 | Bacteria | 3730 |
| 373 | Ga0207702_10029252 | 3300026078 | Bacteria | 4584 |
| 374 | Ga0207702_10302115 | 3300026078 | Bacteria | 1519 |
| 375 | Ga0207641_10000006 | 3300026088 | Bacteria | 442569 |
| 376 | Ga0207641_10046134 | 3300026088 | Bacteria | 3672 |
| 377 | Ga0207648_10006908 | 3300026089 | Bacteria | 11245 |
| 378 | Ga0207648_10356014 | 3300026089 | Bacteria | 1320 |
| 379 | Ga0207648_11218395 | 3300026089 | Unclassified | 707 |
| 380 | Ga0207676_10000155 | 3300026095 | Bacteria | 59757 |
| 381 | Ga0207674_10000537 | 3300026116 | Bacteria | 49684 |
| 382 | Ga0207674_10001082 | 3300026116 | Bacteria | 35408 |
| 383 | Ga0207674_10474259 | 3300026116 | Unclassified | 1209 |
| 384 | Ga0207674_10607681 | 3300026116 | Unclassified | 1056 |
| 385 | Ga0207675_100000602 | 3300026118 | Bacteria | 35101 |
| 386 | Ga0207675_100392337 | 3300026118 | Bacteria | 1367 |
| 387 | Ga0207683_10000236 | 3300026121 | Bacteria | 48996 |
| 388 | Ga0207683_10010359 | 3300026121 | Bacteria | 7953 |
| 389 | Ga0207698_10204435 | 3300026142 | Bacteria | 1771 |
| 390 | Ga0207698_10528769 | 3300026142 | Bacteria | 1152 |
| 391 | Ga0209973_1000443 | 3300027252 | Archaea | 3122 |
| 392 | Ga0209973_1007292 | 3300027252 | Unclassified | 1232 |
| 393 | Ga0209969_1065446 | 3300027360 | Bacteria | 576 |
| 394 | Ga0209967_1000075 | 3300027364 | Archaea | 13452 |
| 395 | Ga0209981_1000656 | 3300027378 | Archaea | 4368 |
| 396 | Ga0209996_1000096 | 3300027395 | Archaea | 11659 |
| 397 | Ga0210000_1053577 | 3300027462 | Bacteria | 649 |
| 398 | Ga0209995_1000119 | 3300027471 | Archaea | 12334 |
| 399 | Ga0209968_1000063 | 3300027526 | Archaea | 19330 |
| 400 | Ga0209968_1047395 | 3300027526 | Bacteria | 742 |
| 401 | Ga0209970_1027855 | 3300027614 | Bacteria | 974 |
| 402 | Ga0210002_1000481 | 3300027617 | Archaea | 5429 |
| 403 | Ga0209983_1001089 | 3300027665 | Archaea | 5987 |
| 404 | Ga0209983_1008692 | 3300027665 | Bacteria | 2074 |
| 405 | Ga0209971_1011244 | 3300027682 | Bacteria | 2120 |
| 406 | Ga0209966_1000316 | 3300027695 | Archaea | 15768 |
| 407 | Ga0209813_10135094 | 3300027866 | Bacteria | 871 |
| 408 | Ga0209813_10170366 | 3300027866 | Bacteria | 791 |
| 409 | Ga0209974_10013670 | 3300027876 | Bacteria | 2703 |
| 410 | Ga0207428_10033121 | 3300027907 | Archaea | 4246 |
| 411 | Ga0207428_10043378 | 3300027907 | Bacteria | 3633 |
| 412 | Ga0268266_10011780 | 3300028379 | Bacteria | 7582 |
| 413 | Ga0268265_10012466 | 3300028380 | Bacteria | 5760 |
| 414 | Ga0268265_10146743 | 3300028380 | Bacteria | 1983 |
| 415 | Ga0268264_10002713 | 3300028381 | Bacteria | 15451 |
| 416 | Ga0268264_10033024 | 3300028381 | Archaea | 4248 |
| 417 | Ga0268264_10050928 | 3300028381 | Bacteria | 3449 |
| 418 | Ga0307515_10043657 | 3300028794 | Bacteria | 6959 |
| 419 | Ga0307513_10362351 | 3300031456 | Bacteria | 1194 |
| 420 | Ga0307508_10000071 | 3300031616 | Bacteria | 118790 |
| 421 | Ga0307410_10000001 | 3300031852 | Bacteria | 162839 |
| 422 | Ga0307410_11288133 | 3300031852 | Unclassified | 639 |
| 423 | Ga0307406_10926339 | 3300031901 | Bacteria | 743 |
| 424 | Ga0307407_10008057 | 3300031903 | Bacteria | 4810 |
| 425 | Ga0307407_10099493 | 3300031903 | Bacteria | 1801 |
| 426 | Ga0307412_10022081 | 3300031911 | Bacteria | 3895 |
| 427 | Ga0307409_100000127 | 3300031995 | Bacteria | 28561 |
| 428 | Ga0307416_100000075 | 3300032002 | Bacteria | 77549 |
| 429 | Ga0307416_102289675 | 3300032002 | Bacteria | 641 |
| 430 | Ga0307416_102551931 | 3300032002 | Bacteria | 609 |
| 431 | Ga0307411_10777636 | 3300032005 | Unclassified | 841 |
| 432 | Ga0307411_11751101 | 3300032005 | Unclassified | 576 |
| 433 | Ga0307415_100667811 | 3300032126 | Bacteria | 934 |
| 434 | Ga0373951_0016042 | 3300035091 | Bacteria | 1689 |
| 435 | Ga0373952_0013851 | 3300035092 | Bacteria | 1606 |
| 436 | Ga0373932_0030459 | 3300035112 | Bacteria | 1496 |
| 437 | Ga0373939_0293776 | 3300035114 | Bacteria | 646 |
| 438 | Ga0373960_0028627 | 3300035121 | Bacteria | 1539 |
| 439 | Ga0373942_0245664 | 3300035207 | Bacteria | 607 |
| 440 | Ga0373962_0045159 | 3300035242 | Bacteria | 1254 |
| 441 | Ga0373931_0006598 | 3300035691 | Bacteria | 5433 |
| 442 | Ga0395899_0649984 | 3300037312 | Bacteria | 666 |
| 443 | Ga0395900_0016010 | 3300037418 | Bacteria | 7640 |
| 444 | Ga0395900_1816755 | 3300037418 | Bacteria | 520 |
| 445 | Ga0395898_0043972 | 3300037466 | Bacteria | 4400 |
| 446 | Ga0395905_0001179 | 3300037471 | Bacteria | 32664 |
| 447 | Ga0395901_0003815 | 3300038443 | Bacteria | 15189 |
| 448 | Ga0451797_0165799 | 3300041453 | Unclassified | 573 |
| 449 | Ga0439441_000659 | 3300042001 | Archaea | 3946 |
| 450 | Ga0439443_022468 | 3300042003 | Archaea | 1001 |
| 451 | Ga0439450_000400 | 3300042008 | Archaea | 5554 |
| 452 | Ga0439451_003231 | 3300042009 | Archaea | 3312 |
| 453 | Ga0439454_000030 | 3300042011 | Archaea | 9334 |
| 454 | Ga0439463_001438 | 3300042016 | Archaea | 6321 |
| 455 | Ga0439434_0241335 | 3300042435 | Bacteria | 616 |
| 456 | Ga0439434_0272363 | 3300042435 | Bacteria | 582 |
| 457 | Ga0439435_0002613 | 3300042436 | Unclassified | 3611 |
| 458 | Ga0439435_0317211 | 3300042436 | Bacteria | 536 |
| 459 | Ga0439444_0004325 | 3300042437 | Archaea | 2058 |
| 460 | Ga0439464_0032819 | 3300042439 | Archaea | 1459 |
| 461 | Ga0439460_0006124 | 3300042461 | Unclassified | 2970 |
| 462 | Ga0451576_0029623 | 3300045051 | Bacteria | 5857 |
| 463 | Ga0495592_0816927 | 3300046454 | Bacteria | 553 |
| 464 | Ga0495590_0346278 | 3300046457 | Bacteria | 564 |
| 465 | Ga0495608_0297198 | 3300046511 | Bacteria | 1000 |
| 466 | Ga0495656_0293967 | 3300046615 | Bacteria | 831 |
| 467 | Ga0495656_0452267 | 3300046615 | Unclassified | 677 |
| 468 | Ga0495669_0060387 | 3300046684 | Bacteria | 1714 |
| 469 | Ga0495680_0210059 | 3300047322 | Bacteria | 1394 |
| 470 | Ga0496100_0006494 | 3300048903 | Bacteria | 6377 |
| 471 | Ga0496100_0155337 | 3300048903 | Bacteria | 1636 |
| 472 | Ga0496101_0029740 | 3300048904 | Bacteria | 3821 |
| 473 | Ga0496101_1551331 | 3300048904 | Bacteria | 515 |
| 474 | Ga0496102_0673575 | 3300048905 | Bacteria | 957 |
| 475 | Ga0496103_0037973 | 3300048906 | Bacteria | 2953 |
| 476 | Ga0496104_0718763 | 3300048907 | Bacteria | 906 |
| 477 | Ga0496104_1586682 | 3300048907 | Unclassified | 557 |
| 478 | Ga0496105_0158146 | 3300048908 | Bacteria | 1860 |
| 479 | Ga0496106_0020480 | 3300048909 | Bacteria | 4908 |
| 480 | Ga0496107_0023098 | 3300048910 | Bacteria | 4395 |
| 481 | Ga0496108_0000258 | 3300048911 | Bacteria | 45782 |
| 482 | Ga0496108_0134482 | 3300048911 | Bacteria | 2126 |
| 483 | Ga0496108_0562388 | 3300048911 | Bacteria | 994 |
| 484 | Ga0496109_0000126 | 3300048912 | Bacteria | 77920 |
| 485 | Ga0496109_0041667 | 3300048912 | Bacteria | 4158 |
| 486 | Ga0496109_0596600 | 3300048912 | Bacteria | 1040 |
| 487 | Ga0496110_0025514 | 3300048913 | Bacteria | 5052 |
| 488 | Ga0496110_0031645 | 3300048913 | Bacteria | 4565 |
| 489 | Ga0496111_0000724 | 3300048914 | Bacteria | 17595 |
| 490 | Ga0496112_0000081 | 3300048915 | Bacteria | 62594 |
| 491 | Ga0496112_0040764 | 3300048915 | Bacteria | 4541 |
| 492 | Ga0496112_0067209 | 3300048915 | Bacteria | 3537 |
| 493 | Ga0496113_0001980 | 3300048916 | Bacteria | 11735 |
| 494 | Ga0496113_0076000 | 3300048916 | Bacteria | 2564 |
| 495 | Ga0496113_0697124 | 3300048916 | Bacteria | 810 |
| 496 | Ga0496114_0270221 | 3300048917 | Bacteria | 1498 |
| 497 | Ga0496114_0809357 | 3300048917 | Unclassified | 816 |
| 498 | Ga0496126_0010210 | 3300048929 | Bacteria | 9873 |
| 499 | Ga0501031_0021104 | 3300049568 | Bacteria | 4248 |
| 500 | Ga0501031_0532011 | 3300049568 | Unclassified | 757 |
| 501 | Ga0501032_0125136 | 3300049569 | Unclassified | 1698 |
| 502 | Ga0501032_0221158 | 3300049569 | Archaea | 1232 |
| 503 | Ga0501033_0006425 | 3300049570 | Bacteria | 9205 |
