F470551

General Info

Members Datasets Scaffolds Average Seq Length
627 352 606 312

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10028029|Ga0099795_100280292
Length 372
Sequence VCLSAWKVGPIYGKALIGDERGSIASRRQACAELHFTCKPRRISFLESFPEIPMSMADRDGFIWYDGKLVPWRSATTHVLTHSLHYGLAVFEGVRAYKTVDGTAIFRLADHTERLFNSAHIYMMKIPYGRETLIEAQKEVVRANQHDSCYIRPIAFYGSEKMGVSPIGATVHVAIAAWPWGAYLGPEAIEKGIRVKTSSFARHHINVTMARSKMAGTYPNSILANLEATQHGYDEGLLLDVDGFVAEGSGENIFIVKDGKLHEPELTSALSGITRASVITLANELGYEVVSRRLTRDDIYIADEAFFTGTAAEVTPIRELDGRTIGAGTRGPVTTKIQKLFFDVIAGKVAKHKDWLSPVNEKASSRVSREKA

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
5 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
6 2643221569 Achromobacter sp. Root565 Isolate Unclassified
7 2643221594 Achromobacter sp. Root170 Isolate Unclassified
8 2643221621 Achromobacter sp. Root83 Isolate Unclassified
9 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
10 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
11 2855730933 Achromobacter sp. HZ28 Isolate Nodule
12 2855767633 Achromobacter sp. HZ34 Isolate Nodule
13 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
14 2858950400 Achromobacter sp. K91 Isolate Unclassified
15 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
16 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
17 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
18 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
19 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
183 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
194 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
197 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
225 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
233 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
234 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
235 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
242 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
243 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
251 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
252 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
253 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
273 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
276 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
277 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
278 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
281 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
298 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
307 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
308 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
327 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
333 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
347 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
348 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
349 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
350 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
351 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
352 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.17
Metatranscriptomes 0.48
Isolates 3.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.39
Nodule 0.32
Rhizoplane 2.23
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 5.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000516 3300003187 Bacteria 36120
2 Ga0065712_10131402 3300005290 Bacteria 1545
3 Ga0065715_10146804 3300005293 Bacteria 1775
4 Ga0070658_10005401 3300005327 Bacteria 10371
5 Ga0070658_10067962 3300005327 Bacteria 2912
6 Ga0070658_10136018 3300005327 Bacteria 2051
7 Ga0070683_100036866 3300005329 Bacteria 4474
8 Ga0070683_100179863 3300005329 Bacteria 2007
9 Ga0070690_100037193 3300005330 Bacteria 3066
10 Ga0070690_100162491 3300005330 Bacteria 1531
11 Ga0070666_10003225 3300005335 Bacteria 9905
12 Ga0070680_100126865 3300005336 Bacteria 2132
13 Ga0070682_100193864 3300005337 Bacteria 1428
14 Ga0068868_100040558 3300005338 Bacteria 3624
15 Ga0068868_100222258 3300005338 Bacteria 1581
16 Ga0068868_100335263 3300005338 Bacteria 1292
17 Ga0070660_100080497 3300005339 Bacteria 2556
18 Ga0070660_100155664 3300005339 Bacteria 1839
19 Ga0070689_100000002 3300005340 Bacteria 695141
20 Ga0070687_100068831 3300005343 Bacteria 1894
21 Ga0070671_100002165 3300005355 Bacteria 15154
22 Ga0070671_100544467 3300005355 Bacteria 1001
23 Ga0070688_100000414 3300005365 Bacteria 21639
24 Ga0070659_100045031 3300005366 Bacteria 3456
25 Ga0070667_100012039 3300005367 Bacteria 7160
26 Ga0070709_10074167 3300005434 Bacteria 2205
27 Ga0070714_100015455 3300005435 Bacteria 6142
28 Ga0070714_100026067 3300005435 Bacteria 4829
29 Ga0070714_100040552 3300005435 Bacteria 3924
30 Ga0070714_100053819 3300005435 Bacteria 3437
31 Ga0070713_100001176 3300005436 Bacteria 16724
32 Ga0070713_100036705 3300005436 Bacteria 3957
33 Ga0070713_100452149 3300005436 Bacteria 1206
34 Ga0070710_10005850 3300005437 Bacteria 5869
35 Ga0070710_10006053 3300005437 Bacteria 5782
36 Ga0070710_10013499 3300005437 Bacteria 4094
37 Ga0070711_100000696 3300005439 Bacteria 17615
38 Ga0070711_100101318 3300005439 Bacteria 2095
39 Ga0070694_100009079 3300005444 Bacteria 6096
40 Ga0070694_100037526 3300005444 Bacteria 3214
41 Ga0070694_100180368 3300005444 Bacteria 1562
42 Ga0070663_100019603 3300005455 Bacteria 4463
43 Ga0070678_100027528 3300005456 Bacteria 3861
44 Ga0070678_100278098 3300005456 Bacteria 1414
45 Ga0070662_100309808 3300005457 Bacteria 1285
46 Ga0070681_10019793 3300005458 Bacteria 6740
47 Ga0070681_10061415 3300005458 Bacteria 3732
48 Ga0070681_10066867 3300005458 Bacteria 3563
49 Ga0070681_10268538 3300005458 Bacteria 1617
50 Ga0068867_100029179 3300005459 Bacteria 3974
51 Ga0068867_100048854 3300005459 Bacteria 3114
52 Ga0070685_10053565 3300005466 Bacteria 2338
53 Ga0070698_100074104 3300005471 Bacteria 3410
54 Ga0070679_100011258 3300005530 Bacteria 8525
55 Ga0070684_100013793 3300005535 Bacteria 6524
56 Ga0070684_100046695 3300005535 Bacteria 3752
57 Ga0070697_100000387 3300005536 Bacteria 34310
58 Ga0070697_100075256 3300005536 Bacteria 2775
59 Ga0070697_100076954 3300005536 Bacteria 2744
60 Ga0068853_100030959 3300005539 Bacteria 4523
61 Ga0068853_100093308 3300005539 Bacteria 2650
62 Ga0068853_100121269 3300005539 Bacteria 2333
63 Ga0070686_100059500 3300005544 Bacteria 2462
64 Ga0070686_100134337 3300005544 Bacteria 1715
65 Ga0070695_100053841 3300005545 Bacteria 2588
66 Ga0070696_100002413 3300005546 Bacteria 12376
67 Ga0070696_100007006 3300005546 Bacteria 7521
68 Ga0070696_100053156 3300005546 Bacteria 2819
69 Ga0070696_100060640 3300005546 Bacteria 2645
70 Ga0070693_100001757 3300005547 Bacteria 9880
71 Ga0070693_100124204 3300005547 Bacteria 1605
72 Ga0070665_100025205 3300005548 Bacteria 5993
73 Ga0070704_100082574 3300005549 Bacteria 2370
74 Ga0070704_100117310 3300005549 Bacteria 2037
75 Ga0068855_100024894 3300005563 Bacteria 7162
76 Ga0068855_100026030 3300005563 Bacteria 6998
77 Ga0068855_100128167 3300005563 Bacteria 2900
78 Ga0068855_100460578 3300005563 Bacteria 1387
79 Ga0070664_100215209 3300005564 Bacteria 1718
80 Ga0068857_100136792 3300005577 Bacteria 2212
81 Ga0068854_100016671 3300005578 Bacteria 4902
82 Ga0068856_100013711 3300005614 Bacteria 7836
83 Ga0068856_100049933 3300005614 Bacteria 4123
84 Ga0070702_100065759 3300005615 Bacteria 2124
85 Ga0068852_100000554 3300005616 Bacteria 24527
86 Ga0068852_100001905 3300005616 Bacteria 14201
87 Ga0068852_100015681 3300005616 Bacteria 5886
88 Ga0068852_100204595 3300005616 Bacteria 1869
89 Ga0068864_100034288 3300005618 Bacteria 4317
90 Ga0068866_10002901 3300005718 Bacteria 7068
91 Ga0068861_100163944 3300005719 Bacteria 1836
92 Ga0068851_10000229 3300005834 Bacteria 27016
93 Ga0068851_10071717 3300005834 Bacteria 1793
94 Ga0068870_10055741 3300005840 Bacteria 2107
95 Ga0068858_100017245 3300005842 Bacteria 6773
96 Ga0068858_100028590 3300005842 Bacteria 5178
97 Ga0068858_100093425 3300005842 Bacteria 2800
98 Ga0068860_100599073 3300005843 Bacteria 1107
99 Ga0070717_10124226 3300006028 Bacteria 2214
100 Ga0075368_10039954 3300006042 Bacteria 1841
101 Ga0070715_10056243 3300006163 Bacteria 1711
102 Ga0070715_10059385 3300006163 Bacteria 1673
103 Ga0070716_100022575 3300006173 Bacteria 3327
104 Ga0070716_100053803 3300006173 Bacteria 2297
105 Ga0070712_100001651 3300006175 Bacteria 13660
106 Ga0070712_100045826 3300006175 Bacteria 3021
107 Ga0070712_100147136 3300006175 Bacteria 1804
108 Ga0075369_10014439 3300006186 Bacteria 3155
109 Ga0075366_10009881 3300006195 Bacteria 5339
110 Ga0075366_10076709 3300006195 Bacteria 1995
111 Ga0097621_100036037 3300006237 Bacteria 3955
112 Ga0068871_100004374 3300006358 Bacteria 9821
113 Ga0068871_100017486 3300006358 Bacteria 5427
114 Ga0068871_100203600 3300006358 Bacteria 1710
115 Ga0075428_100002905 3300006844 Bacteria 18646
116 Ga0075428_100044527 3300006844 Bacteria 4877
117 Ga0075430_100034651 3300006846 Bacteria 4285
118 Ga0075430_100056974 3300006846 Bacteria 3287
119 Ga0075431_100404571 3300006847 Bacteria 1366
120 Ga0075433_10000110 3300006852 Bacteria 40433
121 Ga0075433_10109726 3300006852 Bacteria 2448
122 Ga0075433_10109950 3300006852 Bacteria 2445
123 Ga0075434_100065115 3300006871 Bacteria 3630
124 Ga0075434_100098714 3300006871 Bacteria 2926
125 Ga0075434_100133112 3300006871 Bacteria 2506
126 Ga0075429_100033171 3300006880 Bacteria 4486
127 Ga0075429_100118416 3300006880 Bacteria 2315
128 Ga0097620_100132747 3300006931 Bacteria 2562
129 Ga0099795_10028029 3300007788 Bacteria 1911
130 Ga0105240_10018674 3300009093 Bacteria 9291
131 Ga0105240_10060469 3300009093 Bacteria 4723
132 Ga0105240_10074744 3300009093 Bacteria 4181
133 Ga0105240_10106295 3300009093 Bacteria 3404
134 Ga0105240_10127435 3300009093 Bacteria 3057
135 Ga0111539_10003499 3300009094 Bacteria 20711
136 Ga0105245_10011124 3300009098 Bacteria 7832
137 Ga0105245_10252393 3300009098 Bacteria 1714
138 Ga0105247_10029850 3300009101 Bacteria 3306
139 Ga0114129_10046541 3300009147 Bacteria 6095
140 Ga0105243_10090156 3300009148 Bacteria 2523
141 Ga0105241_10010136 3300009174 Bacteria 6918
142 Ga0105241_10113850 3300009174 Bacteria 2169
143 Ga0105242_10003813 3300009176 Bacteria 11724
144 Ga0105242_10009597 3300009176 Bacteria 7417
145 Ga0105242_10042004 3300009176 Bacteria 3690
146 Ga0105248_10021630 3300009177 Bacteria 7123
147 Ga0105237_10021527 3300009545 Bacteria 6629
148 Ga0105237_10178560 3300009545 Bacteria 2123
149 Ga0105237_10624609 3300009545 Bacteria 1084
150 Ga0105238_10065776 3300009551 Bacteria 3626
151 Ga0105238_10120614 3300009551 Bacteria 2602
152 Ga0105238_10460445 3300009551 Bacteria 1269
153 Ga0105239_10086834 3300010375 Bacteria 3448
154 Ga0105239_10163494 3300010375 Bacteria 2488
155 Ga0105239_10175387 3300010375 Bacteria 2397
156 Ga0105246_10038730 3300011119 Bacteria 3207
157 Ga0157373_10035289 3300013100 Bacteria 3591
158 Ga0157373_10298022 3300013100 Bacteria 1144
159 Ga0157371_10019530 3300013102 Bacteria 4995
160 Ga0157371_10131682 3300013102 Bacteria 1779
161 Ga0157370_10002509 3300013104 Bacteria 22106
162 Ga0157370_10019075 3300013104 Bacteria 6893
163 Ga0157370_10029259 3300013104 Bacteria 5410
164 Ga0157370_10032996 3300013104 Bacteria 5050
165 Ga0157369_10000904 3300013105 Bacteria 37886
166 Ga0157369_10044093 3300013105 Bacteria 4857
167 Ga0157369_10245566 3300013105 Bacteria 1869
168 Ga0157369_10652329 3300013105 Bacteria 1085
169 Ga0157374_10035131 3300013296 Bacteria 4584
170 Ga0163162_10125806 3300013306 Bacteria 2669
171 Ga0163162_10148202 3300013306 Bacteria 2463
172 Ga0163162_10264232 3300013306 Bacteria 1852
173 Ga0157372_10010371 3300013307 Bacteria 9906
174 Ga0157372_10122441 3300013307 Bacteria 2989
175 Ga0157372_10224221 3300013307 Bacteria 2179
176 Ga0157372_10358302 3300013307 Bacteria 1699
177 Ga0157372_10417913 3300013307 Bacteria 1563
178 Ga0157372_10437194 3300013307 Bacteria 1525
179 Ga0157372_10634745 3300013307 Bacteria 1244
180 Ga0157375_10042981 3300013308 Bacteria 4378
181 Ga0157375_10482650 3300013308 Bacteria 1404
182 Ga0163163_10013714 3300014325 Bacteria 7426
183 Ga0163163_10038793 3300014325 Bacteria 4644
184 Ga0157380_10146563 3300014326 Bacteria 2035
185 Ga0182008_10079861 3300014497 Bacteria 1609
186 Ga0157377_10007044 3300014745 Bacteria 5400
187 Ga0157379_10018386 3300014968 Bacteria 6162
188 Ga0157379_10040838 3300014968 Bacteria 4141
189 Ga0157379_10089553 3300014968 Bacteria 2760
190 Ga0157379_10103232 3300014968 Bacteria 2558
191 Ga0157376_10291370 3300014969 Bacteria 1541
192 Ga0157376_10643190 3300014969 Bacteria 1060
193 Ga0163161_10079877 3300017792 Bacteria 2406
194 Ga0206354_10773014 3300020081 Bacteria 2302
195 Ga0154015_1545361 3300020610 Bacteria 957
196 Ga0209258_101933 3300025242 Bacteria 6083
197 Ga0209455_1000420 3300025272 Bacteria 33306
198 Ga0209676_1016081 3300025292 Bacteria 2722
199 Ga0209025_1000141 3300025294 Bacteria 184281
200 Ga0209050_1002420 3300025298 Bacteria 16080
201 Ga0207656_10004971 3300025321 Bacteria 4670
202 Ga0207656_10007459 3300025321 Bacteria 3983
203 Ga0207656_10037209 3300025321 Bacteria 2046
204 Ga0207692_10060325 3300025898 Bacteria 1961
205 Ga0207680_10005277 3300025903 Bacteria 6166
206 Ga0207685_10008765 3300025905 Bacteria 2901
207 Ga0207699_10010741 3300025906 Bacteria 4606
208 Ga0207705_10094166 3300025909 Bacteria 2196
209 Ga0207705_10115974 3300025909 Bacteria 1982
210 Ga0207705_10121753 3300025909 Bacteria 1936
211 Ga0207654_10085962 3300025911 Bacteria 1905
212 Ga0207707_10005992 3300025912 Bacteria 10640
213 Ga0207707_10034568 3300025912 Bacteria 4422
214 Ga0207707_10110746 3300025912 Bacteria 2400
215 Ga0207707_10113913 3300025912 Bacteria 2363
216 Ga0207707_10209873 3300025912 Bacteria 1697
217 Ga0207695_10062423 3300025913 Bacteria 3847
218 Ga0207695_10077004 3300025913 Bacteria 3389
219 Ga0207695_10116851 3300025913 Bacteria 2641
220 Ga0207695_10207195 3300025913 Bacteria 1873
221 Ga0207695_10255703 3300025913 Bacteria 1650
222 Ga0207671_10332711 3300025914 Bacteria 1203
223 Ga0207693_10000449 3300025915 Bacteria 37683
224 Ga0207693_10090350 3300025915 Bacteria 2401
225 Ga0207663_10003365 3300025916 Bacteria 7814
226 Ga0207663_10228616 3300025916 Bacteria 1358
227 Ga0207660_10094245 3300025917 Bacteria 2225
228 Ga0207662_10070888 3300025918 Bacteria 2109
229 Ga0207662_10094126 3300025918 Bacteria 1847
230 Ga0207657_10000297 3300025919 Bacteria 52991
231 Ga0207649_10029443 3300025920 Bacteria 3242
232 Ga0207649_10044989 3300025920 Bacteria 2704
233 Ga0207649_10144487 3300025920 Bacteria 1631
234 Ga0207652_10045918 3300025921 Bacteria 3725
235 Ga0207652_10123772 3300025921 Bacteria 2302
236 Ga0207652_10350467 3300025921 Bacteria 1332
237 Ga0207694_10033000 3300025924 Bacteria 3965
238 Ga0207650_10020902 3300025925 Bacteria 4624
239 Ga0207687_10005787 3300025927 Bacteria 8182
240 Ga0207687_10019194 3300025927 Bacteria 4527
241 Ga0207687_10068842 3300025927 Bacteria 2522
242 Ga0207700_10012513 3300025928 Bacteria 5476
243 Ga0207700_10326538 3300025928 Bacteria 1331
244 Ga0207700_10387906 3300025928 Bacteria 1222
245 Ga0207664_10014931 3300025929 Bacteria 5623
246 Ga0207664_10027283 3300025929 Bacteria 4327
247 Ga0207664_10028558 3300025929 Bacteria 4240
248 Ga0207664_10035835 3300025929 Bacteria 3831
249 Ga0207664_10036315 3300025929 Bacteria 3808
250 Ga0207690_10090593 3300025932 Bacteria 2159
251 Ga0207690_10164364 3300025932 Bacteria 1657
252 Ga0207706_10043412 3300025933 Bacteria 3984
253 Ga0207686_10000474 3300025934 Bacteria 26589
254 Ga0207686_10008745 3300025934 Bacteria 5470
255 Ga0207709_10188392 3300025935 Bacteria 1463
256 Ga0207670_10000001 3300025936 Bacteria 949312
257 Ga0207665_10004123 3300025939 Bacteria 9694
258 Ga0207665_10014728 3300025939 Bacteria 5143
259 Ga0207711_10002490 3300025941 Bacteria 16440
260 Ga0207689_10041855 3300025942 Bacteria 3790
261 Ga0207661_10088947 3300025944 Bacteria 2568
262 Ga0207661_10228401 3300025944 Bacteria 1647
263 Ga0207679_10156516 3300025945 Bacteria 1861
264 Ga0207667_10013735 3300025949 Bacteria 9255
265 Ga0207667_10023013 3300025949 Bacteria 6867
266 Ga0207667_10031080 3300025949 Bacteria 5768
267 Ga0207667_10099563 3300025949 Bacteria 2999
268 Ga0207667_10114860 3300025949 Bacteria 2775
269 Ga0207667_10288493 3300025949 Bacteria 1677
270 Ga0207651_10007117 3300025960 Bacteria 5940
271 Ga0207651_10080227 3300025960 Bacteria 2348
272 Ga0207658_10087484 3300025986 Bacteria 2406
273 Ga0207677_10009935 3300026023 Bacteria 5366
274 Ga0207703_10007141 3300026035 Bacteria 8887
275 Ga0207703_10058212 3300026035 Bacteria 3153
276 Ga0207639_10044835 3300026041 Bacteria 3328
277 Ga0207639_10112617 3300026041 Bacteria 2221
278 Ga0207639_10318047 3300026041 Bacteria 1381
279 Ga0207639_10411903 3300026041 Bacteria 1220
280 Ga0207678_10012275 3300026067 Bacteria 7522
281 Ga0207702_10022087 3300026078 Bacteria 5272
282 Ga0207702_10118288 3300026078 Bacteria 2367
283 Ga0207702_10186557 3300026078 Bacteria 1913
284 Ga0207641_10015550 3300026088 Bacteria 6235
285 Ga0207648_10090444 3300026089 Bacteria 2674
286 Ga0207648_10124429 3300026089 Bacteria 2268
287 Ga0207676_10025612 3300026095 Bacteria 4377
288 Ga0207674_10000396 3300026116 Bacteria 56376
289 Ga0207674_10018103 3300026116 Bacteria 7666
290 Ga0207674_10123583 3300026116 Bacteria 2554
291 Ga0207675_100075163 3300026118 Bacteria 3162
292 Ga0207675_100502022 3300026118 Bacteria 1208
293 Ga0207683_10001287 3300026121 Bacteria 22701
294 Ga0207683_10214645 3300026121 Bacteria 1752
295 Ga0207698_10003759 3300026142 Bacteria 9176
296 Ga0207698_10043816 3300026142 Bacteria 3356
297 Ga0207698_10135461 3300026142 Bacteria 2112
298 Ga0209984_1011203 3300027424 Bacteria 1159
299 Ga0210000_1010652 3300027462 Bacteria 1360
300 Ga0209983_1008059 3300027665 Bacteria 2154
301 Ga0209974_10001325 3300027876 Bacteria 8896
302 Ga0207428_10004905 3300027907 Bacteria 12607
303 Ga0207428_10005350 3300027907 Bacteria 11971
304 Ga0268266_10041082 3300028379 Bacteria 3944
305 Ga0268265_10281681 3300028380 Bacteria 1488
306 Ga0268264_10033840 3300028381 Bacteria 4201
307 Ga0268264_10509306 3300028381 Bacteria 1175
308 Ga0307511_10000164 3300030521 Bacteria 64605