| 504 | Ga0501034_0156684 | 3300049571 | Unclassified | 2251 |
| 505 | Ga0501034_0264645 | 3300049571 | Unclassified | 1662 |
| 506 | Ga0501036_0001556 | 3300049572 | Bacteria | 17726 |
| 507 | Ga0501036_0275270 | 3300049572 | Archaea | 1409 |
| 508 | Ga0501037_0039995 | 3300049573 | Eukaryota | 3451 |
| 509 | Ga0501037_0107235 | 3300049573 | Archaea | 2013 |
| 510 | Ga0501038_0034122 | 3300049574 | Eukaryota | 4476 |
| 511 | Ga0501038_0383925 | 3300049574 | Bacteria | 1089 |
| 512 | Ga0501039_0000989 | 3300049575 | Bacteria | 20675 |
| 513 | Ga0501039_0394416 | 3300049575 | Archaea | 1087 |
| 514 | Ga0501040_0000351 | 3300049576 | Bacteria | 27003 |
| 515 | Ga0501040_0675428 | 3300049576 | Archaea | 747 |
| 516 | Ga0501041_0001230 | 3300049577 | Bacteria | 14040 |
| 517 | Ga0501041_0212270 | 3300049577 | Archaea | 1214 |
| 518 | Ga0501042_0002805 | 3300049578 | Bacteria | 10781 |
| 519 | Ga0501042_0036838 | 3300049578 | Archaea | 3471 |
| 520 | Ga0501042_0090118 | 3300049578 | Archaea | 2201 |
| 521 | Ga0501042_1042389 | 3300049578 | Bacteria | 596 |
| 522 | Ga0501043_0071401 | 3300049579 | Unclassified | 2727 |
| 523 | Ga0501043_0622702 | 3300049579 | Unclassified | 795 |
| 524 | Ga0501046_0002565 | 3300049580 | Bacteria | 16995 |
| 525 | Ga0501046_0033621 | 3300049580 | Archaea | 4141 |
| 526 | Ga0501046_0458314 | 3300049580 | Archaea | 916 |
| 527 | Ga0501046_0909090 | 3300049580 | Bacteria | 614 |
| 528 | Ga0501046_1046268 | 3300049580 | Bacteria | 565 |
| 529 | Ga0501047_1247446 | 3300049581 | Bacteria | 557 |
| 530 | Ga0501048_0012837 | 3300049582 | Bacteria | 6222 |
| 531 | Ga0501048_0318874 | 3300049582 | Archaea | 1107 |
| 532 | Ga0501068_0001484 | 3300049584 | Bacteria | 12485 |
| 533 | Ga0501068_0014073 | 3300049584 | Bacteria | 4567 |
| 534 | Ga0501069_0203302 | 3300049585 | Bacteria | 1148 |
| 535 | Ga0501070_0174108 | 3300049586 | Unclassified | 1772 |
| 536 | Ga0501071_0000159 | 3300049587 | Bacteria | 28852 |
| 537 | Ga0501071_0252999 | 3300049587 | Bacteria | 1330 |
| 538 | Ga0501071_0259384 | 3300049587 | Archaea | 1313 |
| 539 | Ga0501071_0672540 | 3300049587 | Bacteria | 797 |
| 540 | Ga0501071_1462430 | 3300049587 | Unclassified | 527 |
| 541 | Ga0501072_0008151 | 3300049588 | Bacteria | 7951 |
| 542 | Ga0501072_0647513 | 3300049588 | Bacteria | 832 |
| 543 | Ga0501073_0094930 | 3300049589 | Bacteria | 2071 |
| 544 | Ga0501073_0133733 | 3300049589 | Bacteria | 1719 |
| 545 | Ga0501073_0397350 | 3300049589 | Bacteria | 952 |
| 546 | Ga0501074_0005569 | 3300049590 | Bacteria | 9061 |
| 547 | Ga0501074_0259768 | 3300049590 | Archaea | 1235 |
| 548 | Ga0501075_0014450 | 3300049591 | Eukaryota | 5657 |
| 549 | Ga0501075_0207112 | 3300049591 | Bacteria | 1496 |
| 550 | Ga0501075_0554631 | 3300049591 | Bacteria | 877 |
| 551 | Ga0501076_0009874 | 3300049592 | Bacteria | 7056 |
| 552 | Ga0501076_0122370 | 3300049592 | Bacteria | 2107 |
| 553 | Ga0501076_0350977 | 3300049592 | Archaea | 1211 |
| 554 | Ga0501076_0505397 | 3300049592 | Archaea | 996 |
| 555 | Ga0501077_0000351 | 3300049593 | Bacteria | 27245 |
| 556 | Ga0501077_0598191 | 3300049593 | Bacteria | 708 |
| 557 | Ga0501253_180624 | 3300049683 | Bacteria | 548 |
| 558 | Ga0501079_0052024 | 3300049741 | Unclassified | 3162 |
| 559 | Ga0501079_0295863 | 3300049741 | Bacteria | 1266 |
| 560 | Ga0501079_0536969 | 3300049741 | Archaea | 919 |
| 561 | Ga0501079_1390327 | 3300049741 | Archaea | 552 |
| 562 | Ga0501080_0001579 | 3300049742 | Bacteria | 19301 |
| 563 | Ga0501080_0126175 | 3300049742 | Bacteria | 2370 |
| 564 | Ga0501080_1610613 | 3300049742 | Unclassified | 550 |
| 565 | Ga0501081_0001463 | 3300049743 | Bacteria | 14467 |
| 566 | Ga0501083_0083495 | 3300049744 | Unclassified | 2116 |
| 567 | Ga0501083_0899824 | 3300049744 | Bacteria | 576 |
| 568 | Ga0501270_058524 | 3300049767 | Bacteria | 717 |
| 569 | Ga0501035_0003075 | 3300049822 | Bacteria | 16014 |
| 570 | Ga0501035_0608000 | 3300049822 | Bacteria | 890 |
| 571 | Ga0501035_0953021 | 3300049822 | Archaea | 677 |
| 572 | Ga0501044_0690482 | 3300049823 | Unclassified | 907 |
| 573 | Ga0501045_0013636 | 3300049824 | Bacteria | 5744 |
| 574 | Ga0501045_0521455 | 3300049824 | Bacteria | 882 |
| 575 | Ga0501045_0612283 | 3300049824 | Archaea | 806 |
| 576 | nmdc:mga03n38_707267_c1 | 3300050490 | Bacteria | 581 |
| 577 | nmdc:mga00v17_185209_c1 | 3300050491 | Bacteria | 1344 |
| 578 | nmdc:mga00v17_381134_c1 | 3300050491 | Bacteria | 917 |
| 579 | nmdc:mga0yw44_123493_c1 | 3300050492 | Bacteria | 1670 |
| 580 | nmdc:mga0k408_248665_c1 | 3300050493 | Bacteria | 1062 |
| 581 | nmdc:mga0k408_74257_c1 | 3300050493 | Bacteria | 1987 |
| 582 | nmdc:mga06z11_122783_c1 | 3300050494 | Bacteria | 1451 |
| 583 | nmdc:mga06z11_368647_c1 | 3300050494 | Bacteria | 862 |
| 584 | nmdc:mga04h51_174525_c1 | 3300050495 | Bacteria | 834 |
| 585 | nmdc:mga04h51_260903_c1 | 3300050495 | Bacteria | 697 |
| 586 | nmdc:mga05p37_1167905_c1 | 3300050507 | Unclassified | 799 |
| 587 | nmdc:mga05p37_291418_c1 | 3300050507 | Bacteria | 1943 |
| 588 | nmdc:mga05p37_6406_c2 | 3300050507 | Archaea | 12251 |
| 589 | nmdc:mga05p37_89340_c1 | 3300050507 | Archaea | 3797 |
| 590 | nmdc:mga09592_150935_c1 | 3300050508 | Archaea | 2005 |
| 591 | nmdc:mga09592_1603_c1 | 3300050508 | Archaea | 18240 |
| 592 | nmdc:mga09592_201729_c1 | 3300050508 | Unclassified | 1723 |
| 593 | nmdc:mga09592_653359_c1 | 3300050508 | Bacteria | 898 |
| 594 | nmdc:mga0qj67_1567190_c1 | 3300050509 | Bacteria | 506 |
| 595 | nmdc:mga0qj67_25579_c1 | 3300050509 | Archaea | 4562 |
| 596 | nmdc:mga0qj67_283328_c1 | 3300050509 | Archaea | 1343 |
| 597 | nmdc:mga0qj67_993632_c1 | 3300050509 | Unclassified | 658 |
| 598 | nmdc:mga06r32_2035748_c1 | 3300050510 | Unclassified | 508 |
| 599 | nmdc:mga06r32_224702_c1 | 3300050510 | Bacteria | 1866 |
| 600 | nmdc:mga06r32_310987_c1 | 3300050510 | Unclassified | 1561 |
| 601 | nmdc:mga06r32_35589_c2 | 3300050510 | Archaea | 1084 |
| 602 | nmdc:mga06r32_8121_c1 | 3300050510 | Archaea | 9446 |
| 603 | nmdc:mga08y16_114802_c1 | 3300050511 | Bacteria | 2804 |
| 604 | nmdc:mga08y16_1234810_c1 | 3300050511 | Unclassified | 717 |
| 605 | nmdc:mga08y16_136996_c1 | 3300050511 | Archaea | 2545 |
| 606 | nmdc:mga08y16_209766_c1 | 3300050511 | Archaea | 2017 |
| 607 | nmdc:mga08y16_303750_c1 | 3300050511 | Bacteria | 1644 |
| 608 | nmdc:mga08y16_961159_c1 | 3300050511 | Unclassified | 837 |
| 609 | nmdc:mga08y16_966_c2 | 3300050511 | Archaea | 21251 |
| 610 | nmdc:mga0n895_1037600_c1 | 3300050512 | Bacteria | 800 |
| 611 | nmdc:mga0rr50_119968_c1 | 3300050513 | Bacteria | 2092 |
| 612 | nmdc:mga0a205_55612_c1 | 3300050515 | Bacteria | 3822 |
| 613 | nmdc:mga0sz30_64716_c1 | 3300050516 | Bacteria | 1567 |
| 614 | Ga0495655_0000442 | 3300053083 | Bacteria | 6980 |
| 615 | Ga0500660_208864 | 3300053100 | Bacteria | 660 |
| 616 | Ga0500645_026689 | 3300053730 | Unclassified | 1756 |
| 617 | Ga0501084_0003638 | 3300054114 | Bacteria | 12517 |
| 618 | Ga0501084_0152193 | 3300054114 | Bacteria | 1950 |
| 619 | Ga0501084_0575962 | 3300054114 | Bacteria | 951 |
| 620 | Ga0501084_0772144 | 3300054114 | Bacteria | 810 |
| 621 | Ga0501084_0951499 | 3300054114 | Bacteria | 722 |
| 622 | Ga0501082_0019926 | 3300060353 | Bacteria | 5780 |
| 623 | Ga0501082_0225397 | 3300060353 | Archaea | 1631 |
| 624 | Ga0501082_0860039 | 3300060353 | Unclassified | 793 |
| 625 | Ga0530510_0005094 | 3300061734 | Bacteria | 9064 |
| 626 | Ga0530510_0080761 | 3300061734 | Archaea | 2367 |
| 627 | Ga0530510_0216571 | 3300061734 | Archaea | 1423 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006038 | Ga0075365_10758956 | Ga0075365_107589561 | 116 |
| 2 | 3300006195 | Ga0075366_10563387 | Ga0075366_105633872 | 116 |
| 3 | 3300006353 | Ga0075370_10900423 | Ga0075370_109004231 | 116 |
| 4 | 3300025885 | Ga0207653_10121532 | Ga0207653_101215321 | 116 |