309 Ga0265332_10000004 3300031238 Bacteria 426592
310 Ga0265332_10021756 3300031238 Bacteria 2831
311 Ga0265325_10025196 3300031241 Bacteria 3231
312 Ga0265327_10028560 3300031251 Bacteria 3188
313 Ga0265327_10052087 3300031251 Bacteria 2133
314 Ga0265316_10071091 3300031344 Bacteria 2683
315 Ga0307408_100079001 3300031548 Bacteria 2454
316 Ga0307408_100095572 3300031548 Bacteria 2253
317 Ga0307408_100184031 3300031548 Bacteria 1678
318 Ga0307508_10049204 3300031616 Bacteria 3754
319 Ga0316575_10054877 3300031665 Bacteria 1586
320 Ga0307413_10232493 3300031824 Bacteria 1355
321 Ga0307412_10000148 3300031911 Bacteria 50533
322 Ga0307416_100077509 3300032002 Bacteria 2792
323 Ga0307416_100665530 3300032002 Bacteria 1127
324 Ga0307414_10045164 3300032004 Bacteria 3015
325 Ga0307414_10235851 3300032004 Bacteria 1511
326 Ga0316583_10000345 3300032133 Bacteria 13267
327 Ga0316583_10010803 3300032133 Bacteria 3289
328 Ga0316593_10019538 3300032168 Bacteria 2095
329 Ga0307507_10039851 3300033179 Bacteria 4732
330 Ga0373958_0011459 3300034819 Bacteria 1499
331 Ga0373934_0003046 3300035086 Bacteria 6121
332 Ga0373936_0001904 3300035113 Bacteria 7700
333 Ga0373941_0018556 3300035115 Bacteria 1924
334 Ga0373954_0004840 3300035118 Bacteria 5808
335 Ga0373954_0016592 3300035118 Bacteria 3298
336 Ga0373956_0000103 3300035119 Bacteria 29146
337 Ga0373956_0017262 3300035119 Bacteria 3040
338 Ga0373957_0002129 3300035120 Bacteria 5569
339 Ga0373943_0007528 3300035170 Bacteria 4891
340 Ga0373943_0044243 3300035170 Bacteria 2166
341 Ga0373955_0002776 3300035172 Bacteria 7684
342 Ga0373955_0010947 3300035172 Bacteria 4306
343 Ga0373955_0012200 3300035172 Bacteria 4125
344 Ga0373961_0005558 3300035241 Bacteria 3029
345 Ga0316574_0053217 3300035398 Bacteria 2526
346 Ga0316574_0221173 3300035398 Bacteria 1213
347 Ga0373924_0001467 3300035410 Bacteria 7666
348 Ga0373924_0011127 3300035410 Bacteria 3334
349 Ga0373924_0099455 3300035410 Bacteria 1250
350 Ga0373931_0054923 3300035691 Bacteria 2130
351 Ga0373935_0321894 3300035692 Bacteria 1097
352 Ga0373927_0032817 3300035695 Bacteria 3381
353 Ga0373933_0017604 3300035724 Bacteria 4009
354 Ga0373933_0020378 3300035724 Bacteria 3758
355 Ga0373933_0050711 3300035724 Bacteria 2478
356 Ga0373933_0353750 3300035724 Bacteria 954
357 Ga0373947_0002381 3300035725 Bacteria 11355
358 Ga0373947_0018747 3300035725 Bacteria 3985
359 Ga0373937_0005811 3300036401 Bacteria 10609
360 Ga0373937_0006490 3300036401 Bacteria 10091
361 Ga0373937_0010340 3300036401 Bacteria 8146
362 Ga0373937_0033702 3300036401 Bacteria 4653
363 Ga0316582_0011326 3300036647 Bacteria 4925
364 Ga0373925_0073259 3300037068 Bacteria 2592
365 Ga0373925_0188574 3300037068 Bacteria 1635
366 Ga0395900_0002375 3300037418 Bacteria 20809
367 Ga0395905_0078422 3300037471 Bacteria 3096
368 Ga0316581_0077521 3300037588 Bacteria 1021
369 Ga0436364_0438780 3300037853 Bacteria 1217
370 Ga0395901_0051673 3300038443 Bacteria 4274
371 Ga0395901_0086884 3300038443 Bacteria 3270
372 Ga0395901_0141348 3300038443 Bacteria 2530
373 Ga0436361_1111140 3300039447 Bacteria 1445
374 Ga0451577_0003501 3300042876 Bacteria 17443
375 Ga0451577_0003515 3300042876 Bacteria 17370
376 Ga0451577_0004085 3300042876 Bacteria 15684
377 Ga0451577_0013830 3300042876 Bacteria 7539
378 Ga0451577_0037150 3300042876 Bacteria 4385
379 Ga0451577_0201804 3300042876 Bacteria 1795
380 Ga0451577_0256684 3300042876 Bacteria 1583
381 Ga0453683_0018786 3300044673 Bacteria 4435
382 Ga0466966_0153162 3300044684 Bacteria 1405
383 Ga0466963_0025591 3300044694 Bacteria 3766
384 Ga0453684_0000065 3300044712 Bacteria 468481
385 Ga0453684_0001131 3300044712 Bacteria 83523
386 Ga0453684_0001181 3300044712 Bacteria 80955
387 Ga0453684_0001452 3300044712 Bacteria 67372
388 Ga0453684_0003292 3300044712 Bacteria 36816
389 Ga0453684_0009602 3300044712 Bacteria 16876
390 Ga0453684_0010067 3300044712 Bacteria 16251
391 Ga0453684_0058382 3300044712 Bacteria 4984
392 Ga0453684_0105893 3300044712 Bacteria 3429
393 Ga0466971_0064903 3300044719 Bacteria 1653
394 Ga0451576_0000335 3300045051 Bacteria 113806
395 Ga0451576_0000526 3300045051 Bacteria 83427
396 Ga0451576_0001979 3300045051 Bacteria 32546
397 Ga0451576_0028559 3300045051 Bacteria 5972
398 Ga0451576_0036754 3300045051 Bacteria 5190
399 Ga0451576_0056353 3300045051 Bacteria 4110
400 Ga0451576_0062696 3300045051 Bacteria 3875
401 Ga0466958_0118908 3300045836 Bacteria 1653
402 Ga0466967_0014124 3300045976 Bacteria 6205
403 Ga0495592_0001049 3300046454 Bacteria 19178
404 Ga0495592_0084947 3300046454 Bacteria 2282
405 Ga0495592_0095526 3300046454 Bacteria 2126
406 Ga0495590_0020783 3300046457 Bacteria 2330
407 Ga0495629_0015666 3300046459 Bacteria 5443
408 Ga0495638_0018489 3300046460 Bacteria 4627
409 Ga0495641_0001109 3300046461 Bacteria 23172
410 Ga0495641_0071068 3300046461 Bacteria 1563
411 Ga0495651_0001335 3300046462 Bacteria 19115
412 Ga0495651_0008602 3300046462 Bacteria 7823
413 Ga0495651_0081151 3300046462 Bacteria 2449
414 Ga0495653_0005924 3300046463 Bacteria 10007
415 Ga0495653_0029699 3300046463 Bacteria 4360
416 Ga0495653_0060736 3300046463 Bacteria 2863
417 Ga0495653_0188121 3300046463 Bacteria 1411
418 Ga0495650_0001345 3300046471 Bacteria 24481
419 Ga0495650_0005814 3300046471 Bacteria 7865
420 Ga0495580_0000419 3300046472 Bacteria 35257
421 Ga0495580_0044957 3300046472 Bacteria 3138
422 Ga0495580_0078136 3300046472 Bacteria 2308
423 Ga0495580_0139893 3300046472 Bacteria 1678
424 Ga0495582_0155665 3300046473 Bacteria 1298
425 Ga0495605_0001689 3300046474 Bacteria 14177
426 Ga0495639_0039475 3300046475 Bacteria 2123
427 Ga0495662_0016429 3300046476 Bacteria 3585
428 Ga0495594_0016852 3300046499 Bacteria 3854
429 Ga0495606_0010357 3300046507 Bacteria 7747
430 Ga0495608_0025886 3300046511 Bacteria 4004
431 Ga0495608_0041098 3300046511 Bacteria 3096
432 Ga0495620_0008826 3300046515 Bacteria 5392
433 Ga0495628_0028030 3300046516 Bacteria 4580
434 Ga0495628_0028451 3300046516 Bacteria 4541
435 Ga0495628_0035453 3300046516 Bacteria 4008
436 Ga0495628_0067801 3300046516 Bacteria 2785
437 Ga0495628_0106034 3300046516 Bacteria 2165
438 Ga0495630_0001348 3300046517 Bacteria 16880
439 Ga0495630_0015929 3300046517 Bacteria 5495
440 Ga0495666_0000965 3300046526 Bacteria 13585
441 Ga0495666_0005962 3300046526 Bacteria 6144
442 Ga0495666_0045685 3300046526 Bacteria 2112
443 Ga0495642_0036410 3300046528 Bacteria 1989
444 Ga0495652_0082592 3300046529 Bacteria 2647
445 Ga0495652_0118386 3300046529 Bacteria 2117
446 Ga0495665_0023624 3300046531 Bacteria 3302
447 Ga0495586_0007778 3300046535 Bacteria 5714
448 Ga0495587_0016844 3300046536 Bacteria 4545
449 Ga0495621_0002360 3300046539 Bacteria 5077
450 Ga0495645_0000056 3300046543 Bacteria 81955
451 Ga0495645_0000842 3300046543 Bacteria 20871
452 Ga0495667_0004484 3300046559 Bacteria 9419
453 Ga0495667_0040464 3300046559 Bacteria 3095
454 Ga0495611_0005417 3300046648 Bacteria 5455
455 Ga0495625_0063884 3300046660 Bacteria 2599
456 Ga0495635_0025265 3300046663 Bacteria 4137
457 Ga0495635_0028419 3300046663 Bacteria 3887
458 Ga0495657_0034293 3300046675 Bacteria 3526
459 Ga0495657_0072632 3300046675 Bacteria 2243
460 Ga0495599_0000353 3300046678 Bacteria 27136
461 Ga0495599_0002751 3300046678 Bacteria 10260
462 Ga0495599_0013228 3300046678 Bacteria 5098
463 Ga0495599_0028664 3300046678 Bacteria 3488
464 Ga0495599_0078578 3300046678 Bacteria 2060
465 Ga0495623_0001978 3300046679 Bacteria 13755
466 Ga0495623_0008799 3300046679 Bacteria 6551
467 Ga0495623_0011173 3300046679 Bacteria 5809
468 Ga0495646_0103734 3300046680 Bacteria 1627
469 Ga0495647_0000531 3300046681 Bacteria 11170
470 Ga0495613_0020205 3300046689 Bacteria 4963
471 Ga0495613_0080741 3300046689 Bacteria 2363
472 Ga0495624_0000385 3300046690 Bacteria 35142
473 Ga0495624_0000446 3300046690 Bacteria 32513
474 Ga0495624_0026061 3300046690 Bacteria 3833
475 Ga0495624_0251198 3300046690 Bacteria 1069
476 Ga0495649_0047648 3300046694 Bacteria 2330
477 Ga0495600_0000226 3300046809 Bacteria 31185
478 Ga0495600_0065028 3300046809 Bacteria 2384
479 Ga0495581_0050005 3300047315 Bacteria 2414
480 Ga0495581_0161188 3300047315 Bacteria 1311
481 Ga0495604_0001989 3300047317 Bacteria 16502
482 Ga0495604_0039780 3300047317 Bacteria 3694
483 Ga0495636_0083394 3300047318 Bacteria 1379
484 Ga0495674_0005107 3300047319 Bacteria 12607
485 Ga0495674_0352900 3300047319 Bacteria 1194
486 Ga0495676_0093467 3300047321 Bacteria 2243
487 Ga0495680_0005058 3300047322 Bacteria 12448
488 Ga0495680_0029215 3300047322 Bacteria 4515
489 Ga0495683_0067986 3300047323 Bacteria 1753
490 Ga0495687_072736 3300047443 Bacteria 1372
491 Ga0495675_0016416 3300047444 Bacteria 4683
492 Ga0495675_0055961 3300047444 Bacteria 2501
493 Ga0495675_0141319 3300047444 Bacteria 1492
494 Ga0495679_000048 3300047446 Bacteria 127785
495 Ga0495684_0088090 3300047471 Bacteria 2352
496 Ga0495684_0266210 3300047471 Bacteria 1242
497 Ga0495593_0010083 3300047673 Bacteria 5469
498 Ga0495602_0005553 3300048088 Bacteria 13231
499 Ga0495626_0027564 3300048091 Bacteria 2762
500 Ga0496101_0023939 3300048904 Bacteria 4222
501 Ga0496104_0011562 3300048907 Bacteria 7909
502 Ga0496105_0004299 3300048908 Bacteria 10726
503 Ga0496106_0080556 3300048909 Bacteria 2501
504 Ga0496107_0037372 3300048910 Bacteria 3484
505 Ga0496108_0372878 3300048911 Bacteria 1246
506 Ga0496109_0071342 3300048912 Bacteria 3189
507 Ga0496110_0305668 3300048913 Bacteria 1449
508 Ga0496112_0001563 3300048915 Bacteria 17685
509 Ga0496112_0247295 3300048915 Bacteria 1735
510 Ga0496114_0021269 3300048917 Bacteria 5276
511 Ga0496114_0031136 3300048917 Bacteria 4389
512 Ga0496115_0125610 3300048918 Bacteria 2113
513 Ga0496116_0013153 3300048919 Bacteria 6697
514 Ga0496117_0022126 3300048920 Bacteria 5107
515 Ga0496117_0044020 3300048920 Bacteria 3237
516 Ga0496118_0029133 3300048921 Bacteria 4636
517 Ga0496118_0067713 3300048921 Bacteria 2597
518 Ga0496120_0040401 3300048923 Bacteria 2741
519 Ga0496121_0000157 3300048924 Bacteria 149289
520 Ga0496121_0006213 3300048924 Bacteria 14971
521 Ga0496121_0049065 3300048924 Bacteria 3585
522 Ga0496122_0000330 3300048925 Bacteria 102646
523 Ga0496122_0092372 3300048925 Bacteria 2057
524 Ga0496123_0000449 3300048926 Bacteria 73718
525 Ga0496124_0077161 3300048927 Bacteria 2748
526 Ga0496125_0000028 3300048928 Bacteria 387222
527 Ga0496125_0020130 3300048928 Bacteria 6273
528 Ga0496125_0027602 3300048928 Bacteria 5143
529 Ga0496126_0086776 3300048929 Bacteria 2758
530 Ga0496126_0344927 3300048929 Bacteria 1219
531 Ga0495678_010827 3300049459 Bacteria 4404
532 Ga0501290_005461 3300049513 Bacteria 1587
533 Ga0501300_015448 3300049523 Bacteria 1115
534 Ga0501031_0000981 3300049568 Bacteria 17341
535 Ga0501032_0001882 3300049569 Bacteria 16578
536 Ga0501033_0007174 3300049570 Bacteria 8696
537 Ga0501033_0016074 3300049570 Bacteria 5667
538 Ga0501034_0028036 3300049571 Bacteria 5727
539 Ga0501034_0060115 3300049571 Bacteria 3817
540 Ga0501034_0060213 3300049571 Bacteria 3814
541 Ga0501036_0000457 3300049572 Bacteria 29187
542 Ga0501037_0004620 3300049573 Bacteria 10011
543 Ga0501037_0021935 3300049573 Bacteria 4727
544 Ga0501037_0167328 3300049573 Bacteria 1564
545 Ga0501038_0002486 3300049574 Bacteria 17145
546 Ga0501038_0187165 3300049574 Bacteria 1668
547 Ga0501041_0112393 3300049577 Bacteria 1690
548 Ga0501043_0001931 3300049579 Bacteria 17749
549 Ga0501043_0206543 3300049579 Bacteria 1523
550 Ga0501046_0011855 3300049580 Bacteria 7440
551 Ga0501046_0045786 3300049580 Bacteria 3474
552 Ga0501047_0003333 3300049581 Bacteria 15218
553 Ga0501047_0005185 3300049581 Bacteria 12232
554 Ga0501047_0117809 3300049581 Bacteria 2537
555 Ga0501048_0138571 3300049582 Bacteria 1720
556 Ga0501069_0000469 3300049585 Bacteria 18414
557 Ga0501070_0000531 3300049586 Bacteria 35043
558 Ga0501071_0001663 3300049587 Bacteria 13042
559 Ga0501073_0005354 3300049589 Bacteria 9622
560 Ga0501073_0153081 3300049589 Bacteria 1598
561 Ga0501074_0004628 3300049590 Bacteria 9850
562 Ga0501075_0434884 3300049591 Bacteria 1001
563 Ga0501076_0023409 3300049592 Bacteria 4762
564 Ga0501076_0258499 3300049592 Bacteria 1425
565 Ga0501079_0026598 3300049741 Bacteria 4435
566 Ga0501080_0003248 3300049742 Bacteria 14342
567 Ga0501080_0028302 3300049742 Bacteria 5212
568 Ga0501081_0006141 3300049743 Bacteria 7785
569 Ga0501081_0281314 3300049743 Bacteria 1218
570 Ga0501083_0001601 3300049744 Bacteria 15480
571 Ga0501280_000307 3300049776 Bacteria 12329
572 Ga0501035_0000848 3300049822 Bacteria 32689
573 Ga0501035_0007523 3300049822 Bacteria 10179
574 Ga0501035_0015273 3300049822 Bacteria 7086
575 Ga0501035_0016321 3300049822 Bacteria 6851
576 Ga0501044_0000336 3300049823 Bacteria 59417
577 Ga0501044_0002803 3300049823 Bacteria 19864
578 Ga0501044_0006254 3300049823 Bacteria 13164
579 Ga0501044_0027660 3300049823 Bacteria 5987
580 Ga0501044_0337351 3300049823 Bacteria 1429
581 nmdc:mga0k408_43245_c1 3300050493 Bacteria 2595
582 nmdc:mga05p37_1696_c1 3300050507 Bacteria 25667
583 nmdc:mga09592_112397_c1 3300050508 Bacteria 2337
584 nmdc:mga09592_414747_c1 3300050508 Bacteria 1163
585 nmdc:mga09592_432_c1 3300050508 Bacteria 30841
586 nmdc:mga0qj67_7099_c1 3300050509 Bacteria 8263
587 nmdc:mga08y16_5020_c1 3300050511 Bacteria 13832
588 nmdc:mga08y16_63414_c1 3300050511 Bacteria 3860
589 nmdc:mga0n895_127075_c1 3300050512 Bacteria 2573
590 nmdc:mga0rr50_152923_c1 3300050513 Bacteria 1866
591 nmdc:mga08x19_341184_c1 3300050514 Bacteria 1045
592 nmdc:mga0a205_127157_c1 3300050515 Bacteria 2448
593 nmdc:mga0a205_798_c1 3300050515 Bacteria 25516
594 nmdc:mga0sz30_18054_c1 3300050516 Bacteria 2819
595 Ga0495601_0000678 3300053077 Bacteria 18176
596 Ga0495601_0002100 3300053077 Bacteria 11204
597 Ga0495601_0011921 3300053077 Bacteria 5211
598 Ga0495601_0108025 3300053077 Bacteria 1800
599 Ga0495612_0075236 3300053078 Bacteria 1413
600 Ga0495612_0090646 3300053078 Bacteria 1294
601 Ga0495595_0003664 3300053084 Bacteria 6103
602 Ga0495595_0039283 3300053084 Bacteria 2159
603 Ga0500646_0002822 3300053090 Bacteria 4466
604 Ga0500655_003214 3300053133 Bacteria 2963
605 Ga0500573_0034193 3300053140 Bacteria 2932
606 Ga0501082_0203665 3300060353 Bacteria 1722

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2501025502 2501079092 300
2 3300044712 Ga0453684_0105893 Ga0453684_0105893_1739_2659 301
3 iso_pu_bacteria 2547132512 2548847737 302
4 iso_pu_bacteria 2574179768 2574429172 302
5 iso_pu_bacteria 2599185292 2599906542 302
6 iso_pu_bacteria 2643221569 2643862591 302
7 iso_pu_bacteria 2643221594 2643980400 302
8 iso_pu_bacteria 2643221621 2644124891 302
9 iso_pu_bacteria 2739367655 2739611942 302
10 iso_pu_bacteria 2808606395 2809032286 302
11 iso_pu_bacteria 2855730933 2855736025 302
12 iso_pu_bacteria 2855767633 2855772963 302
13 iso_pu_bacteria 2857537821 2857538743 302
14 iso_pu_bacteria 2858950400 2858952660 302
15 iso_pu_bacteria 2881412998 2881413122 302
16 iso_pu_bacteria 2881927736 2881930079 302
17 iso_pu_bacteria 2887375801 2887377714 302
18 iso_pu_bacteria 2891633521 2891637669 302
19 iso_pu_bacteria 2919046199 2919049458 302
20 iso_pu_bacteria 2941479691 2941485302 302
21 iso_pu_bacteria 639633007 639787931 302
22 3300005293 Ga0065715_10146804 Ga0065715_101468042 304
23 3300005330 Ga0070690_100037193 Ga0070690_1000371933 304
24 3300005335 Ga0070666_10003225 Ga0070666_100032256 304
25 3300005338 Ga0068868_100335263 Ga0068868_1003352631 304
26 3300005339 Ga0070660_100155664 Ga0070660_1001556642 304
27 3300005340 Ga0070689_100000002 Ga0070689_100000002347 304
28 3300005343 Ga0070687_100068831 Ga0070687_1000688312 304
29 3300005355 Ga0070671_100002165 Ga0070671_1000021652 304
30 3300005365 Ga0070688_100000414 Ga0070688_10000041414 304
31 3300005367 Ga0070667_100012039 Ga0070667_1000120392 304
32 3300005434 Ga0070709_10074167 Ga0070709_100741672 304
33 3300005436 Ga0070713_100001176 Ga0070713_1000011764 304
34 3300005437 Ga0070710_10005850 Ga0070710_100058502 304
35 3300005439 Ga0070711_100000696 Ga0070711_1000006967 304
36 3300005444 Ga0070694_100009079 Ga0070694_1000090796 304
37 3300005456 Ga0070678_100027528 Ga0070678_1000275282 304
38 3300005456 Ga0070678_100278098 Ga0070678_1002780982 304
39 3300005457 Ga0070662_100309808 Ga0070662_1003098081 304
40 3300005459 Ga0068867_100029179 Ga0068867_1000291793 304
41 3300005459 Ga0068867_100048854 Ga0068867_1000488542 304
42 3300005466 Ga0070685_10053565 Ga0070685_100535652 304
43 3300005535 Ga0070684_100013793 Ga0070684_1000137932 304
44 3300005536 Ga0070697_100076954 Ga0070697_1000769542 304
45 3300005545 Ga0070695_100053841 Ga0070695_1000538411 304
46 3300005546 Ga0070696_100060640 Ga0070696_1000606401 304
47 3300005547 Ga0070693_100001757 Ga0070693_1000017575 304
48 3300005548 Ga0070665_100025205 Ga0070665_1000252052 304
49 3300005615 Ga0070702_100065759 Ga0070702_1000657592 304
50 3300005618 Ga0068864_100034288 Ga0068864_1000342882 304
51 3300005718 Ga0068866_10002901 Ga0068866_100029012 304
52 3300005719 Ga0068861_100163944 Ga0068861_1001639442 304
53 3300005842 Ga0068858_100028590 Ga0068858_1000285904 304
54 3300006163 Ga0070715_10059385 Ga0070715_100593852 304
55 3300006173 Ga0070716_100022575 Ga0070716_1000225752 304
56 3300006173 Ga0070716_100053803 Ga0070716_1000538032 304
57 3300006175 Ga0070712_100001651 Ga0070712_1000016515 304
58 3300006175 Ga0070712_100147136 Ga0070712_1001471362 304
59 3300006846 Ga0075430_100034651 Ga0075430_1000346512 304
60 3300006852 Ga0075433_10000110 Ga0075433_1000011010 304
61 3300006852 Ga0075433_10109950 Ga0075433_101099502 304
62 3300006871 Ga0075434_100133112 Ga0075434_1001331122 304
63 3300006880 Ga0075429_100118416 Ga0075429_1001184162 304
64 3300009093 Ga0105240_10127435 Ga0105240_101274352 304
65 3300009176 Ga0105242_10003813 Ga0105242_100038139 304
66 3300009545 Ga0105237_10624609 Ga0105237_106246091 304
67 3300014326 Ga0157380_10146563 Ga0157380_101465632 304
68 3300025321 Ga0207656_10037209 Ga0207656_100372092 304
69 3300025903 Ga0207680_10005277 Ga0207680_100052776 304
70 3300025911 Ga0207654_10085962 Ga0207654_100859622 304
71 3300025915 Ga0207693_10000449 Ga0207693_1000044922 304
72 3300025915 Ga0207693_10090350 Ga0207693_100903502 304