| 5 | 3300049578 | Ga0501042_1042389 | Ga0501042_1042389_43_396 | 116 |
| 6 | 3300049592 | Ga0501076_0122370 | Ga0501076_0122370_560_913 | 116 |
| 7 | 3300049593 | Ga0501077_0598191 | Ga0501077_0598191_209_562 | 116 |
| 8 | 3300049741 | Ga0501079_0295863 | Ga0501079_0295863_883_1236 | 116 |
| 9 | 3300049744 | Ga0501083_0899824 | Ga0501083_0899824_22_375 | 116 |
| 10 | 3300049822 | Ga0501035_0608000 | Ga0501035_0608000_354_707 | 116 |
| 11 | 3300054114 | Ga0501084_0152193 | Ga0501084_0152193_515_868 | 116 |
| 12 | 3300005290 | Ga0065712_10451385 | Ga0065712_104513852 | 117 |
| 13 | 3300006038 | Ga0075365_10325635 | Ga0075365_103256352 | 117 |
| 14 | 3300006042 | Ga0075368_10146482 | Ga0075368_101464822 | 117 |
| 15 | 3300006048 | Ga0075363_100104339 | Ga0075363_1001043392 | 117 |
| 16 | 3300006051 | Ga0075364_10465955 | Ga0075364_104659552 | 117 |
| 17 | 3300006177 | Ga0075362_10041992 | Ga0075362_100419922 | 117 |
| 18 | 3300006177 | Ga0075362_10654214 | Ga0075362_106542142 | 117 |
| 19 | 3300006186 | Ga0075369_10076842 | Ga0075369_100768421 | 117 |
| 20 | 3300006195 | Ga0075366_10111260 | Ga0075366_101112603 | 117 |
| 21 | 3300006353 | Ga0075370_10116918 | Ga0075370_101169183 | 117 |
| 22 | 3300027866 | Ga0209813_10170366 | Ga0209813_101703661 | 117 |
| 23 | 3300042435 | Ga0439434_0241335 | Ga0439434_0241335_85_438 | 117 |
| 24 | 3300042435 | Ga0439434_0272363 | Ga0439434_0272363_94_447 | 117 |
| 25 | 3300049585 | Ga0501069_0203302 | Ga0501069_0203302_236_592 | 117 |
| 26 | 3300049587 | Ga0501071_0252999 | Ga0501071_0252999_295_651 | 117 |
| 27 | 3300054114 | Ga0501084_0772144 | Ga0501084_0772144_354_707 | 117 |
| 28 | 3300001976 | JGI24752J21851_1025577 | JGI24752J21851_10255771 | 118 |
| 29 | 3300001977 | JGI24746J21847_1023181 | JGI24746J21847_10231812 | 118 |
| 30 | 3300001990 | JGI24737J22298_10025794 | JGI24737J22298_100257944 | 118 |
| 31 | 3300001991 | JGI24743J22301_10053080 | JGI24743J22301_100530802 | 118 |
| 32 | 3300002067 | JGI24735J21928_10129251 | JGI24735J21928_101292511 | 118 |
| 33 | 3300003371 | JGI26145J50221_1034683 | JGI26145J50221_10346831 | 118 |
| 34 | 3300004798 | Ga0058859_11573965 | Ga0058859_115739652 | 118 |
| 35 | 3300005295 | Ga0065707_10118002 | Ga0065707_101180023 | 118 |
| 36 | 3300005327 | Ga0070658_10201857 | Ga0070658_102018573 | 118 |
| 37 | 3300005328 | Ga0070676_10003640 | Ga0070676_100036405 | 118 |
| 38 | 3300005329 | Ga0070683_100215413 | Ga0070683_1002154132 | 118 |
| 39 | 3300005330 | Ga0070690_100000541 | Ga0070690_1000005413 | 118 |
| 40 | 3300005331 | Ga0070670_100023275 | Ga0070670_1000232756 | 118 |
| 41 | 3300005334 | Ga0068869_100069126 | Ga0068869_1000691262 | 118 |
| 42 | 3300005335 | Ga0070666_10003865 | Ga0070666_1000386512 | 118 |
| 43 | 3300005336 | Ga0070680_100004731 | Ga0070680_1000047319 | 118 |
| 44 | 3300005337 | Ga0070682_100009937 | Ga0070682_1000099376 | 118 |
| 45 | 3300005338 | Ga0068868_100043822 | Ga0068868_1000438223 | 118 |
| 46 | 3300005339 | Ga0070660_100003403 | Ga0070660_10000340314 | 118 |
| 47 | 3300005340 | Ga0070689_100089582 | Ga0070689_1000895824 | 118 |
| 48 | 3300005341 | Ga0070691_10000488 | Ga0070691_100004884 | 118 |
| 49 | 3300005343 | Ga0070687_100001870 | Ga0070687_10000187010 | 118 |
| 50 | 3300005344 | Ga0070661_100000292 | Ga0070661_10000029229 | 118 |
| 51 | 3300005345 | Ga0070692_10018450 | Ga0070692_100184503 | 118 |
| 52 | 3300005347 | Ga0070668_100002727 | Ga0070668_10000272711 | 118 |
| 53 | 3300005353 | Ga0070669_100000436 | Ga0070669_10000043626 | 118 |
| 54 | 3300005353 | Ga0070669_101363559 | Ga0070669_1013635592 | 118 |
| 55 | 3300005355 | Ga0070671_100093451 | Ga0070671_1000934512 | 118 |
| 56 | 3300005356 | Ga0070674_100002709 | Ga0070674_1000027092 | 118 |
| 57 | 3300005364 | Ga0070673_100000301 | Ga0070673_10000030116 | 118 |
| 58 | 3300005365 | Ga0070688_100001500 | Ga0070688_10000150015 | 118 |
| 59 | 3300005366 | Ga0070659_100034719 | Ga0070659_1000347194 | 118 |
| 60 | 3300005367 | Ga0070667_100000941 | Ga0070667_10000094114 | 118 |
| 61 | 3300005434 | Ga0070709_10003268 | Ga0070709_100032688 | 118 |
| 62 | 3300005435 | Ga0070714_100012854 | Ga0070714_1000128542 | 118 |
| 63 | 3300005436 | Ga0070713_100023098 | Ga0070713_1000230986 | 118 |
| 64 | 3300005437 | Ga0070710_10002192 | Ga0070710_100021928 | 118 |
| 65 | 3300005438 | Ga0070701_10037467 | Ga0070701_100374674 | 118 |
| 66 | 3300005439 | Ga0070711_100044574 | Ga0070711_1000445743 | 118 |
| 67 | 3300005440 | Ga0070705_100001662 | Ga0070705_1000016622 | 118 |
| 68 | 3300005441 | Ga0070700_100002296 | Ga0070700_1000022964 | 118 |
| 69 | 3300005444 | Ga0070694_100059393 | Ga0070694_1000593934 | 118 |
| 70 | 3300005445 | Ga0070708_100157248 | Ga0070708_1001572484 | 118 |
| 71 | 3300005455 | Ga0070663_100000631 | Ga0070663_10000063115 | 118 |
| 72 | 3300005456 | Ga0070678_100000488 | Ga0070678_10000048811 | 118 |
| 73 | 3300005457 | Ga0070662_100001505 | Ga0070662_10000150515 | 118 |
| 74 | 3300005458 | Ga0070681_10122200 | Ga0070681_101222004 | 118 |
| 75 | 3300005459 | Ga0068867_100012911 | Ga0068867_1000129113 | 118 |
| 76 | 3300005466 | Ga0070685_10033646 | Ga0070685_100336465 | 118 |
| 77 | 3300005518 | Ga0070699_100314984 | Ga0070699_1003149841 | 118 |
| 78 | 3300005530 | Ga0070679_100362431 | Ga0070679_1003624312 | 118 |
| 79 | 3300005535 | Ga0070684_100003013 | Ga0070684_1000030133 | 118 |
| 80 | 3300005536 | Ga0070697_100033146 | Ga0070697_1000331464 | 118 |
| 81 | 3300005539 | Ga0068853_100031322 | Ga0068853_1000313225 | 118 |
| 82 | 3300005543 | Ga0070672_100020119 | Ga0070672_1000201195 | 118 |
| 83 | 3300005544 | Ga0070686_100000909 | Ga0070686_1000009094 | 118 |
| 84 | 3300005545 | Ga0070695_100015863 | Ga0070695_1000158635 | 118 |
| 85 | 3300005546 | Ga0070696_100153385 | Ga0070696_1001533854 | 118 |
| 86 | 3300005548 | Ga0070665_100010653 | Ga0070665_1000106534 | 118 |
| 87 | 3300005563 | Ga0068855_100011601 | Ga0068855_1000116013 | 118 |
| 88 | 3300005564 | Ga0070664_100002105 | Ga0070664_10000210512 | 118 |
| 89 | 3300005577 | Ga0068857_100007922 | Ga0068857_1000079229 | 118 |
| 90 | 3300005578 | Ga0068854_100019749 | Ga0068854_1000197497 | 118 |
| 91 | 3300005614 | Ga0068856_100084493 | Ga0068856_1000844932 | 118 |
| 92 | 3300005615 | Ga0070702_100035488 | Ga0070702_1000354885 | 118 |
| 93 | 3300005616 | Ga0068852_100012062 | Ga0068852_1000120629 | 118 |
| 94 | 3300005617 | Ga0068859_100244077 | Ga0068859_1002440773 | 118 |
| 95 | 3300005618 | Ga0068864_100004333 | Ga0068864_1000043332 | 118 |
| 96 | 3300005718 | Ga0068866_10013440 | Ga0068866_100134404 | 118 |
| 97 | 3300005842 | Ga0068858_100041522 | Ga0068858_1000415225 | 118 |
| 98 | 3300005843 | Ga0068860_100002808 | Ga0068860_10000280815 | 118 |
| 99 | 3300005844 | Ga0068862_100034536 | Ga0068862_1000345365 | 118 |
| 100 | 3300005983 | Ga0081540_1001147 | Ga0081540_10011476 | 118 |
| 101 | 3300006028 | Ga0070717_10500627 | Ga0070717_105006272 | 118 |
| 102 | 3300006042 | Ga0075368_10189777 | Ga0075368_101897772 | 118 |
| 103 | 3300006048 | Ga0075363_100288063 | Ga0075363_1002880632 | 118 |
| 104 | 3300006058 | Ga0075432_10010335 | Ga0075432_100103356 | 118 |
| 105 | 3300006163 | Ga0070715_10000531 | Ga0070715_1000053112 | 118 |
| 106 | 3300006175 | Ga0070712_100020438 | Ga0070712_1000204385 | 118 |
| 107 | 3300006178 | Ga0075367_10152738 | Ga0075367_101527382 | 118 |
| 108 | 3300006195 | Ga0075366_10123106 | Ga0075366_101231062 | 118 |
| 109 | 3300006237 | Ga0097621_100189910 | Ga0097621_1001899102 | 118 |
| 110 | 3300006844 | Ga0075428_100095078 | Ga0075428_1000950782 | 118 |
| 111 | 3300006846 | Ga0075430_100188687 | Ga0075430_1001886871 | 118 |
| 112 | 3300006847 | Ga0075431_100130914 | Ga0075431_1001309145 | 118 |
| 113 | 3300006847 | Ga0075431_100215537 | Ga0075431_1002155371 | 118 |
| 114 | 3300006852 | Ga0075433_10306637 | Ga0075433_103066372 | 118 |