73 3300025916 Ga0207663_10003365 Ga0207663_100033657 304
74 3300025918 Ga0207662_10070888 Ga0207662_100708882 304
75 3300025920 Ga0207649_10029443 Ga0207649_100294433 304
76 3300025925 Ga0207650_10020902 Ga0207650_100209023 304
77 3300025927 Ga0207687_10005787 Ga0207687_100057873 304
78 3300025928 Ga0207700_10012513 Ga0207700_100125133 304
79 3300025929 Ga0207664_10028558 Ga0207664_100285581 304
80 3300025932 Ga0207690_10164364 Ga0207690_101643642 304
81 3300025933 Ga0207706_10043412 Ga0207706_100434122 304
82 3300025936 Ga0207670_10000001 Ga0207670_10000001560 304
83 3300025939 Ga0207665_10014728 Ga0207665_100147286 304
84 3300025941 Ga0207711_10002490 Ga0207711_1000249011 304
85 3300025942 Ga0207689_10041855 Ga0207689_100418552 304
86 3300025960 Ga0207651_10007117 Ga0207651_100071174 304
87 3300025960 Ga0207651_10080227 Ga0207651_100802271 304
88 3300025986 Ga0207658_10087484 Ga0207658_100874842 304
89 3300026023 Ga0207677_10009935 Ga0207677_100099354 304
90 3300026088 Ga0207641_10015550 Ga0207641_100155502 304
91 3300026089 Ga0207648_10090444 Ga0207648_100904442 304
92 3300026089 Ga0207648_10124429 Ga0207648_101244292 304
93 3300026095 Ga0207676_10025612 Ga0207676_100256122 304
94 3300026116 Ga0207674_10018103 Ga0207674_100181033 304
95 3300026118 Ga0207675_100075163 Ga0207675_1000751634 304
96 3300026121 Ga0207683_10214645 Ga0207683_102146452 304
97 3300028379 Ga0268266_10041082 Ga0268266_100410822 304
98 3300028381 Ga0268264_10033840 Ga0268264_100338402 304
99 3300035118 Ga0373954_0016592 Ga0373954_0016592_1340_2293 304
100 3300037068 Ga0373925_0073259 Ga0373925_0073259_254_1207 304
101 3300037471 Ga0395905_0078422 Ga0395905_0078422_1061_1981 304
102 3300042876 Ga0451577_0003501 Ga0451577_0003501_1820_2734 304
103 3300042876 Ga0451577_0004085 Ga0451577_0004085_729_1643 304
104 3300042876 Ga0451577_0201804 Ga0451577_0201804_367_1398 304
105 3300044694 Ga0466963_0025591 Ga0466963_0025591_1074_2018 304
106 3300045051 Ga0451576_0001979 Ga0451576_0001979_17576_18490 304
107 3300045976 Ga0466967_0014124 Ga0466967_0014124_1771_2715 304
108 3300046454 Ga0495592_0084947 Ga0495592_0084947_819_1772 304
109 3300046457 Ga0495590_0020783 Ga0495590_0020783_387_1307 304
110 3300046460 Ga0495638_0018489 Ga0495638_0018489_771_1691 304
111 3300046471 Ga0495650_0001345 Ga0495650_0001345_3247_4164 304
112 3300046471 Ga0495650_0005814 Ga0495650_0005814_3196_4116 304
113 3300046472 Ga0495580_0078136 Ga0495580_0078136_595_1515 304
114 3300046474 Ga0495605_0001689 Ga0495605_0001689_11338_12258 304
115 3300046507 Ga0495606_0010357 Ga0495606_0010357_1131_2051 304
116 3300046515 Ga0495620_0008826 Ga0495620_0008826_3224_4144 304
117 3300046517 Ga0495630_0015929 Ga0495630_0015929_3647_4567 304
118 3300046526 Ga0495666_0000965 Ga0495666_0000965_11045_11998 304
119 3300046528 Ga0495642_0036410 Ga0495642_0036410_1045_1965 304
120 3300046648 Ga0495611_0005417 Ga0495611_0005417_1051_1971 304
121 3300046660 Ga0495625_0063884 Ga0495625_0063884_995_1915 304
122 3300046678 Ga0495599_0002751 Ga0495599_0002751_5898_6818 304
123 3300046690 Ga0495624_0251198 Ga0495624_0251198_114_1034 304
124 3300046694 Ga0495649_0047648 Ga0495649_0047648_1132_2052 304
125 3300047321 Ga0495676_0093467 Ga0495676_0093467_107_1027 304
126 3300047323 Ga0495683_0067986 Ga0495683_0067986_324_1244 304
127 3300047443 Ga0495687_072736 Ga0495687_072736_274_1194 304
128 3300047444 Ga0495675_0016416 Ga0495675_0016416_17_970 304
129 3300047446 Ga0495679_000048 Ga0495679_000048_78869_79789 304
130 3300048091 Ga0495626_0027564 Ga0495626_0027564_170_1090 304
131 3300048915 Ga0496112_0247295 Ga0496112_0247295_547_1461 304
132 3300048921 Ga0496118_0067713 Ga0496118_0067713_348_1268 304
133 3300048929 Ga0496126_0344927 Ga0496126_0344927_68_988 304
134 3300049459 Ga0495678_010827 Ga0495678_010827_1186_2106 304
135 3300049570 Ga0501033_0016074 Ga0501033_0016074_3762_4676 304
136 3300049571 Ga0501034_0060213 Ga0501034_0060213_1270_2184 304
137 3300049573 Ga0501037_0167328 Ga0501037_0167328_235_1149 304
138 3300049579 Ga0501043_0206543 Ga0501043_0206543_101_1015 304
139 3300049581 Ga0501047_0005185 Ga0501047_0005185_10818_11732 304
140 3300049582 Ga0501048_0138571 Ga0501048_0138571_262_1176 304
141 3300049743 Ga0501081_0281314 Ga0501081_0281314_269_1201 304
142 3300049822 Ga0501035_0007523 Ga0501035_0007523_6482_7396 304
143 3300049822 Ga0501035_0016321 Ga0501035_0016321_3950_4864 304
144 3300050508 nmdc:mga09592_414747_c1 nmdc:mga09592_414747_c1_151_1122 304
145 3300050511 nmdc:mga08y16_5020_c1 nmdc:mga08y16_5020_c1_6487_7434 304
146 3300050514 nmdc:mga08x19_341184_c1 nmdc:mga08x19_341184_c1_43_966 304
147 3300050515 nmdc:mga0a205_127157_c1 nmdc:mga0a205_127157_c1_511_1482 304
148 3300050515 nmdc:mga0a205_798_c1 nmdc:mga0a205_798_c1_11195_12166 304
149 3300053077 Ga0495601_0011921 Ga0495601_0011921_1859_2812 304
150 3300053140 Ga0500573_0034193 Ga0500573_0034193_770_1684 304
151 iso_pu_bacteria 2510917013 2511093491 304
152 3300032168 Ga0316593_10019538 Ga0316593_100195382 305
153 3300003187 JGI25151J46595_10000516 JGI25151J46595_100005166 306
154 3300005290 Ga0065712_10131402 Ga0065712_101314022 306
155 3300005327 Ga0070658_10005401 Ga0070658_100054016 306
156 3300005327 Ga0070658_10067962 Ga0070658_100679623 306
157 3300005327 Ga0070658_10136018 Ga0070658_101360182 306
158 3300005329 Ga0070683_100036866 Ga0070683_1000368661 306
159 3300005329 Ga0070683_100179863 Ga0070683_1001798631 306
160 3300005330 Ga0070690_100162491 Ga0070690_1001624912 306
161 3300005336 Ga0070680_100126865 Ga0070680_1001268652 306
162 3300005337 Ga0070682_100193864 Ga0070682_1001938641 306
163 3300005338 Ga0068868_100040558 Ga0068868_1000405584 306
164 3300005338 Ga0068868_100222258 Ga0068868_1002222582 306
165 3300005339 Ga0070660_100080497 Ga0070660_1000804972 306
166 3300005355 Ga0070671_100544467 Ga0070671_1005444671 306
167 3300005366 Ga0070659_100045031 Ga0070659_1000450315 306
168 3300005435 Ga0070714_100015455 Ga0070714_1000154552 306
169 3300005435 Ga0070714_100026067 Ga0070714_1000260673 306
170 3300005435 Ga0070714_100040552 Ga0070714_1000405522 306
171 3300005435 Ga0070714_100053819 Ga0070714_1000538191 306
172 3300005436 Ga0070713_100036705 Ga0070713_1000367055 306
173 3300005436 Ga0070713_100452149 Ga0070713_1004521492 306
174 3300005437 Ga0070710_10006053 Ga0070710_100060535 306
175 3300005437 Ga0070710_10013499 Ga0070710_100134994 306
176 3300005439 Ga0070711_100101318 Ga0070711_1001013182 306
177 3300005444 Ga0070694_100037526 Ga0070694_1000375264 306
178 3300005444 Ga0070694_100180368 Ga0070694_1001803682 306
179 3300005455 Ga0070663_100019603 Ga0070663_1000196035 306
180 3300005458 Ga0070681_10019793 Ga0070681_100197932 306
181 3300005458 Ga0070681_10061415 Ga0070681_100614153 306
182 3300005458 Ga0070681_10066867 Ga0070681_100668671 306
183 3300005458 Ga0070681_10268538 Ga0070681_102685381 306
184 3300005471 Ga0070698_100074104 Ga0070698_1000741042 306
185 3300005530 Ga0070679_100011258 Ga0070679_1000112584 306
186 3300005535 Ga0070684_100046695 Ga0070684_1000466952 306
187 3300005536 Ga0070697_100000387 Ga0070697_10000038710 306
188 3300005536 Ga0070697_100075256 Ga0070697_1000752562 306
189 3300005539 Ga0068853_100030959 Ga0068853_1000309595 306
190 3300005539 Ga0068853_100093308 Ga0068853_1000933083 306
191 3300005539 Ga0068853_100121269 Ga0068853_1001212692 306
192 3300005544 Ga0070686_100059500 Ga0070686_1000595003 306
193 3300005544 Ga0070686_100134337 Ga0070686_1001343371 306
194 3300005546 Ga0070696_100002413 Ga0070696_1000024134 306
195 3300005546 Ga0070696_100007006 Ga0070696_1000070063 306
196 3300005546 Ga0070696_100053156 Ga0070696_1000531562 306
197 3300005547 Ga0070693_100124204 Ga0070693_1001242042 306
198 3300005549 Ga0070704_100082574 Ga0070704_1000825742 306
199 3300005549 Ga0070704_100117310 Ga0070704_1001173101 306
200 3300005563 Ga0068855_100024894 Ga0068855_1000248945 306
201 3300005563 Ga0068855_100026030 Ga0068855_1000260306 306
202 3300005563 Ga0068855_100128167 Ga0068855_1001281672 306
203 3300005563 Ga0068855_100460578 Ga0068855_1004605782 306
204 3300005564 Ga0070664_100215209 Ga0070664_1002152093 306
205 3300005577 Ga0068857_100136792 Ga0068857_1001367922 306
206 3300005578 Ga0068854_100016671 Ga0068854_1000166716 306
207 3300005614 Ga0068856_100013711 Ga0068856_1000137113 306
208 3300005614 Ga0068856_100049933 Ga0068856_1000499335 306
209 3300005616 Ga0068852_100000554 Ga0068852_10000055424 306
210 3300005616 Ga0068852_100001905 Ga0068852_10000190515 306
211 3300005616 Ga0068852_100015681 Ga0068852_1000156811 306
212 3300005616 Ga0068852_100204595 Ga0068852_1002045952 306
213 3300005834 Ga0068851_10000229 Ga0068851_100002293 306
214 3300005834 Ga0068851_10071717 Ga0068851_100717173 306
215 3300005840 Ga0068870_10055741 Ga0068870_100557412 306
216 3300005842 Ga0068858_100017245 Ga0068858_1000172456 306
217 3300005842 Ga0068858_100093425 Ga0068858_1000934253 306
218 3300005843 Ga0068860_100599073 Ga0068860_1005990731 306
219 3300006028 Ga0070717_10124226 Ga0070717_101242262 306
220 3300006042 Ga0075368_10039954 Ga0075368_100399542 306
221 3300006163 Ga0070715_10056243 Ga0070715_100562432 306
222 3300006175 Ga0070712_100045826 Ga0070712_1000458263 306
223 3300006186 Ga0075369_10014439 Ga0075369_100144392 306
224 3300006195 Ga0075366_10009881 Ga0075366_100098812 306
225 3300006195 Ga0075366_10076709 Ga0075366_100767093 306
226 3300006237 Ga0097621_100036037 Ga0097621_1000360375 306
227 3300006358 Ga0068871_100004374 Ga0068871_1000043742 306
228 3300006358 Ga0068871_100017486 Ga0068871_1000174867 306
229 3300006358 Ga0068871_100203600 Ga0068871_1002036002 306
230 3300006844 Ga0075428_100002905 Ga0075428_10000290516 306
231 3300006844 Ga0075428_100044527 Ga0075428_1000445276 306
232 3300006846 Ga0075430_100056974 Ga0075430_1000569744 306
233 3300006847 Ga0075431_100404571 Ga0075431_1004045712 306
234 3300006852 Ga0075433_10109726 Ga0075433_101097262 306
235 3300006871 Ga0075434_100065115 Ga0075434_1000651153 306
236 3300006871 Ga0075434_100098714 Ga0075434_1000987144 306
237 3300006880 Ga0075429_100033171 Ga0075429_1000331713 306
238 3300006931 Ga0097620_100132747 Ga0097620_1001327473 306
239 3300007788 Ga0099795_10028029 Ga0099795_100280292 306
240 3300009093 Ga0105240_10018674 Ga0105240_100186742 306
241 3300009093 Ga0105240_10060469 Ga0105240_100604694 306
242 3300009093 Ga0105240_10074744 Ga0105240_100747442 306
243 3300009093 Ga0105240_10106295 Ga0105240_101062953 306
244 3300009094 Ga0111539_10003499 Ga0111539_1000349914 306
245 3300009098 Ga0105245_10011124 Ga0105245_100111242 306
246 3300009098 Ga0105245_10252393 Ga0105245_102523933 306
247 3300009101 Ga0105247_10029850 Ga0105247_100298502 306
248 3300009147 Ga0114129_10046541 Ga0114129_100465414 306
249 3300009148 Ga0105243_10090156 Ga0105243_100901562 306
250 3300009174 Ga0105241_10010136 Ga0105241_100101363 306
251 3300009174 Ga0105241_10113850 Ga0105241_101138502 306
252 3300009176 Ga0105242_10009597 Ga0105242_100095977 306
253 3300009176 Ga0105242_10042004 Ga0105242_100420043 306
254 3300009177 Ga0105248_10021630 Ga0105248_100216304 306
255 3300009545 Ga0105237_10021527 Ga0105237_100215272 306
256 3300009545 Ga0105237_10178560 Ga0105237_101785602 306
257 3300009551 Ga0105238_10065776 Ga0105238_100657764 306
258 3300009551 Ga0105238_10120614 Ga0105238_101206142 306
259 3300009551 Ga0105238_10460445 Ga0105238_104604451 306
260 3300010375 Ga0105239_10086834 Ga0105239_100868341 306
261 3300010375 Ga0105239_10163494 Ga0105239_101634942 306
262 3300010375 Ga0105239_10175387 Ga0105239_101753872 306
263 3300011119 Ga0105246_10038730 Ga0105246_100387305 306
264 3300013100 Ga0157373_10035289 Ga0157373_100352893 306
265 3300013100 Ga0157373_10298022 Ga0157373_102980221 306
266 3300013102 Ga0157371_10019530 Ga0157371_100195302 306
267 3300013102 Ga0157371_10131682 Ga0157371_101316822 306
268 3300013104 Ga0157370_10002509 Ga0157370_1000250914 306
269 3300013104 Ga0157370_10019075 Ga0157370_100190752 306
270 3300013104 Ga0157370_10029259 Ga0157370_100292592 306
271 3300013104 Ga0157370_10032996 Ga0157370_100329963 306
272 3300013105 Ga0157369_10000904 Ga0157369_100009044 306
273 3300013105 Ga0157369_10044093 Ga0157369_100440932 306
274 3300013105 Ga0157369_10245566 Ga0157369_102455662 306
275 3300013105 Ga0157369_10652329 Ga0157369_106523291 306
276 3300013296 Ga0157374_10035131 Ga0157374_100351312 306
277 3300013306 Ga0163162_10125806 Ga0163162_101258062 306
278 3300013306 Ga0163162_10148202 Ga0163162_101482022 306
279 3300013306 Ga0163162_10264232 Ga0163162_102642322 306
280 3300013307 Ga0157372_10010371 Ga0157372_100103712 306
281 3300013307 Ga0157372_10122441 Ga0157372_101224412 306
282 3300013307 Ga0157372_10224221 Ga0157372_102242212 306
283 3300013307 Ga0157372_10358302 Ga0157372_103583023 306
284 3300013307 Ga0157372_10417913 Ga0157372_104179132 306
285 3300013307 Ga0157372_10437194 Ga0157372_104371941 306
286 3300013307 Ga0157372_10634745 Ga0157372_106347452 306
287 3300013308 Ga0157375_10042981 Ga0157375_100429814 306
288 3300013308 Ga0157375_10482650 Ga0157375_104826502 306
289 3300014325 Ga0163163_10013714 Ga0163163_100137143 306
290 3300014325 Ga0163163_10038793 Ga0163163_100387934 306
291 3300014497 Ga0182008_10079861 Ga0182008_100798613 306
292 3300014745 Ga0157377_10007044 Ga0157377_100070442 306
293 3300014968 Ga0157379_10018386 Ga0157379_100183865 306
294 3300014968 Ga0157379_10040838 Ga0157379_100408382 306
295 3300014968 Ga0157379_10089553 Ga0157379_100895532 306
296 3300014968 Ga0157379_10103232 Ga0157379_101032322 306
297 3300014969 Ga0157376_10291370 Ga0157376_102913702 306
298 3300014969 Ga0157376_10643190 Ga0157376_106431902 306
299 3300017792 Ga0163161_10079877 Ga0163161_100798772 306
300 3300020081 Ga0206354_10773014 Ga0206354_107730143 306
301 3300020610 Ga0154015_1545361 Ga0154015_15453611 306
302 3300025242 Ga0209258_101933 Ga0209258_1019332 306
303 3300025272 Ga0209455_1000420 Ga0209455_100042019 306
304 3300025292 Ga0209676_1016081 Ga0209676_10160814 306
305 3300025294 Ga0209025_1000141 Ga0209025_100014178 306
306 3300025298 Ga0209050_1002420 Ga0209050_10024204 306
307 3300025321 Ga0207656_10004971 Ga0207656_100049714 306
308 3300025321 Ga0207656_10007459 Ga0207656_100074595 306
309 3300025898 Ga0207692_10060325 Ga0207692_100603251 306
310 3300025905 Ga0207685_10008765 Ga0207685_100087654 306
311 3300025906 Ga0207699_10010741 Ga0207699_100107412 306
312 3300025909 Ga0207705_10094166 Ga0207705_100941662 306
313 3300025909 Ga0207705_10115974 Ga0207705_101159742 306
314 3300025909 Ga0207705_10121753 Ga0207705_101217532 306
315 3300025912 Ga0207707_10005992 Ga0207707_100059925 306
316 3300025912 Ga0207707_10034568 Ga0207707_100345682 306
317 3300025912 Ga0207707_10110746 Ga0207707_101107463 306
318 3300025912 Ga0207707_10113913 Ga0207707_101139133 306
319 3300025912 Ga0207707_10209873 Ga0207707_102098732 306
320 3300025913 Ga0207695_10062423 Ga0207695_100624233 306
321 3300025913 Ga0207695_10077004 Ga0207695_100770045 306
322 3300025913 Ga0207695_10116851 Ga0207695_101168512 306
323 3300025913 Ga0207695_10207195 Ga0207695_102071952 306
324 3300025913 Ga0207695_10255703 Ga0207695_102557033 306
325 3300025914 Ga0207671_10332711 Ga0207671_103327111 306
326 3300025916 Ga0207663_10228616 Ga0207663_102286162 306
327 3300025917 Ga0207660_10094245 Ga0207660_100942452 306
328 3300025918 Ga0207662_10094126 Ga0207662_100941263 306
329 3300025919 Ga0207657_10000297 Ga0207657_1000029740 306
330 3300025920 Ga0207649_10044989 Ga0207649_100449892 306
331 3300025920 Ga0207649_10144487 Ga0207649_101444872 306
332 3300025921 Ga0207652_10045918 Ga0207652_100459182 306
333 3300025921 Ga0207652_10123772 Ga0207652_101237722 306
334 3300025921 Ga0207652_10350467 Ga0207652_103504672 306
335 3300025924 Ga0207694_10033000 Ga0207694_100330002 306
336 3300025927 Ga0207687_10019194 Ga0207687_100191944 306
337 3300025927 Ga0207687_10068842 Ga0207687_100688423 306
338 3300025928 Ga0207700_10326538 Ga0207700_103265382 306
339 3300025928 Ga0207700_10387906 Ga0207700_103879061 306
340 3300025929 Ga0207664_10014931 Ga0207664_100149313 306
341 3300025929 Ga0207664_10027283 Ga0207664_100272834 306
342 3300025929 Ga0207664_10035835 Ga0207664_100358352 306
343 3300025929 Ga0207664_10036315 Ga0207664_100363152 306
344 3300025932 Ga0207690_10090593 Ga0207690_100905932 306
345 3300025934 Ga0207686_10000474 Ga0207686_1000047415 306
346 3300025934 Ga0207686_10008745 Ga0207686_100087455 306
347 3300025935 Ga0207709_10188392 Ga0207709_101883921 306
348 3300025939 Ga0207665_10004123 Ga0207665_100041234 306
349 3300025944 Ga0207661_10088947 Ga0207661_100889472 306
350 3300025944 Ga0207661_10228401 Ga0207661_102284012 306
351 3300025945 Ga0207679_10156516 Ga0207679_101565162 306
352 3300025949 Ga0207667_10013735 Ga0207667_100137358 306
353 3300025949 Ga0207667_10023013 Ga0207667_100230134 306
354 3300025949 Ga0207667_10031080 Ga0207667_100310804 306
355 3300025949 Ga0207667_10099563 Ga0207667_100995632 306
356 3300025949 Ga0207667_10114860 Ga0207667_101148604 306
357 3300025949 Ga0207667_10288493 Ga0207667_102884932 306
358 3300026035 Ga0207703_10007141 Ga0207703_100071416 306
359 3300026035 Ga0207703_10058212 Ga0207703_100582123 306
360 3300026041 Ga0207639_10044835 Ga0207639_100448352 306
361 3300026041 Ga0207639_10112617 Ga0207639_101126173 306
362 3300026041 Ga0207639_10318047 Ga0207639_103180471 306
363 3300026041 Ga0207639_10411903 Ga0207639_104119031 306
364 3300026067 Ga0207678_10012275 Ga0207678_100122753 306
365 3300026078 Ga0207702_10022087 Ga0207702_100220873 306
366 3300026078 Ga0207702_10118288 Ga0207702_101182883 306
367 3300026078 Ga0207702_10186557 Ga0207702_101865573 306
368 3300026116 Ga0207674_10000396 Ga0207674_1000039634 306
369 3300026116 Ga0207674_10123583 Ga0207674_101235833 306
370 3300026118 Ga0207675_100502022 Ga0207675_1005020222 306
371 3300026121 Ga0207683_10001287 Ga0207683_1000128711 306
372 3300026142 Ga0207698_10003759 Ga0207698_100037594 306
373 3300026142 Ga0207698_10043816 Ga0207698_100438164 306
374 3300026142 Ga0207698_10135461 Ga0207698_101354613 306
375 3300027424 Ga0209984_1011203 Ga0209984_10112032 306
376 3300027462 Ga0210000_1010652 Ga0210000_10106523 306