| 115 | 3300006871 | Ga0075434_100598786 | Ga0075434_1005987863 | 118 |
| 116 | 3300006880 | Ga0075429_101113522 | Ga0075429_1011135221 | 118 |
| 117 | 3300006881 | Ga0068865_100001614 | Ga0068865_1000016144 | 118 |
| 118 | 3300006914 | Ga0075436_100222575 | Ga0075436_1002225752 | 118 |
| 119 | 3300006931 | Ga0097620_100244068 | Ga0097620_1002440683 | 118 |
| 120 | 3300007076 | Ga0075435_100835256 | Ga0075435_1008352562 | 118 |
| 121 | 3300009036 | Ga0105244_10104999 | Ga0105244_101049993 | 118 |
| 122 | 3300009092 | Ga0105250_10005936 | Ga0105250_100059365 | 118 |
| 123 | 3300009093 | Ga0105240_10254002 | Ga0105240_102540024 | 118 |
| 124 | 3300009094 | Ga0111539_13518285 | Ga0111539_135182851 | 118 |
| 125 | 3300009098 | Ga0105245_10036759 | Ga0105245_100367598 | 118 |
| 126 | 3300009101 | Ga0105247_10017167 | Ga0105247_100171675 | 118 |
| 127 | 3300009147 | Ga0114129_11242009 | Ga0114129_112420092 | 118 |
| 128 | 3300009148 | Ga0105243_10002877 | Ga0105243_1000287717 | 118 |
| 129 | 3300009174 | Ga0105241_10003054 | Ga0105241_100030549 | 118 |
| 130 | 3300009176 | Ga0105242_10049675 | Ga0105242_100496753 | 118 |
| 131 | 3300009177 | Ga0105248_10001545 | Ga0105248_100015454 | 118 |
| 132 | 3300009545 | Ga0105237_10006244 | Ga0105237_100062441 | 118 |
| 133 | 3300009551 | Ga0105238_10059285 | Ga0105238_100592854 | 118 |
| 134 | 3300009553 | Ga0105249_10000740 | Ga0105249_1000074014 | 118 |
| 135 | 3300010375 | Ga0105239_10216611 | Ga0105239_102166111 | 118 |
| 136 | 3300011119 | Ga0105246_10001739 | Ga0105246_1000173914 | 118 |
| 137 | 3300013100 | Ga0157373_10080495 | Ga0157373_100804951 | 118 |
| 138 | 3300013102 | Ga0157371_10003347 | Ga0157371_100033474 | 118 |
| 139 | 3300013296 | Ga0157374_10034021 | Ga0157374_100340217 | 118 |
| 140 | 3300013297 | Ga0157378_10055166 | Ga0157378_100551664 | 118 |
| 141 | 3300013306 | Ga0163162_10006077 | Ga0163162_1000607711 | 118 |
| 142 | 3300013307 | Ga0157372_10018528 | Ga0157372_100185284 | 118 |
| 143 | 3300013308 | Ga0157375_10074868 | Ga0157375_100748686 | 118 |
| 144 | 3300014325 | Ga0163163_10062871 | Ga0163163_100628715 | 118 |
| 145 | 3300014326 | Ga0157380_10002295 | Ga0157380_100022958 | 118 |
| 146 | 3300014745 | Ga0157377_10017066 | Ga0157377_100170663 | 118 |
| 147 | 3300014968 | Ga0157379_10041479 | Ga0157379_100414794 | 118 |
| 148 | 3300014969 | Ga0157376_10029924 | Ga0157376_100299244 | 118 |
| 149 | 3300017792 | Ga0163161_10000777 | Ga0163161_1000077716 | 118 |
| 150 | 3300025315 | Ga0207697_10009651 | Ga0207697_100096512 | 118 |
| 151 | 3300025321 | Ga0207656_10059954 | Ga0207656_100599544 | 118 |
| 152 | 3300025711 | Ga0207696_1046759 | Ga0207696_10467592 | 118 |
| 153 | 3300025898 | Ga0207692_10039147 | Ga0207692_100391474 | 118 |
| 154 | 3300025899 | Ga0207642_10024011 | Ga0207642_100240113 | 118 |
| 155 | 3300025900 | Ga0207710_10014677 | Ga0207710_100146773 | 118 |
| 156 | 3300025901 | Ga0207688_10012936 | Ga0207688_100129368 | 118 |
| 157 | 3300025903 | Ga0207680_10022429 | Ga0207680_100224294 | 118 |
| 158 | 3300025904 | Ga0207647_10000413 | Ga0207647_1000041318 | 118 |
| 159 | 3300025905 | Ga0207685_10011418 | Ga0207685_100114182 | 118 |
| 160 | 3300025906 | Ga0207699_10000914 | Ga0207699_1000091415 | 118 |
| 161 | 3300025909 | Ga0207705_11124156 | Ga0207705_111241562 | 118 |
| 162 | 3300025914 | Ga0207671_10019791 | Ga0207671_100197914 | 118 |
| 163 | 3300025915 | Ga0207693_10000200 | Ga0207693_1000020029 | 118 |
| 164 | 3300025916 | Ga0207663_10002481 | Ga0207663_1000248110 | 118 |
| 165 | 3300025917 | Ga0207660_10062130 | Ga0207660_100621305 | 118 |
| 166 | 3300025918 | Ga0207662_10003669 | Ga0207662_100036696 | 118 |
| 167 | 3300025919 | Ga0207657_10000248 | Ga0207657_1000024830 | 118 |
| 168 | 3300025920 | Ga0207649_10035146 | Ga0207649_100351465 | 118 |
| 169 | 3300025921 | Ga0207652_10068798 | Ga0207652_100687985 | 118 |
| 170 | 3300025922 | Ga0207646_10748030 | Ga0207646_107480302 | 118 |
| 171 | 3300025923 | Ga0207681_10206143 | Ga0207681_102061433 | 118 |
| 172 | 3300025924 | Ga0207694_10191739 | Ga0207694_101917394 | 118 |
| 173 | 3300025925 | Ga0207650_10013639 | Ga0207650_1001363910 | 118 |
| 174 | 3300025926 | Ga0207659_10039047 | Ga0207659_100390475 | 118 |
| 175 | 3300025927 | Ga0207687_11096492 | Ga0207687_110964921 | 118 |
| 176 | 3300025928 | Ga0207700_10141785 | Ga0207700_101417853 | 118 |
| 177 | 3300025929 | Ga0207664_10701261 | Ga0207664_107012612 | 118 |
| 178 | 3300025931 | Ga0207644_10031827 | Ga0207644_100318274 | 118 |
| 179 | 3300025932 | Ga0207690_10002135 | Ga0207690_100021354 | 118 |
| 180 | 3300025933 | Ga0207706_10000886 | Ga0207706_1000088617 | 118 |
| 181 | 3300025934 | Ga0207686_10042390 | Ga0207686_100423902 | 118 |
| 182 | 3300025935 | Ga0207709_10016910 | Ga0207709_100169104 | 118 |
| 183 | 3300025936 | Ga0207670_10047520 | Ga0207670_100475202 | 118 |
| 184 | 3300025937 | Ga0207669_10001242 | Ga0207669_100012424 | 118 |
| 185 | 3300025938 | Ga0207704_10011337 | Ga0207704_100113374 | 118 |
| 186 | 3300025939 | Ga0207665_10000748 | Ga0207665_1000074823 | 118 |
| 187 | 3300025940 | Ga0207691_10078171 | Ga0207691_100781711 | 118 |
| 188 | 3300025942 | Ga0207689_10415676 | Ga0207689_104156763 | 118 |
| 189 | 3300025944 | Ga0207661_10084012 | Ga0207661_100840124 | 118 |
| 190 | 3300025945 | Ga0207679_10006004 | Ga0207679_100060048 | 118 |
| 191 | 3300025960 | Ga0207651_10001356 | Ga0207651_1000135612 | 118 |
| 192 | 3300025961 | Ga0207712_10702225 | Ga0207712_107022252 | 118 |
| 193 | 3300025972 | Ga0207668_10112860 | Ga0207668_101128603 | 118 |
| 194 | 3300025981 | Ga0207640_10150886 | Ga0207640_101508862 | 118 |
| 195 | 3300025986 | Ga0207658_10619422 | Ga0207658_106194222 | 118 |
| 196 | 3300026035 | Ga0207703_10020545 | Ga0207703_100205454 | 118 |
| 197 | 3300026041 | Ga0207639_10024616 | Ga0207639_100246164 | 118 |
| 198 | 3300026067 | Ga0207678_10002318 | Ga0207678_100023184 | 118 |
| 199 | 3300026075 | Ga0207708_10009620 | Ga0207708_1000962011 | 118 |
| 200 | 3300026078 | Ga0207702_10029252 | Ga0207702_100292525 | 118 |
| 201 | 3300026088 | Ga0207641_10046134 | Ga0207641_100461344 | 118 |
| 202 | 3300026089 | Ga0207648_10356014 | Ga0207648_103560143 | 118 |
| 203 | 3300026116 | Ga0207674_10001082 | Ga0207674_1000108212 | 118 |
| 204 | 3300026118 | Ga0207675_100000602 | Ga0207675_10000060229 | 118 |
| 205 | 3300026121 | Ga0207683_10000236 | Ga0207683_1000023618 | 118 |
| 206 | 3300026142 | Ga0207698_10204435 | Ga0207698_102044351 | 118 |
| 207 | 3300027252 | Ga0209973_1007292 | Ga0209973_10072921 | 118 |
| 208 | 3300027360 | Ga0209969_1065446 | Ga0209969_10654461 | 118 |
| 209 | 3300027462 | Ga0210000_1053577 | Ga0210000_10535771 | 118 |
| 210 | 3300027526 | Ga0209968_1047395 | Ga0209968_10473952 | 118 |
| 211 | 3300027614 | Ga0209970_1027855 | Ga0209970_10278552 | 118 |
| 212 | 3300027665 | Ga0209983_1008692 | Ga0209983_10086922 | 118 |
| 213 | 3300027682 | Ga0209971_1011244 | Ga0209971_10112442 | 118 |
| 214 | 3300027866 | Ga0209813_10135094 | Ga0209813_101350942 | 118 |
| 215 | 3300027876 | Ga0209974_10013670 | Ga0209974_100136703 | 118 |
| 216 | 3300027907 | Ga0207428_10043378 | Ga0207428_100433784 | 118 |
| 217 | 3300028380 | Ga0268265_10146743 | Ga0268265_101467434 | 118 |
| 218 | 3300028381 | Ga0268264_10002713 | Ga0268264_100027138 | 118 |
| 219 | 3300028794 | Ga0307515_10043657 | Ga0307515_100436576 | 118 |
| 220 | 3300031456 | Ga0307513_10362351 | Ga0307513_103623512 | 118 |
| 221 | 3300032005 | Ga0307411_11751101 | Ga0307411_117511011 | 118 |
| 222 | 3300035091 | Ga0373951_0016042 | Ga0373951_0016042_1283_1639 | 118 |
| 223 | 3300035092 | Ga0373952_0013851 | Ga0373952_0013851_962_1318 | 118 |
| 224 | 3300035112 | Ga0373932_0030459 | Ga0373932_0030459_351_707 | 118 |
| 225 | 3300035114 | Ga0373939_0293776 | Ga0373939_0293776_56_412 | 118 |