377 3300027665 Ga0209983_1008059 Ga0209983_10080593 306
378 3300027876 Ga0209974_10001325 Ga0209974_100013253 306
379 3300027907 Ga0207428_10004905 Ga0207428_100049058 306
380 3300027907 Ga0207428_10005350 Ga0207428_100053504 306
381 3300028380 Ga0268265_10281681 Ga0268265_102816812 306
382 3300028381 Ga0268264_10509306 Ga0268264_105093061 306
383 3300030521 Ga0307511_10000164 Ga0307511_1000016414 306
384 3300031238 Ga0265332_10000004 Ga0265332_1000000463 306
385 3300031238 Ga0265332_10021756 Ga0265332_100217562 306
386 3300031241 Ga0265325_10025196 Ga0265325_100251965 306
387 3300031251 Ga0265327_10028560 Ga0265327_100285603 306
388 3300031251 Ga0265327_10052087 Ga0265327_100520872 306
389 3300031344 Ga0265316_10071091 Ga0265316_100710912 306
390 3300031548 Ga0307408_100079001 Ga0307408_1000790013 306
391 3300031548 Ga0307408_100095572 Ga0307408_1000955723 306
392 3300031548 Ga0307408_100184031 Ga0307408_1001840312 306
393 3300031616 Ga0307508_10049204 Ga0307508_100492044 306
394 3300031665 Ga0316575_10054877 Ga0316575_100548773 306
395 3300031824 Ga0307413_10232493 Ga0307413_102324931 306
396 3300031911 Ga0307412_10000148 Ga0307412_1000014837 306
397 3300032002 Ga0307416_100077509 Ga0307416_1000775092 306
398 3300032002 Ga0307416_100665530 Ga0307416_1006655302 306
399 3300032004 Ga0307414_10045164 Ga0307414_100451644 306
400 3300032004 Ga0307414_10235851 Ga0307414_102358513 306
401 3300032133 Ga0316583_10000345 Ga0316583_100003458 306
402 3300032133 Ga0316583_10010803 Ga0316583_100108033 306
403 3300033179 Ga0307507_10039851 Ga0307507_100398513 306
404 3300034819 Ga0373958_0011459 Ga0373958_0011459_33_1007 306
405 3300035086 Ga0373934_0003046 Ga0373934_0003046_1493_2452 306
406 3300035113 Ga0373936_0001904 Ga0373936_0001904_3022_3981 306
407 3300035115 Ga0373941_0018556 Ga0373941_0018556_806_1780 306
408 3300035118 Ga0373954_0004840 Ga0373954_0004840_2726_3655 306
409 3300035119 Ga0373956_0000103 Ga0373956_0000103_5548_6507 306
410 3300035119 Ga0373956_0017262 Ga0373956_0017262_338_1297 306
411 3300035120 Ga0373957_0002129 Ga0373957_0002129_3519_4478 306
412 3300035170 Ga0373943_0007528 Ga0373943_0007528_1894_2853 306
413 3300035170 Ga0373943_0044243 Ga0373943_0044243_290_1210 306
414 3300035172 Ga0373955_0002776 Ga0373955_0002776_2936_3865 306
415 3300035172 Ga0373955_0010947 Ga0373955_0010947_1890_2849 306
416 3300035172 Ga0373955_0012200 Ga0373955_0012200_1423_2382 306
417 3300035241 Ga0373961_0005558 Ga0373961_0005558_233_1207 306
418 3300035398 Ga0316574_0053217 Ga0316574_0053217_992_1981 306
419 3300035398 Ga0316574_0221173 Ga0316574_0221173_55_1035 306
420 3300035410 Ga0373924_0001467 Ga0373924_0001467_5744_6703 306
421 3300035410 Ga0373924_0011127 Ga0373924_0011127_2390_3316 306
422 3300035410 Ga0373924_0099455 Ga0373924_0099455_22_978 306
423 3300035691 Ga0373931_0054923 Ga0373931_0054923_1074_2105 306
424 3300035692 Ga0373935_0321894 Ga0373935_0321894_42_1001 306
425 3300035695 Ga0373927_0032817 Ga0373927_0032817_2349_3308 306
426 3300035724 Ga0373933_0017604 Ga0373933_0017604_1218_2138 306
427 3300035724 Ga0373933_0020378 Ga0373933_0020378_2267_3226 306
428 3300035724 Ga0373933_0050711 Ga0373933_0050711_33_953 306
429 3300035724 Ga0373933_0353750 Ga0373933_0353750_21_941 306
430 3300035725 Ga0373947_0002381 Ga0373947_0002381_9145_10065 306
431 3300035725 Ga0373947_0018747 Ga0373947_0018747_736_1656 306
432 3300036401 Ga0373937_0005811 Ga0373937_0005811_6585_7505 306
433 3300036401 Ga0373937_0006490 Ga0373937_0006490_1502_2458 306
434 3300036401 Ga0373937_0010340 Ga0373937_0010340_3500_4429 306
435 3300036401 Ga0373937_0033702 Ga0373937_0033702_3682_4641 306
436 3300036647 Ga0316582_0011326 Ga0316582_0011326_3556_4536 306
437 3300037068 Ga0373925_0188574 Ga0373925_0188574_380_1333 306
438 3300037418 Ga0395900_0002375 Ga0395900_0002375_1306_2226 306
439 3300037588 Ga0316581_0077521 Ga0316581_0077521_28_1008 306
440 3300037853 Ga0436364_0438780 Ga0436364_0438780_56_1063 306
441 3300038443 Ga0395901_0051673 Ga0395901_0051673_765_1754 306
442 3300038443 Ga0395901_0086884 Ga0395901_0086884_2092_3012 306
443 3300038443 Ga0395901_0141348 Ga0395901_0141348_196_1122 306
444 3300039447 Ga0436361_1111140 Ga0436361_1111140_352_1272 306
445 3300042876 Ga0451577_0003515 Ga0451577_0003515_6794_7714 306
446 3300042876 Ga0451577_0013830 Ga0451577_0013830_2123_3043 306
447 3300042876 Ga0451577_0037150 Ga0451577_0037150_2126_3055 306
448 3300042876 Ga0451577_0256684 Ga0451577_0256684_67_1062 306
449 3300044673 Ga0453683_0018786 Ga0453683_0018786_1372_2298 306
450 3300044684 Ga0466966_0153162 Ga0466966_0153162_440_1393 306
451 3300044712 Ga0453684_0000065 Ga0453684_0000065_459045_459965 306
452 3300044712 Ga0453684_0001131 Ga0453684_0001131_74077_74997 306
453 3300044712 Ga0453684_0001181 Ga0453684_0001181_72949_73869 306
454 3300044712 Ga0453684_0001452 Ga0453684_0001452_48988_49917 306
455 3300044712 Ga0453684_0003292 Ga0453684_0003292_9315_10247 306
456 3300044712 Ga0453684_0009602 Ga0453684_0009602_2043_2963 306
457 3300044712 Ga0453684_0010067 Ga0453684_0010067_8559_9479 306
458 3300044712 Ga0453684_0058382 Ga0453684_0058382_2283_3212 306
459 3300044719 Ga0466971_0064903 Ga0466971_0064903_508_1461 306
460 3300045051 Ga0451576_0000335 Ga0451576_0000335_78326_79246 306
461 3300045051 Ga0451576_0000526 Ga0451576_0000526_73949_74869 306
462 3300045051 Ga0451576_0028559 Ga0451576_0028559_461_1381 306
463 3300045051 Ga0451576_0036754 Ga0451576_0036754_2587_3513 306
464 3300045051 Ga0451576_0056353 Ga0451576_0056353_253_1182 306
465 3300045051 Ga0451576_0062696 Ga0451576_0062696_1969_2895 306
466 3300045836 Ga0466958_0118908 Ga0466958_0118908_156_1109 306
467 3300046454 Ga0495592_0001049 Ga0495592_0001049_16808_17767 306
468 3300046454 Ga0495592_0095526 Ga0495592_0095526_1025_1954 306
469 3300046459 Ga0495629_0015666 Ga0495629_0015666_2226_3146 306
470 3300046461 Ga0495641_0001109 Ga0495641_0001109_6467_7426 306
471 3300046461 Ga0495641_0071068 Ga0495641_0071068_245_1177 306
472 3300046462 Ga0495651_0001335 Ga0495651_0001335_13340_14299 306
473 3300046462 Ga0495651_0008602 Ga0495651_0008602_940_1899 306
474 3300046462 Ga0495651_0081151 Ga0495651_0081151_291_1211 306
475 3300046463 Ga0495653_0005924 Ga0495653_0005924_4653_5612 306
476 3300046463 Ga0495653_0029699 Ga0495653_0029699_2603_3535 306
477 3300046463 Ga0495653_0060736 Ga0495653_0060736_165_1097 306
478 3300046463 Ga0495653_0188121 Ga0495653_0188121_276_1202 306
479 3300046472 Ga0495580_0000419 Ga0495580_0000419_3744_4676 306
480 3300046472 Ga0495580_0044957 Ga0495580_0044957_1798_2718 306
481 3300046472 Ga0495580_0139893 Ga0495580_0139893_160_1080 306
482 3300046473 Ga0495582_0155665 Ga0495582_0155665_206_1126 306
483 3300046475 Ga0495639_0039475 Ga0495639_0039475_1131_2051 306
484 3300046476 Ga0495662_0016429 Ga0495662_0016429_1951_2871 306
485 3300046499 Ga0495594_0016852 Ga0495594_0016852_2457_3416 306
486 3300046511 Ga0495608_0025886 Ga0495608_0025886_1423_2382 306
487 3300046511 Ga0495608_0041098 Ga0495608_0041098_639_1595 306
488 3300046516 Ga0495628_0028030 Ga0495628_0028030_3637_4569 306
489 3300046516 Ga0495628_0028451 Ga0495628_0028451_407_1339 306
490 3300046516 Ga0495628_0035453 Ga0495628_0035453_1630_2589 306
491 3300046516 Ga0495628_0067801 Ga0495628_0067801_1516_2475 306
492 3300046516 Ga0495628_0106034 Ga0495628_0106034_372_1328 306
493 3300046517 Ga0495630_0001348 Ga0495630_0001348_12196_13155 306
494 3300046526 Ga0495666_0005962 Ga0495666_0005962_4328_5260 306
495 3300046526 Ga0495666_0045685 Ga0495666_0045685_380_1312 306
496 3300046529 Ga0495652_0082592 Ga0495652_0082592_856_1815 306
497 3300046529 Ga0495652_0118386 Ga0495652_0118386_658_1617 306
498 3300046531 Ga0495665_0023624 Ga0495665_0023624_2086_3045 306
499 3300046535 Ga0495586_0007778 Ga0495586_0007778_3355_4314 306
500 3300046536 Ga0495587_0016844 Ga0495587_0016844_2326_3255 306
501 3300046539 Ga0495621_0002360 Ga0495621_0002360_3743_4663 306
502 3300046543 Ga0495645_0000056 Ga0495645_0000056_14075_15034 306
503 3300046543 Ga0495645_0000842 Ga0495645_0000842_9240_10196 306
504 3300046559 Ga0495667_0004484 Ga0495667_0004484_6059_7018 306
505 3300046559 Ga0495667_0040464 Ga0495667_0040464_663_1589 306
506 3300046663 Ga0495635_0025265 Ga0495635_0025265_1333_2289 306
507 3300046663 Ga0495635_0028419 Ga0495635_0028419_1965_2924 306
508 3300046675 Ga0495657_0034293 Ga0495657_0034293_275_1312 306
509 3300046675 Ga0495657_0072632 Ga0495657_0072632_467_1426 306
510 3300046678 Ga0495599_0000353 Ga0495599_0000353_12310_13269 306
511 3300046678 Ga0495599_0013228 Ga0495599_0013228_501_1457 306
512 3300046678 Ga0495599_0028664 Ga0495599_0028664_2422_3354 306
513 3300046678 Ga0495599_0078578 Ga0495599_0078578_78_1037 306
514 3300046679 Ga0495623_0001978 Ga0495623_0001978_10091_11017 306
515 3300046679 Ga0495623_0008799 Ga0495623_0008799_600_1556 306
516 3300046679 Ga0495623_0011173 Ga0495623_0011173_1571_2500 306
517 3300046680 Ga0495646_0103734 Ga0495646_0103734_558_1517 306
518 3300046681 Ga0495647_0000531 Ga0495647_0000531_3899_4858 306
519 3300046689 Ga0495613_0020205 Ga0495613_0020205_3023_3982 306