| 226 | 3300035121 | Ga0373960_0028627 | Ga0373960_0028627_284_640 | 118 |
| 227 | 3300035207 | Ga0373942_0245664 | Ga0373942_0245664_92_448 | 118 |
| 228 | 3300035242 | Ga0373962_0045159 | Ga0373962_0045159_786_1142 | 118 |
| 229 | 3300035691 | Ga0373931_0006598 | Ga0373931_0006598_1175_1531 | 118 |
| 230 | 3300037312 | Ga0395899_0649984 | Ga0395899_0649984_269_625 | 118 |
| 231 | 3300037418 | Ga0395900_0016010 | Ga0395900_0016010_323_679 | 118 |
| 232 | 3300037418 | Ga0395900_1816755 | Ga0395900_1816755_106_462 | 118 |
| 233 | 3300037466 | Ga0395898_0043972 | Ga0395898_0043972_1922_2278 | 118 |
| 234 | 3300037471 | Ga0395905_0001179 | Ga0395905_0001179_6313_6669 | 118 |
| 235 | 3300038443 | Ga0395901_0003815 | Ga0395901_0003815_11209_11565 | 118 |
| 236 | 3300046454 | Ga0495592_0816927 | Ga0495592_0816927_176_535 | 118 |
| 237 | 3300046457 | Ga0495590_0346278 | Ga0495590_0346278_21_377 | 118 |
| 238 | 3300046511 | Ga0495608_0297198 | Ga0495608_0297198_309_668 | 118 |
| 239 | 3300046615 | Ga0495656_0293967 | Ga0495656_0293967_265_624 | 118 |
| 240 | 3300046615 | Ga0495656_0452267 | Ga0495656_0452267_142_510 | 118 |
| 241 | 3300047322 | Ga0495680_0210059 | Ga0495680_0210059_476_835 | 118 |
| 242 | 3300048903 | Ga0496100_0006494 | Ga0496100_0006494_255_611 | 118 |
| 243 | 3300048904 | Ga0496101_0029740 | Ga0496101_0029740_2036_2392 | 118 |
| 244 | 3300048906 | Ga0496103_0037973 | Ga0496103_0037973_27_383 | 118 |
| 245 | 3300048907 | Ga0496104_0718763 | Ga0496104_0718763_516_872 | 118 |
| 246 | 3300048908 | Ga0496105_0158146 | Ga0496105_0158146_1430_1786 | 118 |
| 247 | 3300048909 | Ga0496106_0020480 | Ga0496106_0020480_1430_1786 | 118 |
| 248 | 3300048910 | Ga0496107_0023098 | Ga0496107_0023098_1215_1571 | 118 |
| 249 | 3300048911 | Ga0496108_0134482 | Ga0496108_0134482_455_811 | 118 |
| 250 | 3300048911 | Ga0496108_0562388 | Ga0496108_0562388_255_611 | 118 |
| 251 | 3300048912 | Ga0496109_0041667 | Ga0496109_0041667_2051_2407 | 118 |
| 252 | 3300048912 | Ga0496109_0596600 | Ga0496109_0596600_542_898 | 118 |
| 253 | 3300048913 | Ga0496110_0031645 | Ga0496110_0031645_2995_3351 | 118 |
| 254 | 3300048915 | Ga0496112_0040764 | Ga0496112_0040764_2034_2390 | 118 |
| 255 | 3300048915 | Ga0496112_0067209 | Ga0496112_0067209_1430_1786 | 118 |
| 256 | 3300048916 | Ga0496113_0076000 | Ga0496113_0076000_1697_2053 | 118 |
| 257 | 3300048916 | Ga0496113_0697124 | Ga0496113_0697124_70_426 | 118 |
| 258 | 3300048917 | Ga0496114_0270221 | Ga0496114_0270221_286_642 | 118 |
| 259 | 3300048929 | Ga0496126_0010210 | Ga0496126_0010210_3797_4162 | 118 |
| 260 | 3300049568 | Ga0501031_0021104 | Ga0501031_0021104_1440_1799 | 118 |
| 261 | 3300049569 | Ga0501032_0125136 | Ga0501032_0125136_826_1185 | 118 |
| 262 | 3300049570 | Ga0501033_0006425 | Ga0501033_0006425_1709_2068 | 118 |
| 263 | 3300049571 | Ga0501034_0156684 | Ga0501034_0156684_122_481 | 118 |
| 264 | 3300049572 | Ga0501036_0001556 | Ga0501036_0001556_17033_17392 | 118 |
| 265 | 3300049573 | Ga0501037_0039995 | Ga0501037_0039995_2344_2703 | 118 |
| 266 | 3300049574 | Ga0501038_0034122 | Ga0501038_0034122_735_1094 | 118 |
| 267 | 3300049574 | Ga0501038_0383925 | Ga0501038_0383925_112_468 | 118 |
| 268 | 3300049575 | Ga0501039_0000989 | Ga0501039_0000989_3896_4255 | 118 |
| 269 | 3300049576 | Ga0501040_0000351 | Ga0501040_0000351_6011_6370 | 118 |
| 270 | 3300049577 | Ga0501041_0001230 | Ga0501041_0001230_3569_3928 | 118 |
| 271 | 3300049578 | Ga0501042_0002805 | Ga0501042_0002805_520_879 | 118 |
| 272 | 3300049579 | Ga0501043_0071401 | Ga0501043_0071401_445_804 | 118 |
| 273 | 3300049580 | Ga0501046_0002565 | Ga0501046_0002565_4119_4478 | 118 |
| 274 | 3300049580 | Ga0501046_1046268 | Ga0501046_1046268_152_508 | 118 |
| 275 | 3300049581 | Ga0501047_1247446 | Ga0501047_1247446_90_449 | 118 |
| 276 | 3300049582 | Ga0501048_0012837 | Ga0501048_0012837_30_389 | 118 |
| 277 | 3300049584 | Ga0501068_0001484 | Ga0501068_0001484_9880_10239 | 118 |
| 278 | 3300049584 | Ga0501068_0014073 | Ga0501068_0014073_4095_4454 | 118 |
| 279 | 3300049586 | Ga0501070_0174108 | Ga0501070_0174108_265_624 | 118 |
| 280 | 3300049587 | Ga0501071_0000159 | Ga0501071_0000159_20105_20464 | 118 |
| 281 | 3300049587 | Ga0501071_0672540 | Ga0501071_0672540_154_510 | 118 |
| 282 | 3300049588 | Ga0501072_0008151 | Ga0501072_0008151_4322_4681 | 118 |
| 283 | 3300049589 | Ga0501073_0094930 | Ga0501073_0094930_1338_1697 | 118 |
| 284 | 3300049589 | Ga0501073_0397350 | Ga0501073_0397350_174_533 | 118 |
| 285 | 3300049590 | Ga0501074_0005569 | Ga0501074_0005569_7399_7758 | 118 |
| 286 | 3300049591 | Ga0501075_0014450 | Ga0501075_0014450_2043_2402 | 118 |
| 287 | 3300049592 | Ga0501076_0009874 | Ga0501076_0009874_4450_4809 | 118 |
| 288 | 3300049593 | Ga0501077_0000351 | Ga0501077_0000351_24676_25035 | 118 |
| 289 | 3300049683 | Ga0501253_180624 | Ga0501253_180624_10_369 | 118 |
| 290 | 3300049741 | Ga0501079_0052024 | Ga0501079_0052024_1827_2186 | 118 |
| 291 | 3300049742 | Ga0501080_0001579 | Ga0501080_0001579_4760_5119 | 118 |
| 292 | 3300049742 | Ga0501080_0126175 | Ga0501080_0126175_1600_1959 | 118 |
| 293 | 3300049743 | Ga0501081_0001463 | Ga0501081_0001463_12392_12751 | 118 |
| 294 | 3300049744 | Ga0501083_0083495 | Ga0501083_0083495_695_1063 | 118 |
| 295 | 3300049767 | Ga0501270_058524 | Ga0501270_058524_205_564 | 118 |
| 296 | 3300049822 | Ga0501035_0003075 | Ga0501035_0003075_1936_2295 | 118 |
| 297 | 3300049824 | Ga0501045_0013636 | Ga0501045_0013636_644_1003 | 118 |
| 298 | 3300050490 | nmdc:mga03n38_707267_c1 | nmdc:mga03n38_707267_c1_50_418 | 118 |
| 299 | 3300050491 | nmdc:mga00v17_381134_c1 | nmdc:mga00v17_381134_c1_289_648 | 118 |
| 300 | 3300050493 | nmdc:mga0k408_74257_c1 | nmdc:mga0k408_74257_c1_1173_1532 | 118 |
| 301 | 3300050494 | nmdc:mga06z11_122783_c1 | nmdc:mga06z11_122783_c1_250_609 | 118 |
| 302 | 3300050495 | nmdc:mga04h51_260903_c1 | nmdc:mga04h51_260903_c1_311_670 | 118 |
| 303 | 3300050507 | nmdc:mga05p37_1167905_c1 | nmdc:mga05p37_1167905_c1_320_688 | 118 |
| 304 | 3300050507 | nmdc:mga05p37_291418_c1 | nmdc:mga05p37_291418_c1_992_1348 | 118 |
| 305 | 3300050508 | nmdc:mga09592_653359_c1 | nmdc:mga09592_653359_c1_411_767 | 118 |
| 306 | 3300050509 | nmdc:mga0qj67_1567190_c1 | nmdc:mga0qj67_1567190_c1_110_466 | 118 |
| 307 | 3300050509 | nmdc:mga0qj67_993632_c1 | nmdc:mga0qj67_993632_c1_286_645 | 118 |
| 308 | 3300050510 | nmdc:mga06r32_224702_c1 | nmdc:mga06r32_224702_c1_1043_1399 | 118 |
| 309 | 3300050510 | nmdc:mga06r32_310987_c1 | nmdc:mga06r32_310987_c1_1175_1534 | 118 |
| 310 | 3300050511 | nmdc:mga08y16_114802_c1 | nmdc:mga08y16_114802_c1_1233_1589 | 118 |
| 311 | 3300050511 | nmdc:mga08y16_1234810_c1 | nmdc:mga08y16_1234810_c1_173_541 | 118 |
| 312 | 3300050512 | nmdc:mga0n895_1037600_c1 | nmdc:mga0n895_1037600_c1_312_668 | 118 |
| 313 | 3300050513 | nmdc:mga0rr50_119968_c1 | nmdc:mga0rr50_119968_c1_1397_1753 | 118 |
| 314 | 3300050515 | nmdc:mga0a205_55612_c1 | nmdc:mga0a205_55612_c1_1401_1757 | 118 |
| 315 | 3300053083 | Ga0495655_0000442 | Ga0495655_0000442_189_545 | 118 |
| 316 | 3300053730 | Ga0500645_026689 | Ga0500645_026689_437_796 | 118 |
| 317 | 3300054114 | Ga0501084_0003638 | Ga0501084_0003638_10332_10691 | 118 |
| 318 | 3300054114 | Ga0501084_0575962 | Ga0501084_0575962_439_798 | 118 |
| 319 | 3300060353 | Ga0501082_0019926 | Ga0501082_0019926_807_1166 | 118 |
| 320 | 3300061734 | Ga0530510_0005094 | Ga0530510_0005094_6663_7022 | 118 |
| 321 | 2162886011 | MRS1b_contig_52275 | MRS1b_0322.00002100 | 119 |
| 322 | 2162886012 | MBSR1b_contig_2599212 | MBSR1b_0785.00005550 | 119 |
| 323 | 2162886012 | MBSR1b_contig_7247536 | MBSR1b_0137.00004660 | 119 |
| 324 | 3300001915 | JGI24741J21665_1033634 | JGI24741J21665_10336341 | 119 |
| 325 | 3300001976 | JGI24752J21851_1008799 | JGI24752J21851_10087992 | 119 |
| 326 | 3300001976 | JGI24752J21851_1009973 | JGI24752J21851_10099731 | 119 |
| 327 | 3300001978 | JGI24747J21853_1015245 | JGI24747J21853_10152452 | 119 |
| 328 | 3300001990 | JGI24737J22298_10092088 | JGI24737J22298_100920882 | 119 |
| 329 | 3300001991 | JGI24743J22301_10015255 | JGI24743J22301_100152552 | 119 |
| 330 | 3300002074 | JGI24748J21848_1007059 | JGI24748J21848_10070592 | 119 |
| 331 | 3300002239 | JGI24034J26672_10002946 | JGI24034J26672_100029464 | 119 |
| 332 | 3300002244 | JGI24742J22300_10032457 | JGI24742J22300_100324572 | 119 |
| 333 | 3300002459 | JGI24751J29686_10004419 | JGI24751J29686_100044193 | 119 |
| 334 | 3300002459 | JGI24751J29686_10004481 | JGI24751J29686_100044813 | 119 |
| 335 | 3300005289 | Ga0065704_10628753 | Ga0065704_106287531 | 119 |
| 336 | 3300005290 | Ga0065712_10079196 | Ga0065712_100791962 | 119 |
| 337 | 3300005293 | Ga0065715_10181563 | Ga0065715_101815632 | 119 |
| 338 | 3300005295 | Ga0065707_10137003 | Ga0065707_101370031 | 119 |
| 339 | 3300005327 | Ga0070658_10116778 | Ga0070658_101167784 | 119 |
| 340 | 3300005328 | Ga0070676_10011045 | Ga0070676_100110457 | 119 |
| 341 | 3300005329 | Ga0070683_100019783 | Ga0070683_1000197838 | 119 |
| 342 | 3300005330 | Ga0070690_100040473 | Ga0070690_1000404732 | 119 |
| 343 | 3300005331 | Ga0070670_100073709 | Ga0070670_1000737093 | 119 |
| 344 | 3300005337 | Ga0070682_100005894 | Ga0070682_1000058944 | 119 |
| 345 | 3300005338 | Ga0068868_100281602 | Ga0068868_1002816022 | 119 |
| 346 | 3300005339 | Ga0070660_100001305 | Ga0070660_10000130510 | 119 |
| 347 | 3300005340 | Ga0070689_100086179 | Ga0070689_1000861792 | 119 |
| 348 | 3300005343 | Ga0070687_100070183 | Ga0070687_1000701832 | 119 |
| 349 | 3300005347 | Ga0070668_100016470 | Ga0070668_1000164703 | 119 |
| 350 | 3300005353 | Ga0070669_100060775 | Ga0070669_1000607753 | 119 |
| 351 | 3300005354 | Ga0070675_100038398 | Ga0070675_1000383986 | 119 |
| 352 | 3300005355 | Ga0070671_100498449 | Ga0070671_1004984492 | 119 |
| 353 | 3300005364 | Ga0070673_100369716 | Ga0070673_1003697162 | 119 |
| 354 | 3300005365 | Ga0070688_100004625 | Ga0070688_1000046251 | 119 |
| 355 | 3300005366 | Ga0070659_100008100 | Ga0070659_1000081009 | 119 |
| 356 | 3300005367 | Ga0070667_100623603 | Ga0070667_1006236032 | 119 |
| 357 | 3300005438 | Ga0070701_10148229 | Ga0070701_101482291 | 119 |
| 358 | 3300005441 | Ga0070700_100014627 | Ga0070700_1000146275 | 119 |
| 359 | 3300005456 | Ga0070678_100603056 | Ga0070678_1006030562 | 119 |
| 360 | 3300005459 | Ga0068867_100004533 | Ga0068867_1000045333 | 119 |
| 361 | 3300005466 | Ga0070685_10016898 | Ga0070685_100168983 | 119 |
| 362 | 3300005535 | Ga0070684_100033816 | Ga0070684_1000338162 | 119 |
| 363 | 3300005539 | Ga0068853_100111225 | Ga0068853_1001112252 | 119 |
| 364 | 3300005543 | Ga0070672_100161640 | Ga0070672_1001616402 | 119 |
| 365 | 3300005544 | Ga0070686_100021089 | Ga0070686_1000210896 | 119 |
| 366 | 3300005546 | Ga0070696_101812327 | Ga0070696_1018123271 | 119 |
| 367 | 3300005549 | Ga0070704_101599191 | Ga0070704_1015991911 | 119 |
| 368 | 3300005563 | Ga0068855_100043085 | Ga0068855_1000430853 | 119 |
| 369 | 3300005564 | Ga0070664_100084748 | Ga0070664_1000847482 | 119 |
| 370 | 3300005577 | Ga0068857_100005254 | Ga0068857_10000525411 | 119 |
| 371 | 3300005578 | Ga0068854_100018882 | Ga0068854_1000188826 | 119 |
| 372 | 3300005614 | Ga0068856_100042031 | Ga0068856_1000420316 | 119 |
| 373 | 3300005615 | Ga0070702_100236064 | Ga0070702_1002360642 | 119 |
| 374 | 3300005616 | Ga0068852_100014600 | Ga0068852_1000146009 | 119 |
| 375 | 3300005617 | Ga0068859_100640178 | Ga0068859_1006401782 | 119 |
| 376 | 3300005718 | Ga0068866_10011330 | Ga0068866_100113302 | 119 |
| 377 | 3300005719 | Ga0068861_100202678 | Ga0068861_1002026782 | 119 |
| 378 | 3300005834 | Ga0068851_10005404 | Ga0068851_100054043 | 119 |
| 379 | 3300005843 | Ga0068860_100154339 | Ga0068860_1001543392 | 119 |
| 380 | 3300005844 | Ga0068862_100048246 | Ga0068862_1000482463 | 119 |
| 381 | 3300006175 | Ga0070712_101119190 | Ga0070712_1011191901 | 119 |
| 382 | 3300006358 | Ga0068871_100182236 | Ga0068871_1001822363 | 119 |
| 383 | 3300006847 | Ga0075431_101044600 | Ga0075431_1010446001 | 119 |
| 384 | 3300006881 | Ga0068865_100054670 | Ga0068865_1000546702 | 119 |
| 385 | 3300006931 | Ga0097620_100640188 | Ga0097620_1006401882 | 119 |
| 386 | 3300009092 | Ga0105250_10020592 | Ga0105250_100205922 | 119 |
| 387 | 3300009094 | Ga0111539_10235245 | Ga0111539_102352452 | 119 |
| 388 | 3300009094 | Ga0111539_10607999 | Ga0111539_106079992 | 119 |
| 389 | 3300009098 | Ga0105245_10018069 | Ga0105245_100180695 | 119 |
| 390 | 3300009101 | Ga0105247_10005265 | Ga0105247_100052658 | 119 |
| 391 | 3300009147 | Ga0114129_10244701 | Ga0114129_102447015 | 119 |
| 392 | 3300009147 | Ga0114129_11687674 | Ga0114129_116876742 | 119 |
| 393 | 3300009174 | Ga0105241_10017418 | Ga0105241_100174187 | 119 |
| 394 | 3300009176 | Ga0105242_10018248 | Ga0105242_100182486 | 119 |
| 395 | 3300009176 | Ga0105242_10243662 | Ga0105242_102436622 | 119 |
| 396 | 3300009176 | Ga0105242_13022448 | Ga0105242_130224481 | 119 |
| 397 | 3300009545 | Ga0105237_10132534 | Ga0105237_101325342 | 119 |
| 398 | 3300009551 | Ga0105238_10373411 | Ga0105238_103734113 | 119 |
| 399 | 3300009553 | Ga0105249_10022601 | Ga0105249_100226016 | 119 |
| 400 | 3300010375 | Ga0105239_10023993 | Ga0105239_100239936 | 119 |
| 401 | 3300011119 | Ga0105246_10019764 | Ga0105246_100197647 | 119 |
| 402 | 3300012495 | Ga0157323_1006337 | Ga0157323_10063372 | 119 |
| 403 | 3300013100 | Ga0157373_10072677 | Ga0157373_100726772 | 119 |
| 404 | 3300013102 | Ga0157371_10026473 | Ga0157371_100264737 | 119 |
| 405 | 3300013105 | Ga0157369_10121632 | Ga0157369_101216323 | 119 |
| 406 | 3300013296 | Ga0157374_10253664 | Ga0157374_102536642 | 119 |
| 407 | 3300013306 | Ga0163162_10497488 | Ga0163162_104974882 | 119 |
| 408 | 3300013307 | Ga0157372_10225268 | Ga0157372_102252682 | 119 |
| 409 | 3300013308 | Ga0157375_12167126 | Ga0157375_121671262 | 119 |
| 410 | 3300014325 | Ga0163163_10037711 | Ga0163163_100377115 | 119 |
| 411 | 3300014326 | Ga0157380_10053820 | Ga0157380_100538205 | 119 |
| 412 | 3300014745 | Ga0157377_10000604 | Ga0157377_1000060412 | 119 |
| 413 | 3300014968 | Ga0157379_10214274 | Ga0157379_102142742 | 119 |
| 414 | 3300017792 | Ga0163161_10010955 | Ga0163161_100109557 | 119 |
| 415 | 3300025321 | Ga0207656_10007939 | Ga0207656_100079395 | 119 |
| 416 | 3300025899 | Ga0207642_10107206 | Ga0207642_101072062 | 119 |
| 417 | 3300025900 | Ga0207710_10113975 | Ga0207710_101139752 | 119 |
| 418 | 3300025901 | Ga0207688_10155657 | Ga0207688_101556572 | 119 |
| 419 | 3300025903 | Ga0207680_10069511 | Ga0207680_100695115 | 119 |
| 420 | 3300025904 | Ga0207647_10014154 | Ga0207647_100141545 | 119 |
| 421 | 3300025907 | Ga0207645_10003125 | Ga0207645_1000312513 | 119 |
| 422 | 3300025908 | Ga0207643_10001093 | Ga0207643_1000109313 | 119 |
| 423 | 3300025909 | Ga0207705_10048442 | Ga0207705_100484422 | 119 |
| 424 | 3300025911 | Ga0207654_10106425 | Ga0207654_101064252 | 119 |
| 425 | 3300025914 | Ga0207671_10245864 | Ga0207671_102458642 | 119 |
| 426 | 3300025918 | Ga0207662_10048294 | Ga0207662_100482943 | 119 |
| 427 | 3300025919 | Ga0207657_10002871 | Ga0207657_1000287111 | 119 |
| 428 | 3300025920 | Ga0207649_10001017 | Ga0207649_1000101716 | 119 |
| 429 | 3300025923 | Ga0207681_10025337 | Ga0207681_100253373 | 119 |
| 430 | 3300025924 | Ga0207694_11555842 | Ga0207694_115558422 | 119 |
| 431 | 3300025925 | Ga0207650_10000051 | Ga0207650_10000051156 | 119 |
| 432 | 3300025926 | Ga0207659_10012088 | Ga0207659_100120885 | 119 |
| 433 | 3300025927 | Ga0207687_10061356 | Ga0207687_100613565 | 119 |
| 434 | 3300025931 | Ga0207644_10006972 | Ga0207644_100069728 | 119 |
| 435 | 3300025932 | Ga0207690_10372348 | Ga0207690_103723481 | 119 |