520 3300046689 Ga0495613_0080741 Ga0495613_0080741_740_1660 306
521 3300046690 Ga0495624_0000385 Ga0495624_0000385_6428_7360 306
522 3300046690 Ga0495624_0000446 Ga0495624_0000446_29878_30810 306
523 3300046690 Ga0495624_0026061 Ga0495624_0026061_1453_2412 306
524 3300046809 Ga0495600_0000226 Ga0495600_0000226_10647_11606 306
525 3300046809 Ga0495600_0065028 Ga0495600_0065028_1441_2361 306
526 3300047315 Ga0495581_0050005 Ga0495581_0050005_1085_2005 306
527 3300047315 Ga0495581_0161188 Ga0495581_0161188_232_1191 306
528 3300047317 Ga0495604_0001989 Ga0495604_0001989_1126_2052 306
529 3300047317 Ga0495604_0039780 Ga0495604_0039780_1006_1965 306
530 3300047318 Ga0495636_0083394 Ga0495636_0083394_259_1218 306
531 3300047319 Ga0495674_0005107 Ga0495674_0005107_11070_12029 306
532 3300047319 Ga0495674_0352900 Ga0495674_0352900_217_1176 306
533 3300047322 Ga0495680_0005058 Ga0495680_0005058_3227_4186 306
534 3300047322 Ga0495680_0029215 Ga0495680_0029215_2281_3213 306
535 3300047444 Ga0495675_0055961 Ga0495675_0055961_1382_2308 306
536 3300047444 Ga0495675_0141319 Ga0495675_0141319_370_1299 306
537 3300047471 Ga0495684_0088090 Ga0495684_0088090_956_1876 306
538 3300047471 Ga0495684_0266210 Ga0495684_0266210_229_1185 306
539 3300047673 Ga0495593_0010083 Ga0495593_0010083_2738_3670 306
540 3300048088 Ga0495602_0005553 Ga0495602_0005553_5878_6804 306
541 3300048904 Ga0496101_0023939 Ga0496101_0023939_1031_1960 306
542 3300048907 Ga0496104_0011562 Ga0496104_0011562_2310_3263 306
543 3300048908 Ga0496105_0004299 Ga0496105_0004299_9678_10607 306
544 3300048909 Ga0496106_0080556 Ga0496106_0080556_909_1835 306
545 3300048910 Ga0496107_0037372 Ga0496107_0037372_808_1737 306
546 3300048911 Ga0496108_0372878 Ga0496108_0372878_61_987 306
547 3300048912 Ga0496109_0071342 Ga0496109_0071342_2161_3090 306
548 3300048913 Ga0496110_0305668 Ga0496110_0305668_229_1158 306
549 3300048915 Ga0496112_0001563 Ga0496112_0001563_16116_17045 306
550 3300048917 Ga0496114_0021269 Ga0496114_0021269_3643_4572 306
551 3300048917 Ga0496114_0031136 Ga0496114_0031136_193_1119 306
552 3300048918 Ga0496115_0125610 Ga0496115_0125610_592_1512 306
553 3300048919 Ga0496116_0013153 Ga0496116_0013153_40_972 306
554 3300048920 Ga0496117_0022126 Ga0496117_0022126_708_1640 306
555 3300048920 Ga0496117_0044020 Ga0496117_0044020_2190_3110 306
556 3300048921 Ga0496118_0029133 Ga0496118_0029133_117_1037 306
557 3300048923 Ga0496120_0040401 Ga0496120_0040401_1215_2147 306
558 3300048924 Ga0496121_0000157 Ga0496121_0000157_102319_103251 306
559 3300048924 Ga0496121_0006213 Ga0496121_0006213_13155_14075 306
560 3300048924 Ga0496121_0049065 Ga0496121_0049065_805_1737 306
561 3300048925 Ga0496122_0000330 Ga0496122_0000330_67126_68058 306
562 3300048925 Ga0496122_0092372 Ga0496122_0092372_26_958 306
563 3300048926 Ga0496123_0000449 Ga0496123_0000449_3551_4483 306
564 3300048927 Ga0496124_0077161 Ga0496124_0077161_1200_2132 306
565 3300048928 Ga0496125_0000028 Ga0496125_0000028_247720_248652 306
566 3300048928 Ga0496125_0020130 Ga0496125_0020130_3288_4220 306
567 3300048928 Ga0496125_0027602 Ga0496125_0027602_102_1022 306
568 3300048929 Ga0496126_0086776 Ga0496126_0086776_1115_2047 306
569 3300049513 Ga0501290_005461 Ga0501290_005461_208_1134 306
570 3300049523 Ga0501300_015448 Ga0501300_015448_172_1092 306
571 3300049568 Ga0501031_0000981 Ga0501031_0000981_7603_8523 306
572 3300049569 Ga0501032_0001882 Ga0501032_0001882_9758_10678 306
573 3300049570 Ga0501033_0007174 Ga0501033_0007174_5291_6211 306
574 3300049571 Ga0501034_0028036 Ga0501034_0028036_2377_3297 306
575 3300049571 Ga0501034_0060115 Ga0501034_0060115_1527_2447 306
576 3300049572 Ga0501036_0000457 Ga0501036_0000457_3322_4242 306
577 3300049573 Ga0501037_0004620 Ga0501037_0004620_7613_8533 306
578 3300049573 Ga0501037_0021935 Ga0501037_0021935_1359_2279 306
579 3300049574 Ga0501038_0002486 Ga0501038_0002486_7009_7929 306
580 3300049574 Ga0501038_0187165 Ga0501038_0187165_468_1388 306
581 3300049577 Ga0501041_0112393 Ga0501041_0112393_199_1176 306
582 3300049579 Ga0501043_0001931 Ga0501043_0001931_13236_14156 306
583 3300049580 Ga0501046_0011855 Ga0501046_0011855_1422_2342 306
584 3300049580 Ga0501046_0045786 Ga0501046_0045786_2113_3033 306
585 3300049581 Ga0501047_0003333 Ga0501047_0003333_5480_6400 306
586 3300049581 Ga0501047_0117809 Ga0501047_0117809_366_1319 306
587 3300049585 Ga0501069_0000469 Ga0501069_0000469_17165_18118 306
588 3300049586 Ga0501070_0000531 Ga0501070_0000531_1203_2156 306
589 3300049587 Ga0501071_0001663 Ga0501071_0001663_2969_3946 306
590 3300049589 Ga0501073_0005354 Ga0501073_0005354_4450_5403 306
591 3300049589 Ga0501073_0153081 Ga0501073_0153081_18_995 306
592 3300049590 Ga0501074_0004628 Ga0501074_0004628_8094_9047 306
593 3300049591 Ga0501075_0434884 Ga0501075_0434884_35_955 306
594 3300049592 Ga0501076_0023409 Ga0501076_0023409_2074_3051 306
595 3300049592 Ga0501076_0258499 Ga0501076_0258499_300_1220 306
596 3300049741 Ga0501079_0026598 Ga0501079_0026598_2230_3183 306
597 3300049742 Ga0501080_0003248 Ga0501080_0003248_9784_10761 306
598 3300049742 Ga0501080_0028302 Ga0501080_0028302_3516_4469 306
599 3300049743 Ga0501081_0006141 Ga0501081_0006141_3302_4279 306
600 3300049744 Ga0501083_0001601 Ga0501083_0001601_10884_11837 306
601 3300049776 Ga0501280_000307 Ga0501280_000307_3886_4806 306
602 3300049822 Ga0501035_0000848 Ga0501035_0000848_8264_9184 306
603 3300049822 Ga0501035_0015273 Ga0501035_0015273_4644_5564 306
604 3300049823 Ga0501044_0000336 Ga0501044_0000336_24054_24974 306
605 3300049823 Ga0501044_0002803 Ga0501044_0002803_2999_3919 306
606 3300049823 Ga0501044_0006254 Ga0501044_0006254_8880_9800 306
607 3300049823 Ga0501044_0027660 Ga0501044_0027660_3594_4514 306
608 3300049823 Ga0501044_0337351 Ga0501044_0337351_84_1058 306
609 3300050493 nmdc:mga0k408_43245_c1 nmdc:mga0k408_43245_c1_294_1217 306
610 3300050507 nmdc:mga05p37_1696_c1 nmdc:mga05p37_1696_c1_16145_17113 306
611 3300050508 nmdc:mga09592_112397_c1 nmdc:mga09592_112397_c1_1270_2220 306
612 3300050508 nmdc:mga09592_432_c1 nmdc:mga09592_432_c1_16618_17586 306
613 3300050509 nmdc:mga0qj67_7099_c1 nmdc:mga0qj67_7099_c1_213_1187 306
614 3300050511 nmdc:mga08y16_63414_c1 nmdc:mga08y16_63414_c1_371_1339 306
615 3300050512 nmdc:mga0n895_127075_c1 nmdc:mga0n895_127075_c1_619_1548 306
616 3300050513 nmdc:mga0rr50_152923_c1 nmdc:mga0rr50_152923_c1_858_1787 306
617 3300050516 nmdc:mga0sz30_18054_c1 nmdc:mga0sz30_18054_c1_777_1787 306
618 3300053077 Ga0495601_0000678 Ga0495601_0000678_5762_6721 306
619 3300053077 Ga0495601_0002100 Ga0495601_0002100_6553_7509 306
620 3300053077 Ga0495601_0108025 Ga0495601_0108025_73_1032 306
621 3300053078 Ga0495612_0075236 Ga0495612_0075236_403_1323 306
622 3300053078 Ga0495612_0090646 Ga0495612_0090646_127_1047 306
623 3300053084 Ga0495595_0003664 Ga0495595_0003664_1870_2829 306
624 3300053084 Ga0495595_0039283 Ga0495595_0039283_926_1846 306
625 3300053090 Ga0500646_0002822 Ga0500646_0002822_769_1791 306
626 3300053133 Ga0500655_003214 Ga0500655_003214_1234_2256 306
627 3300060353 Ga0501082_0203665 Ga0501082_0203665_743_1696 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01063

Aminotran_4

Amino-transferase class IV

89

320

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4whx-assembly1.cif.gz_E x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate 0.976 2 306
6nst-assembly1.cif.gz_B crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9758 2 306
6nst-assembly1.cif.gz_F crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9748 1 305
6nst-assembly1.cif.gz_A crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.974 1 305
6nst-assembly1.cif.gz_D crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa 0.9735 2 305
ID Description Score Start End Superfamily
3u0gF02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.982 129 294 3.20.10.10
af_P0AB80_137_302_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.9818 138 294 3.30.470.10
6h65B02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9752 135 294 3.20.10.10
af_I1JRF2_385_551_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9711 136 290 3.20.10.10
3u0gF02 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9705 129 294 3.20.10.10
ID Description Score Start End GO Terms
AF-A0A349S5M3-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9941 173 306 GO:0005829
GO:0006532
GO:0009098
GO:0009099
GO:0052655
GO:0052656
AF-A0A532D543-F1-model_v4 Branched chain amino acid aminotransferase (EC 2.6.1.42) 0.9936 170 306 GO:0005829
GO:0008652
GO:0009082
GO:0052655
GO:0052656
AF-A0A2N2SIT2-F1-model_v4 branched-chain-amino-acid transaminase (EC 2.6.1.42) 0.9928 136 306 GO:0004084
GO:0005829
GO:0046394
AF-A0A532E8X2-F1-model_v4 Branched chain amino acid aminotransferase (EC 2.6.1.42) 0.9927 139 306 GO:0005829
GO:0008652
GO:0009082
GO:0052655
GO:0052656
AF-A0A3N5GLS2-F1-model_v4 Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) 0.9915 93 306 GO:0005829
GO:0009097
GO:0009098
GO:0009099
GO:0052655
GO:0052656

Feature Viewer

pLDDT pTM Quality
87.89 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map