| 436 | 3300025933 | Ga0207706_10006949 | Ga0207706_1000694911 | 119 |
| 437 | 3300025934 | Ga0207686_10107319 | Ga0207686_101073192 | 119 |
| 438 | 3300025936 | Ga0207670_10020207 | Ga0207670_100202075 | 119 |
| 439 | 3300025938 | Ga0207704_10145496 | Ga0207704_101454962 | 119 |
| 440 | 3300025941 | Ga0207711_10104857 | Ga0207711_101048572 | 119 |
| 441 | 3300025942 | Ga0207689_10000184 | Ga0207689_100001847 | 119 |
| 442 | 3300025944 | Ga0207661_10000122 | Ga0207661_1000012245 | 119 |
| 443 | 3300025945 | Ga0207679_10000101 | Ga0207679_1000010146 | 119 |
| 444 | 3300025949 | Ga0207667_10247518 | Ga0207667_102475183 | 119 |
| 445 | 3300025960 | Ga0207651_10384222 | Ga0207651_103842222 | 119 |
| 446 | 3300025961 | Ga0207712_10082579 | Ga0207712_100825793 | 119 |
| 447 | 3300025972 | Ga0207668_10057386 | Ga0207668_100573863 | 119 |
| 448 | 3300025981 | Ga0207640_10024018 | Ga0207640_100240185 | 119 |
| 449 | 3300025986 | Ga0207658_10023411 | Ga0207658_100234116 | 119 |
| 450 | 3300026041 | Ga0207639_10038436 | Ga0207639_100384364 | 119 |
| 451 | 3300026067 | Ga0207678_10033626 | Ga0207678_100336262 | 119 |
| 452 | 3300026075 | Ga0207708_10036747 | Ga0207708_100367474 | 119 |
| 453 | 3300026078 | Ga0207702_10302115 | Ga0207702_103021152 | 119 |
| 454 | 3300026088 | Ga0207641_10000006 | Ga0207641_10000006366 | 119 |
| 455 | 3300026089 | Ga0207648_10006908 | Ga0207648_1000690811 | 119 |
| 456 | 3300026095 | Ga0207676_10000155 | Ga0207676_1000015534 | 119 |
| 457 | 3300026116 | Ga0207674_10000537 | Ga0207674_1000053719 | 119 |
| 458 | 3300026118 | Ga0207675_100392337 | Ga0207675_1003923372 | 119 |
| 459 | 3300026121 | Ga0207683_10010359 | Ga0207683_100103592 | 119 |
| 460 | 3300026142 | Ga0207698_10528769 | Ga0207698_105287692 | 119 |
| 461 | 3300028379 | Ga0268266_10011780 | Ga0268266_1001178010 | 119 |
| 462 | 3300028380 | Ga0268265_10012466 | Ga0268265_100124665 | 119 |
| 463 | 3300028381 | Ga0268264_10050928 | Ga0268264_100509285 | 119 |
| 464 | 3300031616 | Ga0307508_10000071 | Ga0307508_1000007145 | 119 |
| 465 | 3300031852 | Ga0307410_10000001 | Ga0307410_10000001111 | 119 |
| 466 | 3300031852 | Ga0307410_11288133 | Ga0307410_112881332 | 119 |
| 467 | 3300031901 | Ga0307406_10926339 | Ga0307406_109263392 | 119 |
| 468 | 3300031903 | Ga0307407_10008057 | Ga0307407_100080573 | 119 |
| 469 | 3300031903 | Ga0307407_10099493 | Ga0307407_100994932 | 119 |
| 470 | 3300031911 | Ga0307412_10022081 | Ga0307412_100220813 | 119 |
| 471 | 3300031995 | Ga0307409_100000127 | Ga0307409_1000001278 | 119 |
| 472 | 3300032002 | Ga0307416_100000075 | Ga0307416_10000007550 | 119 |
| 473 | 3300032002 | Ga0307416_102289675 | Ga0307416_1022896752 | 119 |
| 474 | 3300032002 | Ga0307416_102551931 | Ga0307416_1025519312 | 119 |
| 475 | 3300032005 | Ga0307411_10777636 | Ga0307411_107776361 | 119 |
| 476 | 3300032126 | Ga0307415_100667811 | Ga0307415_1006678112 | 119 |
| 477 | 3300041453 | Ga0451797_0165799 | Ga0451797_0165799_114_476 | 119 |
| 478 | 3300042436 | Ga0439435_0317211 | Ga0439435_0317211_79_447 | 119 |
| 479 | 3300046684 | Ga0495669_0060387 | Ga0495669_0060387_1183_1542 | 119 |
| 480 | 3300048903 | Ga0496100_0155337 | Ga0496100_0155337_768_1127 | 119 |
| 481 | 3300048904 | Ga0496101_1551331 | Ga0496101_1551331_43_405 | 119 |
| 482 | 3300048905 | Ga0496102_0673575 | Ga0496102_0673575_431_790 | 119 |
| 483 | 3300048907 | Ga0496104_1586682 | Ga0496104_1586682_110_469 | 119 |
| 484 | 3300048911 | Ga0496108_0000258 | Ga0496108_0000258_32223_32582 | 119 |
| 485 | 3300048912 | Ga0496109_0000126 | Ga0496109_0000126_15954_16313 | 119 |
| 486 | 3300048913 | Ga0496110_0025514 | Ga0496110_0025514_3381_3740 | 119 |
| 487 | 3300048914 | Ga0496111_0000724 | Ga0496111_0000724_10585_10944 | 119 |
| 488 | 3300048915 | Ga0496112_0000081 | Ga0496112_0000081_43337_43696 | 119 |
| 489 | 3300048916 | Ga0496113_0001980 | Ga0496113_0001980_6354_6713 | 119 |
| 490 | 3300048917 | Ga0496114_0809357 | Ga0496114_0809357_103_462 | 119 |
| 491 | 3300049580 | Ga0501046_0909090 | Ga0501046_0909090_84_446 | 119 |
| 492 | 3300049591 | Ga0501075_0554631 | Ga0501075_0554631_14_376 | 119 |
| 493 | 3300049823 | Ga0501044_0690482 | Ga0501044_0690482_241_600 | 119 |
| 494 | 3300050511 | nmdc:mga08y16_303750_c1 | nmdc:mga08y16_303750_c1_111_473 | 119 |
| 495 | 3300053100 | Ga0500660_208864 | Ga0500660_208864_234_596 | 119 |
| 496 | 3300049576 | Ga0501040_0675428 | Ga0501040_0675428_15_395 | 120 |
| 497 | 3300049588 | Ga0501072_0647513 | Ga0501072_0647513_412_792 | 120 |
| 498 | 3300049824 | Ga0501045_0521455 | Ga0501045_0521455_389_769 | 120 |
| 499 | 3300054114 | Ga0501084_0951499 | Ga0501084_0951499_123_503 | 120 |
| 500 | 3300050491 | nmdc:mga00v17_185209_c1 | nmdc:mga00v17_185209_c1_441_809 | 121 |
| 501 | 3300050492 | nmdc:mga0yw44_123493_c1 | nmdc:mga0yw44_123493_c1_1158_1526 | 121 |
| 502 | 3300050493 | nmdc:mga0k408_248665_c1 | nmdc:mga0k408_248665_c1_484_852 | 121 |
| 503 | 3300050494 | nmdc:mga06z11_368647_c1 | nmdc:mga06z11_368647_c1_350_718 | 121 |
| 504 | 3300050495 | nmdc:mga04h51_174525_c1 | nmdc:mga04h51_174525_c1_159_527 | 121 |
| 505 | 3300050516 | nmdc:mga0sz30_64716_c1 | nmdc:mga0sz30_64716_c1_695_1063 | 121 |
| 506 | 3300049568 | Ga0501031_0532011 | Ga0501031_0532011_286_657 | 123 |
| 507 | 3300049569 | Ga0501032_0221158 | Ga0501032_0221158_39_410 | 123 |
| 508 | 3300049572 | Ga0501036_0275270 | Ga0501036_0275270_180_551 | 123 |
| 509 | 3300049573 | Ga0501037_0107235 | Ga0501037_0107235_1371_1742 | 123 |
| 510 | 3300049577 | Ga0501041_0212270 | Ga0501041_0212270_147_518 | 123 |
| 511 | 3300049578 | Ga0501042_0036838 | Ga0501042_0036838_2938_3309 | 123 |
| 512 | 3300049579 | Ga0501043_0622702 | Ga0501043_0622702_280_651 | 123 |
| 513 | 3300049580 | Ga0501046_0033621 | Ga0501046_0033621_2105_2476 | 123 |
| 514 | 3300049582 | Ga0501048_0318874 | Ga0501048_0318874_626_997 | 123 |
| 515 | 3300049587 | Ga0501071_1462430 | Ga0501071_1462430_12_383 | 123 |
| 516 | 3300049590 | Ga0501074_0259768 | Ga0501074_0259768_714_1085 | 123 |
| 517 | 3300049592 | Ga0501076_0350977 | Ga0501076_0350977_180_551 | 123 |
| 518 | 3300049741 | Ga0501079_1390327 | Ga0501079_1390327_110_481 | 123 |
| 519 | 3300049742 | Ga0501080_1610613 | Ga0501080_1610613_100_471 | 123 |
| 520 | 3300049822 | Ga0501035_0953021 | Ga0501035_0953021_175_546 | 123 |
| 521 | 3300060353 | Ga0501082_0860039 | Ga0501082_0860039_61_432 | 123 |
| 522 | 3300049589 | Ga0501073_0133733 | Ga0501073_0133733_462_881 | 124 |
| 523 | 3300049591 | Ga0501075_0207112 | Ga0501075_0207112_597_1028 | 124 |
| 524 | 2162886006 | SwRhRL3b_contig_1545184 | SwRhRL3b_0520.00000270 | 125 |
| 525 | 2162886006 | SwRhRL3b_contig_3118854 | SwRhRL3b_0451.00001520 | 125 |
| 526 | 3300003349 | JGI26129J50193_1002582 | JGI26129J50193_10025821 | 125 |
| 527 | 3300003371 | JGI26145J50221_1002080 | JGI26145J50221_10020801 | 125 |
| 528 | 3300003382 | JGI26139J50223_100526 | JGI26139J50223_1005261 | 125 |
| 529 | 3300003392 | JGI26134J50242_100045 | JGI26134J50242_1000454 | 125 |
| 530 | 3300003396 | JGI26137J50245_100040 | JGI26137J50245_1000404 | 125 |
| 531 | 3300003398 | JGI26130J50248_100845 | JGI26130J50248_1008452 | 125 |
| 532 | 3300003398 | JGI26130J50248_103330 | JGI26130J50248_1033301 | 125 |
| 533 | 3300003399 | JGI26136J50244_100012 | JGI26136J50244_1000126 | 125 |
| 534 | 3300003399 | JGI26136J50244_102731 | JGI26136J50244_1027311 | 125 |
| 535 | 3300003503 | JGI26141J51220_1000065 | JGI26141J51220_10000651 | 125 |
| 536 | 3300003504 | JGI26138J51218_100034 | JGI26138J51218_1000342 | 125 |
| 537 | 3300005289 | Ga0065704_10002310 | Ga0065704_1000231012 | 125 |
| 538 | 3300005295 | Ga0065707_10001142 | Ga0065707_1000114210 | 125 |
| 539 | 3300005328 | Ga0070676_10014403 | Ga0070676_100144036 | 125 |
| 540 | 3300005331 | Ga0070670_101312709 | Ga0070670_1013127091 | 125 |
| 541 | 3300005331 | Ga0070670_101607464 | Ga0070670_1016074641 | 125 |
| 542 | 3300005341 | Ga0070691_10622892 | Ga0070691_106228921 | 125 |
| 543 | 3300005366 | Ga0070659_100118747 | Ga0070659_1001187473 | 125 |
| 544 | 3300005367 | Ga0070667_101377451 | Ga0070667_1013774511 | 125 |
| 545 | 3300005440 | Ga0070705_100082362 | Ga0070705_1000823623 | 125 |
| 546 | 3300005444 | Ga0070694_100066961 | Ga0070694_1000669613 | 125 |
| 547 | 3300005457 | Ga0070662_100175101 | Ga0070662_1001751012 | 125 |
| 548 | 3300005459 | Ga0068867_100728813 | Ga0068867_1007288132 | 125 |
| 549 | 3300005530 | Ga0070679_101897722 | Ga0070679_1018977221 | 125 |
| 550 | 3300005545 | Ga0070695_100405546 | Ga0070695_1004055461 | 125 |
| 551 | 3300005577 | Ga0068857_100291980 | Ga0068857_1002919802 | 125 |
| 552 | 3300005577 | Ga0068857_100476427 | Ga0068857_1004764272 | 125 |
| 553 | 3300005615 | Ga0070702_100721285 | Ga0070702_1007212852 | 125 |
| 554 | 3300005616 | Ga0068852_100947802 | Ga0068852_1009478021 | 125 |
| 555 | 3300005840 | Ga0068870_10001809 | Ga0068870_100018098 | 125 |
| 556 | 3300005843 | Ga0068860_100232523 | Ga0068860_1002325233 | 125 |
| 557 | 3300005844 | Ga0068862_100232442 | Ga0068862_1002324422 | 125 |
| 558 | 3300006844 | Ga0075428_100007033 | Ga0075428_1000070338 | 125 |
| 559 | 3300006844 | Ga0075428_101108564 | Ga0075428_1011085642 | 125 |
| 560 | 3300006846 | Ga0075430_100269344 | Ga0075430_1002693443 | 125 |
| 561 | 3300006847 | Ga0075431_101182011 | Ga0075431_1011820112 | 125 |
| 562 | 3300006880 | Ga0075429_100003497 | Ga0075429_10000349711 | 125 |
| 563 | 3300006880 | Ga0075429_100135246 | Ga0075429_1001352464 | 125 |
| 564 | 3300009093 | Ga0105240_11282419 | Ga0105240_112824191 | 125 |
| 565 | 3300009094 | Ga0111539_10032379 | Ga0111539_100323797 | 125 |
| 566 | 3300009094 | Ga0111539_10143071 | Ga0111539_101430712 | 125 |
| 567 | 3300009147 | Ga0114129_10015776 | Ga0114129_1001577610 | 125 |
| 568 | 3300009147 | Ga0114129_10618452 | Ga0114129_106184521 | 125 |
| 569 | 3300009553 | Ga0105249_10333907 | Ga0105249_103339071 | 125 |
| 570 | 3300011119 | Ga0105246_10180792 | Ga0105246_101807922 | 125 |
| 571 | 3300014326 | Ga0157380_10581470 | Ga0157380_105814702 | 125 |
| 572 | 3300025907 | Ga0207645_10005574 | Ga0207645_100055746 | 125 |
| 573 | 3300025908 | Ga0207643_10000939 | Ga0207643_1000093914 | 125 |
| 574 | 3300025921 | Ga0207652_11267189 | Ga0207652_112671891 | 125 |
| 575 | 3300025932 | Ga0207690_10083758 | Ga0207690_100837581 | 125 |
| 576 | 3300025933 | Ga0207706_10128092 | Ga0207706_101280923 | 125 |
| 577 | 3300026067 | Ga0207678_10583126 | Ga0207678_105831262 | 125 |
| 578 | 3300026089 | Ga0207648_11218395 | Ga0207648_112183951 | 125 |
| 579 | 3300026116 | Ga0207674_10474259 | Ga0207674_104742592 | 125 |
| 580 | 3300026116 | Ga0207674_10607681 | Ga0207674_106076811 | 125 |
| 581 | 3300027252 | Ga0209973_1000443 | Ga0209973_10004433 | 125 |
| 582 | 3300027364 | Ga0209967_1000075 | Ga0209967_100007510 | 125 |
| 583 | 3300027378 | Ga0209981_1000656 | Ga0209981_10006562 | 125 |
| 584 | 3300027395 | Ga0209996_1000096 | Ga0209996_10000968 | 125 |
| 585 | 3300027471 | Ga0209995_1000119 | Ga0209995_10001198 | 125 |
| 586 | 3300027526 | Ga0209968_1000063 | Ga0209968_10000638 | 125 |
| 587 | 3300027617 | Ga0210002_1000481 | Ga0210002_10004818 | 125 |
| 588 | 3300027665 | Ga0209983_1001089 | Ga0209983_10010892 | 125 |
| 589 | 3300027695 | Ga0209966_1000316 | Ga0209966_10003168 | 125 |
| 590 | 3300027907 | Ga0207428_10033121 | Ga0207428_100331211 | 125 |
| 591 | 3300028381 | Ga0268264_10033024 | Ga0268264_100330241 | 125 |
| 592 | 3300042001 | Ga0439441_000659 | Ga0439441_000659_2116_2517 | 125 |
| 593 | 3300042003 | Ga0439443_022468 | Ga0439443_022468_519_920 | 125 |
| 594 | 3300042008 | Ga0439450_000400 | Ga0439450_000400_3806_4207 | 125 |
| 595 | 3300042009 | Ga0439451_003231 | Ga0439451_003231_1194_1595 | 125 |
| 596 | 3300042011 | Ga0439454_000030 | Ga0439454_000030_1354_1755 | 125 |
| 597 | 3300042016 | Ga0439463_001438 | Ga0439463_001438_2811_3212 | 125 |
| 598 | 3300042436 | Ga0439435_0002613 | Ga0439435_0002613_3122_3523 | 125 |
| 599 | 3300042437 | Ga0439444_0004325 | Ga0439444_0004325_1199_1600 | 125 |
| 600 | 3300042439 | Ga0439464_0032819 | Ga0439464_0032819_519_920 | 125 |
| 601 | 3300042461 | Ga0439460_0006124 | Ga0439460_0006124_2488_2889 | 125 |
| 602 | 3300045051 | Ga0451576_0029623 | Ga0451576_0029623_1545_1937 | 125 |
| 603 | 3300049571 | Ga0501034_0264645 | Ga0501034_0264645_522_914 | 125 |
| 604 | 3300049575 | Ga0501039_0394416 | Ga0501039_0394416_236_613 | 125 |
| 605 | 3300049578 | Ga0501042_0090118 | Ga0501042_0090118_832_1209 | 125 |
| 606 | 3300049580 | Ga0501046_0458314 | Ga0501046_0458314_187_564 | 125 |
| 607 | 3300049587 | Ga0501071_0259384 | Ga0501071_0259384_600_977 | 125 |
| 608 | 3300049592 | Ga0501076_0505397 | Ga0501076_0505397_324_701 | 125 |
| 609 | 3300049741 | Ga0501079_0536969 | Ga0501079_0536969_205_582 | 125 |
| 610 | 3300049824 | Ga0501045_0612283 | Ga0501045_0612283_262_639 | 125 |
| 611 | 3300050507 | nmdc:mga05p37_6406_c2 | nmdc:mga05p37_6406_c2_11613_11990 | 125 |
| 612 | 3300050507 | nmdc:mga05p37_89340_c1 | nmdc:mga05p37_89340_c1_504_881 | 125 |
| 613 | 3300050508 | nmdc:mga09592_150935_c1 | nmdc:mga09592_150935_c1_1125_1502 | 125 |
| 614 | 3300050508 | nmdc:mga09592_1603_c1 | nmdc:mga09592_1603_c1_6465_6842 | 125 |
| 615 | 3300050508 | nmdc:mga09592_201729_c1 | nmdc:mga09592_201729_c1_33_410 | 125 |
| 616 | 3300050509 | nmdc:mga0qj67_25579_c1 | nmdc:mga0qj67_25579_c1_504_881 | 125 |
| 617 | 3300050509 | nmdc:mga0qj67_283328_c1 | nmdc:mga0qj67_283328_c1_865_1242 | 125 |
| 618 | 3300050510 | nmdc:mga06r32_2035748_c1 | nmdc:mga06r32_2035748_c1_87_464 | 125 |
| 619 | 3300050510 | nmdc:mga06r32_35589_c2 | nmdc:mga06r32_35589_c2_294_671 | 125 |
| 620 | 3300050510 | nmdc:mga06r32_8121_c1 | nmdc:mga06r32_8121_c1_621_998 | 125 |
| 621 | 3300050511 | nmdc:mga08y16_136996_c1 | nmdc:mga08y16_136996_c1_522_899 | 125 |
| 622 | 3300050511 | nmdc:mga08y16_209766_c1 | nmdc:mga08y16_209766_c1_789_1166 | 125 |
| 623 | 3300050511 | nmdc:mga08y16_961159_c1 | nmdc:mga08y16_961159_c1_426_803 | 125 |
| 624 | 3300050511 | nmdc:mga08y16_966_c2 | nmdc:mga08y16_966_c2_7839_8216 | 125 |
| 625 | 3300060353 | Ga0501082_0225397 | Ga0501082_0225397_291_668 | 125 |
| 626 | 3300061734 | Ga0530510_0080761 | Ga0530510_0080761_130_507 | 125 |
| 627 | 3300061734 | Ga0530510_0216571 | Ga0530510_0216571_779_1156 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9255 | 7 | 124 |
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.9213 | 4 | 124 |
| 2okq-assembly1.cif.gz_A | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.8795 | 4 | 124 |
| 2okq-assembly1.cif.gz_B | crystal structure of unknown conserved ybaa protein from shigella flexneri | 0.8521 | 7 | 124 |
| 8ecx-assembly1.cif.gz_B | pa0709 with glyoxal and bme modifications | 0.7625 | 6 | 99 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9189 | 8 | 124 | 3.30.70.100 |
| af_P0AAQ6_1_117_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9041 | 8 | 124 | 3.30.70.100 |
| 3qmqB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.728 | 9 | 123 | 3.30.70.100 |
| af_F6NVH9_176_279_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7278 | 6 | 124 | 3.30.70.100 |
| 1xbwA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.7183 | 8 | 125 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5W334-F1-model_v4 | DUF1428 domain-containing protein | 0.9878 | 1 | 125 |
|
| AF-A0A2N3EFM6-F1-model_v4 | DUF1428 domain-containing protein | 0.9804 | 8 | 124 |
|
| AF-A0A7W0LC78-F1-model_v4 | DUF1428 domain-containing protein | 0.979 | 6 | 124 |
|
| AF-A0A2V9R7F6-F1-model_v4 | DUF1428 domain-containing protein | 0.9776 | 8 | 125 |
|
| AF-A0A7T9J2T4-F1-model_v4 | deleted | 0.9708 | 6 | 124 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar