F470551
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 627 | 352 | 606 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10028029|Ga0099795_100280292 |
| Length | 372 |
| Sequence | VCLSAWKVGPIYGKALIGDERGSIASRRQACAELHFTCKPRRISFLESFPEIPMSMADRDGFIWYDGKLVPWRSATTHVLTHSLHYGLAVFEGVRAYKTVDGTAIFRLADHTERLFNSAHIYMMKIPYGRETLIEAQKEVVRANQHDSCYIRPIAFYGSEKMGVSPIGATVHVAIAAWPWGAYLGPEAIEKGIRVKTSSFARHHINVTMARSKMAGTYPNSILANLEATQHGYDEGLLLDVDGFVAEGSGENIFIVKDGKLHEPELTSALSGITRASVITLANELGYEVVSRRLTRDDIYIADEAFFTGTAAEVTPIRELDGRTIGAGTRGPVTTKIQKLFFDVIAGKVAKHKDWLSPVNEKASSRVSREKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 2 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 4 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 5 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 6 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 7 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 8 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 9 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 10 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 11 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 12 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 13 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 14 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 15 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 16 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 17 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 18 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 19 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 20 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 21 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 84 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 87 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 88 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 120 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 186 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 187 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 188 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 189 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 194 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 196 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 207 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 223 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 224 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 225 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 226 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 227 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 290 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 297 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 298 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 299 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 300 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 301 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 302 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 303 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 304 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 305 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 306 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 308 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 333 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 345 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 349 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 350 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 351 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.17 |
| Metatranscriptomes | 0.48 |
| Isolates | 3.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.39 |
| Nodule | 0.32 |
| Rhizoplane | 2.23 |
| Rhizosphere | 89.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000516 | 3300003187 | Bacteria | 36120 |
| 2 | Ga0065712_10131402 | 3300005290 | Bacteria | 1545 |
| 3 | Ga0065715_10146804 | 3300005293 | Bacteria | 1775 |
| 4 | Ga0070658_10005401 | 3300005327 | Bacteria | 10371 |
| 5 | Ga0070658_10067962 | 3300005327 | Bacteria | 2912 |
| 6 | Ga0070658_10136018 | 3300005327 | Bacteria | 2051 |
| 7 | Ga0070683_100036866 | 3300005329 | Bacteria | 4474 |
| 8 | Ga0070683_100179863 | 3300005329 | Bacteria | 2007 |
| 9 | Ga0070690_100037193 | 3300005330 | Bacteria | 3066 |
| 10 | Ga0070690_100162491 | 3300005330 | Bacteria | 1531 |
| 11 | Ga0070666_10003225 | 3300005335 | Bacteria | 9905 |
| 12 | Ga0070680_100126865 | 3300005336 | Bacteria | 2132 |
| 13 | Ga0070682_100193864 | 3300005337 | Bacteria | 1428 |
| 14 | Ga0068868_100040558 | 3300005338 | Bacteria | 3624 |
| 15 | Ga0068868_100222258 | 3300005338 | Bacteria | 1581 |
| 16 | Ga0068868_100335263 | 3300005338 | Bacteria | 1292 |
| 17 | Ga0070660_100080497 | 3300005339 | Bacteria | 2556 |
| 18 | Ga0070660_100155664 | 3300005339 | Bacteria | 1839 |
| 19 | Ga0070689_100000002 | 3300005340 | Bacteria | 695141 |
| 20 | Ga0070687_100068831 | 3300005343 | Bacteria | 1894 |
| 21 | Ga0070671_100002165 | 3300005355 | Bacteria | 15154 |
| 22 | Ga0070671_100544467 | 3300005355 | Bacteria | 1001 |
| 23 | Ga0070688_100000414 | 3300005365 | Bacteria | 21639 |
| 24 | Ga0070659_100045031 | 3300005366 | Bacteria | 3456 |
| 25 | Ga0070667_100012039 | 3300005367 | Bacteria | 7160 |
| 26 | Ga0070709_10074167 | 3300005434 | Bacteria | 2205 |
| 27 | Ga0070714_100015455 | 3300005435 | Bacteria | 6142 |
| 28 | Ga0070714_100026067 | 3300005435 | Bacteria | 4829 |
| 29 | Ga0070714_100040552 | 3300005435 | Bacteria | 3924 |
| 30 | Ga0070714_100053819 | 3300005435 | Bacteria | 3437 |
| 31 | Ga0070713_100001176 | 3300005436 | Bacteria | 16724 |
| 32 | Ga0070713_100036705 | 3300005436 | Bacteria | 3957 |
| 33 | Ga0070713_100452149 | 3300005436 | Bacteria | 1206 |
| 34 | Ga0070710_10005850 | 3300005437 | Bacteria | 5869 |
| 35 | Ga0070710_10006053 | 3300005437 | Bacteria | 5782 |
| 36 | Ga0070710_10013499 | 3300005437 | Bacteria | 4094 |
| 37 | Ga0070711_100000696 | 3300005439 | Bacteria | 17615 |
| 38 | Ga0070711_100101318 | 3300005439 | Bacteria | 2095 |
| 39 | Ga0070694_100009079 | 3300005444 | Bacteria | 6096 |
| 40 | Ga0070694_100037526 | 3300005444 | Bacteria | 3214 |
| 41 | Ga0070694_100180368 | 3300005444 | Bacteria | 1562 |
| 42 | Ga0070663_100019603 | 3300005455 | Bacteria | 4463 |
| 43 | Ga0070678_100027528 | 3300005456 | Bacteria | 3861 |
| 44 | Ga0070678_100278098 | 3300005456 | Bacteria | 1414 |
| 45 | Ga0070662_100309808 | 3300005457 | Bacteria | 1285 |
| 46 | Ga0070681_10019793 | 3300005458 | Bacteria | 6740 |
| 47 | Ga0070681_10061415 | 3300005458 | Bacteria | 3732 |
| 48 | Ga0070681_10066867 | 3300005458 | Bacteria | 3563 |
| 49 | Ga0070681_10268538 | 3300005458 | Bacteria | 1617 |
| 50 | Ga0068867_100029179 | 3300005459 | Bacteria | 3974 |
| 51 | Ga0068867_100048854 | 3300005459 | Bacteria | 3114 |
| 52 | Ga0070685_10053565 | 3300005466 | Bacteria | 2338 |
| 53 | Ga0070698_100074104 | 3300005471 | Bacteria | 3410 |
| 54 | Ga0070679_100011258 | 3300005530 | Bacteria | 8525 |
| 55 | Ga0070684_100013793 | 3300005535 | Bacteria | 6524 |
| 56 | Ga0070684_100046695 | 3300005535 | Bacteria | 3752 |
| 57 | Ga0070697_100000387 | 3300005536 | Bacteria | 34310 |
| 58 | Ga0070697_100075256 | 3300005536 | Bacteria | 2775 |
| 59 | Ga0070697_100076954 | 3300005536 | Bacteria | 2744 |
| 60 | Ga0068853_100030959 | 3300005539 | Bacteria | 4523 |
| 61 | Ga0068853_100093308 | 3300005539 | Bacteria | 2650 |
| 62 | Ga0068853_100121269 | 3300005539 | Bacteria | 2333 |
| 63 | Ga0070686_100059500 | 3300005544 | Bacteria | 2462 |
| 64 | Ga0070686_100134337 | 3300005544 | Bacteria | 1715 |
| 65 | Ga0070695_100053841 | 3300005545 | Bacteria | 2588 |
| 66 | Ga0070696_100002413 | 3300005546 | Bacteria | 12376 |
| 67 | Ga0070696_100007006 | 3300005546 | Bacteria | 7521 |
| 68 | Ga0070696_100053156 | 3300005546 | Bacteria | 2819 |
| 69 | Ga0070696_100060640 | 3300005546 | Bacteria | 2645 |
| 70 | Ga0070693_100001757 | 3300005547 | Bacteria | 9880 |
| 71 | Ga0070693_100124204 | 3300005547 | Bacteria | 1605 |
| 72 | Ga0070665_100025205 | 3300005548 | Bacteria | 5993 |
| 73 | Ga0070704_100082574 | 3300005549 | Bacteria | 2370 |
| 74 | Ga0070704_100117310 | 3300005549 | Bacteria | 2037 |
| 75 | Ga0068855_100024894 | 3300005563 | Bacteria | 7162 |
| 76 | Ga0068855_100026030 | 3300005563 | Bacteria | 6998 |
| 77 | Ga0068855_100128167 | 3300005563 | Bacteria | 2900 |
| 78 | Ga0068855_100460578 | 3300005563 | Bacteria | 1387 |
| 79 | Ga0070664_100215209 | 3300005564 | Bacteria | 1718 |
| 80 | Ga0068857_100136792 | 3300005577 | Bacteria | 2212 |
| 81 | Ga0068854_100016671 | 3300005578 | Bacteria | 4902 |
| 82 | Ga0068856_100013711 | 3300005614 | Bacteria | 7836 |
| 83 | Ga0068856_100049933 | 3300005614 | Bacteria | 4123 |
| 84 | Ga0070702_100065759 | 3300005615 | Bacteria | 2124 |
| 85 | Ga0068852_100000554 | 3300005616 | Bacteria | 24527 |
| 86 | Ga0068852_100001905 | 3300005616 | Bacteria | 14201 |
| 87 | Ga0068852_100015681 | 3300005616 | Bacteria | 5886 |
| 88 | Ga0068852_100204595 | 3300005616 | Bacteria | 1869 |
| 89 | Ga0068864_100034288 | 3300005618 | Bacteria | 4317 |
| 90 | Ga0068866_10002901 | 3300005718 | Bacteria | 7068 |
| 91 | Ga0068861_100163944 | 3300005719 | Bacteria | 1836 |
| 92 | Ga0068851_10000229 | 3300005834 | Bacteria | 27016 |
| 93 | Ga0068851_10071717 | 3300005834 | Bacteria | 1793 |
| 94 | Ga0068870_10055741 | 3300005840 | Bacteria | 2107 |
| 95 | Ga0068858_100017245 | 3300005842 | Bacteria | 6773 |
| 96 | Ga0068858_100028590 | 3300005842 | Bacteria | 5178 |
| 97 | Ga0068858_100093425 | 3300005842 | Bacteria | 2800 |
| 98 | Ga0068860_100599073 | 3300005843 | Bacteria | 1107 |
| 99 | Ga0070717_10124226 | 3300006028 | Bacteria | 2214 |
| 100 | Ga0075368_10039954 | 3300006042 | Bacteria | 1841 |
| 101 | Ga0070715_10056243 | 3300006163 | Bacteria | 1711 |
| 102 | Ga0070715_10059385 | 3300006163 | Bacteria | 1673 |
| 103 | Ga0070716_100022575 | 3300006173 | Bacteria | 3327 |
| 104 | Ga0070716_100053803 | 3300006173 | Bacteria | 2297 |
| 105 | Ga0070712_100001651 | 3300006175 | Bacteria | 13660 |
| 106 | Ga0070712_100045826 | 3300006175 | Bacteria | 3021 |
| 107 | Ga0070712_100147136 | 3300006175 | Bacteria | 1804 |
| 108 | Ga0075369_10014439 | 3300006186 | Bacteria | 3155 |
| 109 | Ga0075366_10009881 | 3300006195 | Bacteria | 5339 |
| 110 | Ga0075366_10076709 | 3300006195 | Bacteria | 1995 |
| 111 | Ga0097621_100036037 | 3300006237 | Bacteria | 3955 |
| 112 | Ga0068871_100004374 | 3300006358 | Bacteria | 9821 |
| 113 | Ga0068871_100017486 | 3300006358 | Bacteria | 5427 |
| 114 | Ga0068871_100203600 | 3300006358 | Bacteria | 1710 |
| 115 | Ga0075428_100002905 | 3300006844 | Bacteria | 18646 |
| 116 | Ga0075428_100044527 | 3300006844 | Bacteria | 4877 |
| 117 | Ga0075430_100034651 | 3300006846 | Bacteria | 4285 |
| 118 | Ga0075430_100056974 | 3300006846 | Bacteria | 3287 |
| 119 | Ga0075431_100404571 | 3300006847 | Bacteria | 1366 |
| 120 | Ga0075433_10000110 | 3300006852 | Bacteria | 40433 |
| 121 | Ga0075433_10109726 | 3300006852 | Bacteria | 2448 |
| 122 | Ga0075433_10109950 | 3300006852 | Bacteria | 2445 |
| 123 | Ga0075434_100065115 | 3300006871 | Bacteria | 3630 |
| 124 | Ga0075434_100098714 | 3300006871 | Bacteria | 2926 |
| 125 | Ga0075434_100133112 | 3300006871 | Bacteria | 2506 |
| 126 | Ga0075429_100033171 | 3300006880 | Bacteria | 4486 |
| 127 | Ga0075429_100118416 | 3300006880 | Bacteria | 2315 |
| 128 | Ga0097620_100132747 | 3300006931 | Bacteria | 2562 |
| 129 | Ga0099795_10028029 | 3300007788 | Bacteria | 1911 |
| 130 | Ga0105240_10018674 | 3300009093 | Bacteria | 9291 |
| 131 | Ga0105240_10060469 | 3300009093 | Bacteria | 4723 |
| 132 | Ga0105240_10074744 | 3300009093 | Bacteria | 4181 |
| 133 | Ga0105240_10106295 | 3300009093 | Bacteria | 3404 |
| 134 | Ga0105240_10127435 | 3300009093 | Bacteria | 3057 |
| 135 | Ga0111539_10003499 | 3300009094 | Bacteria | 20711 |
| 136 | Ga0105245_10011124 | 3300009098 | Bacteria | 7832 |
| 137 | Ga0105245_10252393 | 3300009098 | Bacteria | 1714 |
| 138 | Ga0105247_10029850 | 3300009101 | Bacteria | 3306 |
| 139 | Ga0114129_10046541 | 3300009147 | Bacteria | 6095 |
| 140 | Ga0105243_10090156 | 3300009148 | Bacteria | 2523 |
| 141 | Ga0105241_10010136 | 3300009174 | Bacteria | 6918 |
| 142 | Ga0105241_10113850 | 3300009174 | Bacteria | 2169 |
| 143 | Ga0105242_10003813 | 3300009176 | Bacteria | 11724 |
| 144 | Ga0105242_10009597 | 3300009176 | Bacteria | 7417 |
| 145 | Ga0105242_10042004 | 3300009176 | Bacteria | 3690 |
| 146 | Ga0105248_10021630 | 3300009177 | Bacteria | 7123 |
| 147 | Ga0105237_10021527 | 3300009545 | Bacteria | 6629 |
| 148 | Ga0105237_10178560 | 3300009545 | Bacteria | 2123 |
| 149 | Ga0105237_10624609 | 3300009545 | Bacteria | 1084 |
| 150 | Ga0105238_10065776 | 3300009551 | Bacteria | 3626 |
| 151 | Ga0105238_10120614 | 3300009551 | Bacteria | 2602 |
| 152 | Ga0105238_10460445 | 3300009551 | Bacteria | 1269 |
| 153 | Ga0105239_10086834 | 3300010375 | Bacteria | 3448 |
| 154 | Ga0105239_10163494 | 3300010375 | Bacteria | 2488 |
| 155 | Ga0105239_10175387 | 3300010375 | Bacteria | 2397 |
| 156 | Ga0105246_10038730 | 3300011119 | Bacteria | 3207 |
| 157 | Ga0157373_10035289 | 3300013100 | Bacteria | 3591 |
| 158 | Ga0157373_10298022 | 3300013100 | Bacteria | 1144 |
| 159 | Ga0157371_10019530 | 3300013102 | Bacteria | 4995 |
| 160 | Ga0157371_10131682 | 3300013102 | Bacteria | 1779 |
| 161 | Ga0157370_10002509 | 3300013104 | Bacteria | 22106 |
| 162 | Ga0157370_10019075 | 3300013104 | Bacteria | 6893 |
| 163 | Ga0157370_10029259 | 3300013104 | Bacteria | 5410 |
| 164 | Ga0157370_10032996 | 3300013104 | Bacteria | 5050 |
| 165 | Ga0157369_10000904 | 3300013105 | Bacteria | 37886 |
| 166 | Ga0157369_10044093 | 3300013105 | Bacteria | 4857 |
| 167 | Ga0157369_10245566 | 3300013105 | Bacteria | 1869 |
| 168 | Ga0157369_10652329 | 3300013105 | Bacteria | 1085 |
| 169 | Ga0157374_10035131 | 3300013296 | Bacteria | 4584 |
| 170 | Ga0163162_10125806 | 3300013306 | Bacteria | 2669 |
| 171 | Ga0163162_10148202 | 3300013306 | Bacteria | 2463 |
| 172 | Ga0163162_10264232 | 3300013306 | Bacteria | 1852 |
| 173 | Ga0157372_10010371 | 3300013307 | Bacteria | 9906 |
| 174 | Ga0157372_10122441 | 3300013307 | Bacteria | 2989 |
| 175 | Ga0157372_10224221 | 3300013307 | Bacteria | 2179 |
| 176 | Ga0157372_10358302 | 3300013307 | Bacteria | 1699 |
| 177 | Ga0157372_10417913 | 3300013307 | Bacteria | 1563 |
| 178 | Ga0157372_10437194 | 3300013307 | Bacteria | 1525 |
| 179 | Ga0157372_10634745 | 3300013307 | Bacteria | 1244 |
| 180 | Ga0157375_10042981 | 3300013308 | Bacteria | 4378 |
| 181 | Ga0157375_10482650 | 3300013308 | Bacteria | 1404 |
| 182 | Ga0163163_10013714 | 3300014325 | Bacteria | 7426 |
| 183 | Ga0163163_10038793 | 3300014325 | Bacteria | 4644 |
| 184 | Ga0157380_10146563 | 3300014326 | Bacteria | 2035 |
| 185 | Ga0182008_10079861 | 3300014497 | Bacteria | 1609 |
| 186 | Ga0157377_10007044 | 3300014745 | Bacteria | 5400 |
| 187 | Ga0157379_10018386 | 3300014968 | Bacteria | 6162 |
| 188 | Ga0157379_10040838 | 3300014968 | Bacteria | 4141 |
| 189 | Ga0157379_10089553 | 3300014968 | Bacteria | 2760 |
| 190 | Ga0157379_10103232 | 3300014968 | Bacteria | 2558 |
| 191 | Ga0157376_10291370 | 3300014969 | Bacteria | 1541 |
| 192 | Ga0157376_10643190 | 3300014969 | Bacteria | 1060 |
| 193 | Ga0163161_10079877 | 3300017792 | Bacteria | 2406 |
| 194 | Ga0206354_10773014 | 3300020081 | Bacteria | 2302 |
| 195 | Ga0154015_1545361 | 3300020610 | Bacteria | 957 |
| 196 | Ga0209258_101933 | 3300025242 | Bacteria | 6083 |
| 197 | Ga0209455_1000420 | 3300025272 | Bacteria | 33306 |
| 198 | Ga0209676_1016081 | 3300025292 | Bacteria | 2722 |
| 199 | Ga0209025_1000141 | 3300025294 | Bacteria | 184281 |
| 200 | Ga0209050_1002420 | 3300025298 | Bacteria | 16080 |
| 201 | Ga0207656_10004971 | 3300025321 | Bacteria | 4670 |
| 202 | Ga0207656_10007459 | 3300025321 | Bacteria | 3983 |
| 203 | Ga0207656_10037209 | 3300025321 | Bacteria | 2046 |
| 204 | Ga0207692_10060325 | 3300025898 | Bacteria | 1961 |
| 205 | Ga0207680_10005277 | 3300025903 | Bacteria | 6166 |
| 206 | Ga0207685_10008765 | 3300025905 | Bacteria | 2901 |
| 207 | Ga0207699_10010741 | 3300025906 | Bacteria | 4606 |
| 208 | Ga0207705_10094166 | 3300025909 | Bacteria | 2196 |
| 209 | Ga0207705_10115974 | 3300025909 | Bacteria | 1982 |
| 210 | Ga0207705_10121753 | 3300025909 | Bacteria | 1936 |
| 211 | Ga0207654_10085962 | 3300025911 | Bacteria | 1905 |
| 212 | Ga0207707_10005992 | 3300025912 | Bacteria | 10640 |
| 213 | Ga0207707_10034568 | 3300025912 | Bacteria | 4422 |
| 214 | Ga0207707_10110746 | 3300025912 | Bacteria | 2400 |
| 215 | Ga0207707_10113913 | 3300025912 | Bacteria | 2363 |
| 216 | Ga0207707_10209873 | 3300025912 | Bacteria | 1697 |
| 217 | Ga0207695_10062423 | 3300025913 | Bacteria | 3847 |
| 218 | Ga0207695_10077004 | 3300025913 | Bacteria | 3389 |
| 219 | Ga0207695_10116851 | 3300025913 | Bacteria | 2641 |
| 220 | Ga0207695_10207195 | 3300025913 | Bacteria | 1873 |
| 221 | Ga0207695_10255703 | 3300025913 | Bacteria | 1650 |
| 222 | Ga0207671_10332711 | 3300025914 | Bacteria | 1203 |
| 223 | Ga0207693_10000449 | 3300025915 | Bacteria | 37683 |
| 224 | Ga0207693_10090350 | 3300025915 | Bacteria | 2401 |
| 225 | Ga0207663_10003365 | 3300025916 | Bacteria | 7814 |
| 226 | Ga0207663_10228616 | 3300025916 | Bacteria | 1358 |
| 227 | Ga0207660_10094245 | 3300025917 | Bacteria | 2225 |
| 228 | Ga0207662_10070888 | 3300025918 | Bacteria | 2109 |
| 229 | Ga0207662_10094126 | 3300025918 | Bacteria | 1847 |
| 230 | Ga0207657_10000297 | 3300025919 | Bacteria | 52991 |
| 231 | Ga0207649_10029443 | 3300025920 | Bacteria | 3242 |
| 232 | Ga0207649_10044989 | 3300025920 | Bacteria | 2704 |
| 233 | Ga0207649_10144487 | 3300025920 | Bacteria | 1631 |
| 234 | Ga0207652_10045918 | 3300025921 | Bacteria | 3725 |
| 235 | Ga0207652_10123772 | 3300025921 | Bacteria | 2302 |
| 236 | Ga0207652_10350467 | 3300025921 | Bacteria | 1332 |
| 237 | Ga0207694_10033000 | 3300025924 | Bacteria | 3965 |
| 238 | Ga0207650_10020902 | 3300025925 | Bacteria | 4624 |
| 239 | Ga0207687_10005787 | 3300025927 | Bacteria | 8182 |
| 240 | Ga0207687_10019194 | 3300025927 | Bacteria | 4527 |
| 241 | Ga0207687_10068842 | 3300025927 | Bacteria | 2522 |
| 242 | Ga0207700_10012513 | 3300025928 | Bacteria | 5476 |
| 243 | Ga0207700_10326538 | 3300025928 | Bacteria | 1331 |
| 244 | Ga0207700_10387906 | 3300025928 | Bacteria | 1222 |
| 245 | Ga0207664_10014931 | 3300025929 | Bacteria | 5623 |
| 246 | Ga0207664_10027283 | 3300025929 | Bacteria | 4327 |
| 247 | Ga0207664_10028558 | 3300025929 | Bacteria | 4240 |
| 248 | Ga0207664_10035835 | 3300025929 | Bacteria | 3831 |
| 249 | Ga0207664_10036315 | 3300025929 | Bacteria | 3808 |
| 250 | Ga0207690_10090593 | 3300025932 | Bacteria | 2159 |
| 251 | Ga0207690_10164364 | 3300025932 | Bacteria | 1657 |
| 252 | Ga0207706_10043412 | 3300025933 | Bacteria | 3984 |
| 253 | Ga0207686_10000474 | 3300025934 | Bacteria | 26589 |
| 254 | Ga0207686_10008745 | 3300025934 | Bacteria | 5470 |
| 255 | Ga0207709_10188392 | 3300025935 | Bacteria | 1463 |
| 256 | Ga0207670_10000001 | 3300025936 | Bacteria | 949312 |
| 257 | Ga0207665_10004123 | 3300025939 | Bacteria | 9694 |
| 258 | Ga0207665_10014728 | 3300025939 | Bacteria | 5143 |
| 259 | Ga0207711_10002490 | 3300025941 | Bacteria | 16440 |
| 260 | Ga0207689_10041855 | 3300025942 | Bacteria | 3790 |
| 261 | Ga0207661_10088947 | 3300025944 | Bacteria | 2568 |
| 262 | Ga0207661_10228401 | 3300025944 | Bacteria | 1647 |
| 263 | Ga0207679_10156516 | 3300025945 | Bacteria | 1861 |
| 264 | Ga0207667_10013735 | 3300025949 | Bacteria | 9255 |
| 265 | Ga0207667_10023013 | 3300025949 | Bacteria | 6867 |
| 266 | Ga0207667_10031080 | 3300025949 | Bacteria | 5768 |
| 267 | Ga0207667_10099563 | 3300025949 | Bacteria | 2999 |
| 268 | Ga0207667_10114860 | 3300025949 | Bacteria | 2775 |
| 269 | Ga0207667_10288493 | 3300025949 | Bacteria | 1677 |
| 270 | Ga0207651_10007117 | 3300025960 | Bacteria | 5940 |
| 271 | Ga0207651_10080227 | 3300025960 | Bacteria | 2348 |
| 272 | Ga0207658_10087484 | 3300025986 | Bacteria | 2406 |
| 273 | Ga0207677_10009935 | 3300026023 | Bacteria | 5366 |
| 274 | Ga0207703_10007141 | 3300026035 | Bacteria | 8887 |
| 275 | Ga0207703_10058212 | 3300026035 | Bacteria | 3153 |
| 276 | Ga0207639_10044835 | 3300026041 | Bacteria | 3328 |
| 277 | Ga0207639_10112617 | 3300026041 | Bacteria | 2221 |
| 278 | Ga0207639_10318047 | 3300026041 | Bacteria | 1381 |
| 279 | Ga0207639_10411903 | 3300026041 | Bacteria | 1220 |
| 280 | Ga0207678_10012275 | 3300026067 | Bacteria | 7522 |
| 281 | Ga0207702_10022087 | 3300026078 | Bacteria | 5272 |
| 282 | Ga0207702_10118288 | 3300026078 | Bacteria | 2367 |
| 283 | Ga0207702_10186557 | 3300026078 | Bacteria | 1913 |
| 284 | Ga0207641_10015550 | 3300026088 | Bacteria | 6235 |
| 285 | Ga0207648_10090444 | 3300026089 | Bacteria | 2674 |
| 286 | Ga0207648_10124429 | 3300026089 | Bacteria | 2268 |
| 287 | Ga0207676_10025612 | 3300026095 | Bacteria | 4377 |
| 288 | Ga0207674_10000396 | 3300026116 | Bacteria | 56376 |
| 289 | Ga0207674_10018103 | 3300026116 | Bacteria | 7666 |
| 290 | Ga0207674_10123583 | 3300026116 | Bacteria | 2554 |
| 291 | Ga0207675_100075163 | 3300026118 | Bacteria | 3162 |
| 292 | Ga0207675_100502022 | 3300026118 | Bacteria | 1208 |
| 293 | Ga0207683_10001287 | 3300026121 | Bacteria | 22701 |
| 294 | Ga0207683_10214645 | 3300026121 | Bacteria | 1752 |
| 295 | Ga0207698_10003759 | 3300026142 | Bacteria | 9176 |
| 296 | Ga0207698_10043816 | 3300026142 | Bacteria | 3356 |
| 297 | Ga0207698_10135461 | 3300026142 | Bacteria | 2112 |
| 298 | Ga0209984_1011203 | 3300027424 | Bacteria | 1159 |
| 299 | Ga0210000_1010652 | 3300027462 | Bacteria | 1360 |
| 300 | Ga0209983_1008059 | 3300027665 | Bacteria | 2154 |
| 301 | Ga0209974_10001325 | 3300027876 | Bacteria | 8896 |
| 302 | Ga0207428_10004905 | 3300027907 | Bacteria | 12607 |
| 303 | Ga0207428_10005350 | 3300027907 | Bacteria | 11971 |
| 304 | Ga0268266_10041082 | 3300028379 | Bacteria | 3944 |
| 305 | Ga0268265_10281681 | 3300028380 | Bacteria | 1488 |
| 306 | Ga0268264_10033840 | 3300028381 | Bacteria | 4201 |
| 307 | Ga0268264_10509306 | 3300028381 | Bacteria | 1175 |
| 308 | Ga0307511_10000164 | 3300030521 | Bacteria | 64605 |
| 309 | Ga0265332_10000004 | 3300031238 | Bacteria | 426592 |
| 310 | Ga0265332_10021756 | 3300031238 | Bacteria | 2831 |
| 311 | Ga0265325_10025196 | 3300031241 | Bacteria | 3231 |
| 312 | Ga0265327_10028560 | 3300031251 | Bacteria | 3188 |
| 313 | Ga0265327_10052087 | 3300031251 | Bacteria | 2133 |
| 314 | Ga0265316_10071091 | 3300031344 | Bacteria | 2683 |
| 315 | Ga0307408_100079001 | 3300031548 | Bacteria | 2454 |
| 316 | Ga0307408_100095572 | 3300031548 | Bacteria | 2253 |
| 317 | Ga0307408_100184031 | 3300031548 | Bacteria | 1678 |
| 318 | Ga0307508_10049204 | 3300031616 | Bacteria | 3754 |
| 319 | Ga0316575_10054877 | 3300031665 | Bacteria | 1586 |
| 320 | Ga0307413_10232493 | 3300031824 | Bacteria | 1355 |
| 321 | Ga0307412_10000148 | 3300031911 | Bacteria | 50533 |
| 322 | Ga0307416_100077509 | 3300032002 | Bacteria | 2792 |
| 323 | Ga0307416_100665530 | 3300032002 | Bacteria | 1127 |
| 324 | Ga0307414_10045164 | 3300032004 | Bacteria | 3015 |
| 325 | Ga0307414_10235851 | 3300032004 | Bacteria | 1511 |
| 326 | Ga0316583_10000345 | 3300032133 | Bacteria | 13267 |
| 327 | Ga0316583_10010803 | 3300032133 | Bacteria | 3289 |
| 328 | Ga0316593_10019538 | 3300032168 | Bacteria | 2095 |
| 329 | Ga0307507_10039851 | 3300033179 | Bacteria | 4732 |
| 330 | Ga0373958_0011459 | 3300034819 | Bacteria | 1499 |
| 331 | Ga0373934_0003046 | 3300035086 | Bacteria | 6121 |
| 332 | Ga0373936_0001904 | 3300035113 | Bacteria | 7700 |
| 333 | Ga0373941_0018556 | 3300035115 | Bacteria | 1924 |
| 334 | Ga0373954_0004840 | 3300035118 | Bacteria | 5808 |
| 335 | Ga0373954_0016592 | 3300035118 | Bacteria | 3298 |
| 336 | Ga0373956_0000103 | 3300035119 | Bacteria | 29146 |
| 337 | Ga0373956_0017262 | 3300035119 | Bacteria | 3040 |
| 338 | Ga0373957_0002129 | 3300035120 | Bacteria | 5569 |
| 339 | Ga0373943_0007528 | 3300035170 | Bacteria | 4891 |
| 340 | Ga0373943_0044243 | 3300035170 | Bacteria | 2166 |
| 341 | Ga0373955_0002776 | 3300035172 | Bacteria | 7684 |
| 342 | Ga0373955_0010947 | 3300035172 | Bacteria | 4306 |
| 343 | Ga0373955_0012200 | 3300035172 | Bacteria | 4125 |
| 344 | Ga0373961_0005558 | 3300035241 | Bacteria | 3029 |
| 345 | Ga0316574_0053217 | 3300035398 | Bacteria | 2526 |
| 346 | Ga0316574_0221173 | 3300035398 | Bacteria | 1213 |
| 347 | Ga0373924_0001467 | 3300035410 | Bacteria | 7666 |
| 348 | Ga0373924_0011127 | 3300035410 | Bacteria | 3334 |
| 349 | Ga0373924_0099455 | 3300035410 | Bacteria | 1250 |
| 350 | Ga0373931_0054923 | 3300035691 | Bacteria | 2130 |
| 351 | Ga0373935_0321894 | 3300035692 | Bacteria | 1097 |
| 352 | Ga0373927_0032817 | 3300035695 | Bacteria | 3381 |
| 353 | Ga0373933_0017604 | 3300035724 | Bacteria | 4009 |
| 354 | Ga0373933_0020378 | 3300035724 | Bacteria | 3758 |
| 355 | Ga0373933_0050711 | 3300035724 | Bacteria | 2478 |
| 356 | Ga0373933_0353750 | 3300035724 | Bacteria | 954 |
| 357 | Ga0373947_0002381 | 3300035725 | Bacteria | 11355 |
| 358 | Ga0373947_0018747 | 3300035725 | Bacteria | 3985 |
| 359 | Ga0373937_0005811 | 3300036401 | Bacteria | 10609 |
| 360 | Ga0373937_0006490 | 3300036401 | Bacteria | 10091 |
| 361 | Ga0373937_0010340 | 3300036401 | Bacteria | 8146 |
| 362 | Ga0373937_0033702 | 3300036401 | Bacteria | 4653 |
| 363 | Ga0316582_0011326 | 3300036647 | Bacteria | 4925 |
| 364 | Ga0373925_0073259 | 3300037068 | Bacteria | 2592 |
| 365 | Ga0373925_0188574 | 3300037068 | Bacteria | 1635 |
| 366 | Ga0395900_0002375 | 3300037418 | Bacteria | 20809 |
| 367 | Ga0395905_0078422 | 3300037471 | Bacteria | 3096 |
| 368 | Ga0316581_0077521 | 3300037588 | Bacteria | 1021 |
| 369 | Ga0436364_0438780 | 3300037853 | Bacteria | 1217 |
| 370 | Ga0395901_0051673 | 3300038443 | Bacteria | 4274 |
| 371 | Ga0395901_0086884 | 3300038443 | Bacteria | 3270 |
| 372 | Ga0395901_0141348 | 3300038443 | Bacteria | 2530 |
| 373 | Ga0436361_1111140 | 3300039447 | Bacteria | 1445 |
| 374 | Ga0451577_0003501 | 3300042876 | Bacteria | 17443 |
| 375 | Ga0451577_0003515 | 3300042876 | Bacteria | 17370 |
| 376 | Ga0451577_0004085 | 3300042876 | Bacteria | 15684 |
| 377 | Ga0451577_0013830 | 3300042876 | Bacteria | 7539 |
| 378 | Ga0451577_0037150 | 3300042876 | Bacteria | 4385 |
| 379 | Ga0451577_0201804 | 3300042876 | Bacteria | 1795 |
| 380 | Ga0451577_0256684 | 3300042876 | Bacteria | 1583 |
| 381 | Ga0453683_0018786 | 3300044673 | Bacteria | 4435 |
| 382 | Ga0466966_0153162 | 3300044684 | Bacteria | 1405 |
| 383 | Ga0466963_0025591 | 3300044694 | Bacteria | 3766 |
| 384 | Ga0453684_0000065 | 3300044712 | Bacteria | 468481 |
| 385 | Ga0453684_0001131 | 3300044712 | Bacteria | 83523 |
| 386 | Ga0453684_0001181 | 3300044712 | Bacteria | 80955 |
| 387 | Ga0453684_0001452 | 3300044712 | Bacteria | 67372 |
| 388 | Ga0453684_0003292 | 3300044712 | Bacteria | 36816 |
| 389 | Ga0453684_0009602 | 3300044712 | Bacteria | 16876 |
| 390 | Ga0453684_0010067 | 3300044712 | Bacteria | 16251 |
| 391 | Ga0453684_0058382 | 3300044712 | Bacteria | 4984 |
| 392 | Ga0453684_0105893 | 3300044712 | Bacteria | 3429 |
| 393 | Ga0466971_0064903 | 3300044719 | Bacteria | 1653 |
| 394 | Ga0451576_0000335 | 3300045051 | Bacteria | 113806 |
| 395 | Ga0451576_0000526 | 3300045051 | Bacteria | 83427 |
| 396 | Ga0451576_0001979 | 3300045051 | Bacteria | 32546 |
| 397 | Ga0451576_0028559 | 3300045051 | Bacteria | 5972 |
| 398 | Ga0451576_0036754 | 3300045051 | Bacteria | 5190 |
| 399 | Ga0451576_0056353 | 3300045051 | Bacteria | 4110 |
| 400 | Ga0451576_0062696 | 3300045051 | Bacteria | 3875 |
| 401 | Ga0466958_0118908 | 3300045836 | Bacteria | 1653 |
| 402 | Ga0466967_0014124 | 3300045976 | Bacteria | 6205 |
| 403 | Ga0495592_0001049 | 3300046454 | Bacteria | 19178 |
| 404 | Ga0495592_0084947 | 3300046454 | Bacteria | 2282 |
| 405 | Ga0495592_0095526 | 3300046454 | Bacteria | 2126 |
| 406 | Ga0495590_0020783 | 3300046457 | Bacteria | 2330 |
| 407 | Ga0495629_0015666 | 3300046459 | Bacteria | 5443 |
| 408 | Ga0495638_0018489 | 3300046460 | Bacteria | 4627 |
| 409 | Ga0495641_0001109 | 3300046461 | Bacteria | 23172 |
| 410 | Ga0495641_0071068 | 3300046461 | Bacteria | 1563 |
| 411 | Ga0495651_0001335 | 3300046462 | Bacteria | 19115 |
| 412 | Ga0495651_0008602 | 3300046462 | Bacteria | 7823 |
| 413 | Ga0495651_0081151 | 3300046462 | Bacteria | 2449 |
| 414 | Ga0495653_0005924 | 3300046463 | Bacteria | 10007 |
| 415 | Ga0495653_0029699 | 3300046463 | Bacteria | 4360 |
| 416 | Ga0495653_0060736 | 3300046463 | Bacteria | 2863 |
| 417 | Ga0495653_0188121 | 3300046463 | Bacteria | 1411 |
| 418 | Ga0495650_0001345 | 3300046471 | Bacteria | 24481 |
| 419 | Ga0495650_0005814 | 3300046471 | Bacteria | 7865 |
| 420 | Ga0495580_0000419 | 3300046472 | Bacteria | 35257 |
| 421 | Ga0495580_0044957 | 3300046472 | Bacteria | 3138 |
| 422 | Ga0495580_0078136 | 3300046472 | Bacteria | 2308 |
| 423 | Ga0495580_0139893 | 3300046472 | Bacteria | 1678 |
| 424 | Ga0495582_0155665 | 3300046473 | Bacteria | 1298 |
| 425 | Ga0495605_0001689 | 3300046474 | Bacteria | 14177 |
| 426 | Ga0495639_0039475 | 3300046475 | Bacteria | 2123 |
| 427 | Ga0495662_0016429 | 3300046476 | Bacteria | 3585 |
| 428 | Ga0495594_0016852 | 3300046499 | Bacteria | 3854 |
| 429 | Ga0495606_0010357 | 3300046507 | Bacteria | 7747 |
| 430 | Ga0495608_0025886 | 3300046511 | Bacteria | 4004 |
| 431 | Ga0495608_0041098 | 3300046511 | Bacteria | 3096 |
| 432 | Ga0495620_0008826 | 3300046515 | Bacteria | 5392 |
| 433 | Ga0495628_0028030 | 3300046516 | Bacteria | 4580 |
| 434 | Ga0495628_0028451 | 3300046516 | Bacteria | 4541 |
| 435 | Ga0495628_0035453 | 3300046516 | Bacteria | 4008 |
| 436 | Ga0495628_0067801 | 3300046516 | Bacteria | 2785 |
| 437 | Ga0495628_0106034 | 3300046516 | Bacteria | 2165 |
| 438 | Ga0495630_0001348 | 3300046517 | Bacteria | 16880 |
| 439 | Ga0495630_0015929 | 3300046517 | Bacteria | 5495 |
| 440 | Ga0495666_0000965 | 3300046526 | Bacteria | 13585 |
| 441 | Ga0495666_0005962 | 3300046526 | Bacteria | 6144 |
| 442 | Ga0495666_0045685 | 3300046526 | Bacteria | 2112 |
| 443 | Ga0495642_0036410 | 3300046528 | Bacteria | 1989 |
| 444 | Ga0495652_0082592 | 3300046529 | Bacteria | 2647 |
| 445 | Ga0495652_0118386 | 3300046529 | Bacteria | 2117 |
| 446 | Ga0495665_0023624 | 3300046531 | Bacteria | 3302 |
| 447 | Ga0495586_0007778 | 3300046535 | Bacteria | 5714 |
| 448 | Ga0495587_0016844 | 3300046536 | Bacteria | 4545 |
| 449 | Ga0495621_0002360 | 3300046539 | Bacteria | 5077 |
| 450 | Ga0495645_0000056 | 3300046543 | Bacteria | 81955 |
| 451 | Ga0495645_0000842 | 3300046543 | Bacteria | 20871 |
| 452 | Ga0495667_0004484 | 3300046559 | Bacteria | 9419 |
| 453 | Ga0495667_0040464 | 3300046559 | Bacteria | 3095 |
| 454 | Ga0495611_0005417 | 3300046648 | Bacteria | 5455 |
| 455 | Ga0495625_0063884 | 3300046660 | Bacteria | 2599 |
| 456 | Ga0495635_0025265 | 3300046663 | Bacteria | 4137 |
| 457 | Ga0495635_0028419 | 3300046663 | Bacteria | 3887 |
| 458 | Ga0495657_0034293 | 3300046675 | Bacteria | 3526 |
| 459 | Ga0495657_0072632 | 3300046675 | Bacteria | 2243 |
| 460 | Ga0495599_0000353 | 3300046678 | Bacteria | 27136 |
| 461 | Ga0495599_0002751 | 3300046678 | Bacteria | 10260 |
| 462 | Ga0495599_0013228 | 3300046678 | Bacteria | 5098 |
| 463 | Ga0495599_0028664 | 3300046678 | Bacteria | 3488 |
| 464 | Ga0495599_0078578 | 3300046678 | Bacteria | 2060 |
| 465 | Ga0495623_0001978 | 3300046679 | Bacteria | 13755 |
| 466 | Ga0495623_0008799 | 3300046679 | Bacteria | 6551 |
| 467 | Ga0495623_0011173 | 3300046679 | Bacteria | 5809 |
| 468 | Ga0495646_0103734 | 3300046680 | Bacteria | 1627 |
| 469 | Ga0495647_0000531 | 3300046681 | Bacteria | 11170 |
| 470 | Ga0495613_0020205 | 3300046689 | Bacteria | 4963 |
| 471 | Ga0495613_0080741 | 3300046689 | Bacteria | 2363 |
| 472 | Ga0495624_0000385 | 3300046690 | Bacteria | 35142 |
| 473 | Ga0495624_0000446 | 3300046690 | Bacteria | 32513 |
| 474 | Ga0495624_0026061 | 3300046690 | Bacteria | 3833 |
| 475 | Ga0495624_0251198 | 3300046690 | Bacteria | 1069 |
| 476 | Ga0495649_0047648 | 3300046694 | Bacteria | 2330 |
| 477 | Ga0495600_0000226 | 3300046809 | Bacteria | 31185 |
| 478 | Ga0495600_0065028 | 3300046809 | Bacteria | 2384 |
| 479 | Ga0495581_0050005 | 3300047315 | Bacteria | 2414 |
| 480 | Ga0495581_0161188 | 3300047315 | Bacteria | 1311 |
| 481 | Ga0495604_0001989 | 3300047317 | Bacteria | 16502 |
| 482 | Ga0495604_0039780 | 3300047317 | Bacteria | 3694 |
| 483 | Ga0495636_0083394 | 3300047318 | Bacteria | 1379 |
| 484 | Ga0495674_0005107 | 3300047319 | Bacteria | 12607 |
| 485 | Ga0495674_0352900 | 3300047319 | Bacteria | 1194 |
| 486 | Ga0495676_0093467 | 3300047321 | Bacteria | 2243 |
| 487 | Ga0495680_0005058 | 3300047322 | Bacteria | 12448 |
| 488 | Ga0495680_0029215 | 3300047322 | Bacteria | 4515 |
| 489 | Ga0495683_0067986 | 3300047323 | Bacteria | 1753 |
| 490 | Ga0495687_072736 | 3300047443 | Bacteria | 1372 |
| 491 | Ga0495675_0016416 | 3300047444 | Bacteria | 4683 |
| 492 | Ga0495675_0055961 | 3300047444 | Bacteria | 2501 |
| 493 | Ga0495675_0141319 | 3300047444 | Bacteria | 1492 |
| 494 | Ga0495679_000048 | 3300047446 | Bacteria | 127785 |
| 495 | Ga0495684_0088090 | 3300047471 | Bacteria | 2352 |
| 496 | Ga0495684_0266210 | 3300047471 | Bacteria | 1242 |
| 497 | Ga0495593_0010083 | 3300047673 | Bacteria | 5469 |
| 498 | Ga0495602_0005553 | 3300048088 | Bacteria | 13231 |
| 499 | Ga0495626_0027564 | 3300048091 | Bacteria | 2762 |
| 500 | Ga0496101_0023939 | 3300048904 | Bacteria | 4222 |
| 501 | Ga0496104_0011562 | 3300048907 | Bacteria | 7909 |
| 502 | Ga0496105_0004299 | 3300048908 | Bacteria | 10726 |
| 503 | Ga0496106_0080556 | 3300048909 | Bacteria | 2501 |
| 504 | Ga0496107_0037372 | 3300048910 | Bacteria | 3484 |
| 505 | Ga0496108_0372878 | 3300048911 | Bacteria | 1246 |
| 506 | Ga0496109_0071342 | 3300048912 | Bacteria | 3189 |
| 507 | Ga0496110_0305668 | 3300048913 | Bacteria | 1449 |
| 508 | Ga0496112_0001563 | 3300048915 | Bacteria | 17685 |
| 509 | Ga0496112_0247295 | 3300048915 | Bacteria | 1735 |
| 510 | Ga0496114_0021269 | 3300048917 | Bacteria | 5276 |
| 511 | Ga0496114_0031136 | 3300048917 | Bacteria | 4389 |
| 512 | Ga0496115_0125610 | 3300048918 | Bacteria | 2113 |
| 513 | Ga0496116_0013153 | 3300048919 | Bacteria | 6697 |
| 514 | Ga0496117_0022126 | 3300048920 | Bacteria | 5107 |
| 515 | Ga0496117_0044020 | 3300048920 | Bacteria | 3237 |
| 516 | Ga0496118_0029133 | 3300048921 | Bacteria | 4636 |
| 517 | Ga0496118_0067713 | 3300048921 | Bacteria | 2597 |
| 518 | Ga0496120_0040401 | 3300048923 | Bacteria | 2741 |
| 519 | Ga0496121_0000157 | 3300048924 | Bacteria | 149289 |
| 520 | Ga0496121_0006213 | 3300048924 | Bacteria | 14971 |
| 521 | Ga0496121_0049065 | 3300048924 | Bacteria | 3585 |
| 522 | Ga0496122_0000330 | 3300048925 | Bacteria | 102646 |
| 523 | Ga0496122_0092372 | 3300048925 | Bacteria | 2057 |
| 524 | Ga0496123_0000449 | 3300048926 | Bacteria | 73718 |
| 525 | Ga0496124_0077161 | 3300048927 | Bacteria | 2748 |
| 526 | Ga0496125_0000028 | 3300048928 | Bacteria | 387222 |
| 527 | Ga0496125_0020130 | 3300048928 | Bacteria | 6273 |
| 528 | Ga0496125_0027602 | 3300048928 | Bacteria | 5143 |
| 529 | Ga0496126_0086776 | 3300048929 | Bacteria | 2758 |
| 530 | Ga0496126_0344927 | 3300048929 | Bacteria | 1219 |
| 531 | Ga0495678_010827 | 3300049459 | Bacteria | 4404 |
| 532 | Ga0501290_005461 | 3300049513 | Bacteria | 1587 |
| 533 | Ga0501300_015448 | 3300049523 | Bacteria | 1115 |
| 534 | Ga0501031_0000981 | 3300049568 | Bacteria | 17341 |
| 535 | Ga0501032_0001882 | 3300049569 | Bacteria | 16578 |
| 536 | Ga0501033_0007174 | 3300049570 | Bacteria | 8696 |
| 537 | Ga0501033_0016074 | 3300049570 | Bacteria | 5667 |
| 538 | Ga0501034_0028036 | 3300049571 | Bacteria | 5727 |
| 539 | Ga0501034_0060115 | 3300049571 | Bacteria | 3817 |
| 540 | Ga0501034_0060213 | 3300049571 | Bacteria | 3814 |
| 541 | Ga0501036_0000457 | 3300049572 | Bacteria | 29187 |
| 542 | Ga0501037_0004620 | 3300049573 | Bacteria | 10011 |
| 543 | Ga0501037_0021935 | 3300049573 | Bacteria | 4727 |
| 544 | Ga0501037_0167328 | 3300049573 | Bacteria | 1564 |
| 545 | Ga0501038_0002486 | 3300049574 | Bacteria | 17145 |
| 546 | Ga0501038_0187165 | 3300049574 | Bacteria | 1668 |
| 547 | Ga0501041_0112393 | 3300049577 | Bacteria | 1690 |
| 548 | Ga0501043_0001931 | 3300049579 | Bacteria | 17749 |
| 549 | Ga0501043_0206543 | 3300049579 | Bacteria | 1523 |
| 550 | Ga0501046_0011855 | 3300049580 | Bacteria | 7440 |
| 551 | Ga0501046_0045786 | 3300049580 | Bacteria | 3474 |
| 552 | Ga0501047_0003333 | 3300049581 | Bacteria | 15218 |
| 553 | Ga0501047_0005185 | 3300049581 | Bacteria | 12232 |
| 554 | Ga0501047_0117809 | 3300049581 | Bacteria | 2537 |
| 555 | Ga0501048_0138571 | 3300049582 | Bacteria | 1720 |
| 556 | Ga0501069_0000469 | 3300049585 | Bacteria | 18414 |
| 557 | Ga0501070_0000531 | 3300049586 | Bacteria | 35043 |
| 558 | Ga0501071_0001663 | 3300049587 | Bacteria | 13042 |
| 559 | Ga0501073_0005354 | 3300049589 | Bacteria | 9622 |
| 560 | Ga0501073_0153081 | 3300049589 | Bacteria | 1598 |
| 561 | Ga0501074_0004628 | 3300049590 | Bacteria | 9850 |
| 562 | Ga0501075_0434884 | 3300049591 | Bacteria | 1001 |
| 563 | Ga0501076_0023409 | 3300049592 | Bacteria | 4762 |
| 564 | Ga0501076_0258499 | 3300049592 | Bacteria | 1425 |
| 565 | Ga0501079_0026598 | 3300049741 | Bacteria | 4435 |
| 566 | Ga0501080_0003248 | 3300049742 | Bacteria | 14342 |
| 567 | Ga0501080_0028302 | 3300049742 | Bacteria | 5212 |
| 568 | Ga0501081_0006141 | 3300049743 | Bacteria | 7785 |
| 569 | Ga0501081_0281314 | 3300049743 | Bacteria | 1218 |
| 570 | Ga0501083_0001601 | 3300049744 | Bacteria | 15480 |
| 571 | Ga0501280_000307 | 3300049776 | Bacteria | 12329 |
| 572 | Ga0501035_0000848 | 3300049822 | Bacteria | 32689 |
| 573 | Ga0501035_0007523 | 3300049822 | Bacteria | 10179 |
| 574 | Ga0501035_0015273 | 3300049822 | Bacteria | 7086 |
| 575 | Ga0501035_0016321 | 3300049822 | Bacteria | 6851 |
| 576 | Ga0501044_0000336 | 3300049823 | Bacteria | 59417 |
| 577 | Ga0501044_0002803 | 3300049823 | Bacteria | 19864 |
| 578 | Ga0501044_0006254 | 3300049823 | Bacteria | 13164 |
| 579 | Ga0501044_0027660 | 3300049823 | Bacteria | 5987 |
| 580 | Ga0501044_0337351 | 3300049823 | Bacteria | 1429 |
| 581 | nmdc:mga0k408_43245_c1 | 3300050493 | Bacteria | 2595 |
| 582 | nmdc:mga05p37_1696_c1 | 3300050507 | Bacteria | 25667 |
| 583 | nmdc:mga09592_112397_c1 | 3300050508 | Bacteria | 2337 |
| 584 | nmdc:mga09592_414747_c1 | 3300050508 | Bacteria | 1163 |
| 585 | nmdc:mga09592_432_c1 | 3300050508 | Bacteria | 30841 |
| 586 | nmdc:mga0qj67_7099_c1 | 3300050509 | Bacteria | 8263 |
| 587 | nmdc:mga08y16_5020_c1 | 3300050511 | Bacteria | 13832 |
| 588 | nmdc:mga08y16_63414_c1 | 3300050511 | Bacteria | 3860 |
| 589 | nmdc:mga0n895_127075_c1 | 3300050512 | Bacteria | 2573 |
| 590 | nmdc:mga0rr50_152923_c1 | 3300050513 | Bacteria | 1866 |
| 591 | nmdc:mga08x19_341184_c1 | 3300050514 | Bacteria | 1045 |
| 592 | nmdc:mga0a205_127157_c1 | 3300050515 | Bacteria | 2448 |
| 593 | nmdc:mga0a205_798_c1 | 3300050515 | Bacteria | 25516 |
| 594 | nmdc:mga0sz30_18054_c1 | 3300050516 | Bacteria | 2819 |
| 595 | Ga0495601_0000678 | 3300053077 | Bacteria | 18176 |
| 596 | Ga0495601_0002100 | 3300053077 | Bacteria | 11204 |
| 597 | Ga0495601_0011921 | 3300053077 | Bacteria | 5211 |
| 598 | Ga0495601_0108025 | 3300053077 | Bacteria | 1800 |
| 599 | Ga0495612_0075236 | 3300053078 | Bacteria | 1413 |
| 600 | Ga0495612_0090646 | 3300053078 | Bacteria | 1294 |
| 601 | Ga0495595_0003664 | 3300053084 | Bacteria | 6103 |
| 602 | Ga0495595_0039283 | 3300053084 | Bacteria | 2159 |
| 603 | Ga0500646_0002822 | 3300053090 | Bacteria | 4466 |
| 604 | Ga0500655_003214 | 3300053133 | Bacteria | 2963 |
| 605 | Ga0500573_0034193 | 3300053140 | Bacteria | 2932 |
| 606 | Ga0501082_0203665 | 3300060353 | Bacteria | 1722 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2501025502 | 2501079092 | 300 |
| 2 | 3300044712 | Ga0453684_0105893 | Ga0453684_0105893_1739_2659 | 301 |
| 3 | iso_pu_bacteria | 2547132512 | 2548847737 | 302 |
| 4 | iso_pu_bacteria | 2574179768 | 2574429172 | 302 |
| 5 | iso_pu_bacteria | 2599185292 | 2599906542 | 302 |
| 6 | iso_pu_bacteria | 2643221569 | 2643862591 | 302 |
| 7 | iso_pu_bacteria | 2643221594 | 2643980400 | 302 |
| 8 | iso_pu_bacteria | 2643221621 | 2644124891 | 302 |
| 9 | iso_pu_bacteria | 2739367655 | 2739611942 | 302 |
| 10 | iso_pu_bacteria | 2808606395 | 2809032286 | 302 |
| 11 | iso_pu_bacteria | 2855730933 | 2855736025 | 302 |
| 12 | iso_pu_bacteria | 2855767633 | 2855772963 | 302 |
| 13 | iso_pu_bacteria | 2857537821 | 2857538743 | 302 |
| 14 | iso_pu_bacteria | 2858950400 | 2858952660 | 302 |
| 15 | iso_pu_bacteria | 2881412998 | 2881413122 | 302 |
| 16 | iso_pu_bacteria | 2881927736 | 2881930079 | 302 |
| 17 | iso_pu_bacteria | 2887375801 | 2887377714 | 302 |
| 18 | iso_pu_bacteria | 2891633521 | 2891637669 | 302 |
| 19 | iso_pu_bacteria | 2919046199 | 2919049458 | 302 |
| 20 | iso_pu_bacteria | 2941479691 | 2941485302 | 302 |
| 21 | iso_pu_bacteria | 639633007 | 639787931 | 302 |
| 22 | 3300005293 | Ga0065715_10146804 | Ga0065715_101468042 | 304 |
| 23 | 3300005330 | Ga0070690_100037193 | Ga0070690_1000371933 | 304 |
| 24 | 3300005335 | Ga0070666_10003225 | Ga0070666_100032256 | 304 |
| 25 | 3300005338 | Ga0068868_100335263 | Ga0068868_1003352631 | 304 |
| 26 | 3300005339 | Ga0070660_100155664 | Ga0070660_1001556642 | 304 |
| 27 | 3300005340 | Ga0070689_100000002 | Ga0070689_100000002347 | 304 |
| 28 | 3300005343 | Ga0070687_100068831 | Ga0070687_1000688312 | 304 |
| 29 | 3300005355 | Ga0070671_100002165 | Ga0070671_1000021652 | 304 |
| 30 | 3300005365 | Ga0070688_100000414 | Ga0070688_10000041414 | 304 |
| 31 | 3300005367 | Ga0070667_100012039 | Ga0070667_1000120392 | 304 |
| 32 | 3300005434 | Ga0070709_10074167 | Ga0070709_100741672 | 304 |
| 33 | 3300005436 | Ga0070713_100001176 | Ga0070713_1000011764 | 304 |
| 34 | 3300005437 | Ga0070710_10005850 | Ga0070710_100058502 | 304 |
| 35 | 3300005439 | Ga0070711_100000696 | Ga0070711_1000006967 | 304 |
| 36 | 3300005444 | Ga0070694_100009079 | Ga0070694_1000090796 | 304 |
| 37 | 3300005456 | Ga0070678_100027528 | Ga0070678_1000275282 | 304 |
| 38 | 3300005456 | Ga0070678_100278098 | Ga0070678_1002780982 | 304 |
| 39 | 3300005457 | Ga0070662_100309808 | Ga0070662_1003098081 | 304 |
| 40 | 3300005459 | Ga0068867_100029179 | Ga0068867_1000291793 | 304 |
| 41 | 3300005459 | Ga0068867_100048854 | Ga0068867_1000488542 | 304 |
| 42 | 3300005466 | Ga0070685_10053565 | Ga0070685_100535652 | 304 |
| 43 | 3300005535 | Ga0070684_100013793 | Ga0070684_1000137932 | 304 |
| 44 | 3300005536 | Ga0070697_100076954 | Ga0070697_1000769542 | 304 |
| 45 | 3300005545 | Ga0070695_100053841 | Ga0070695_1000538411 | 304 |
| 46 | 3300005546 | Ga0070696_100060640 | Ga0070696_1000606401 | 304 |
| 47 | 3300005547 | Ga0070693_100001757 | Ga0070693_1000017575 | 304 |
| 48 | 3300005548 | Ga0070665_100025205 | Ga0070665_1000252052 | 304 |
| 49 | 3300005615 | Ga0070702_100065759 | Ga0070702_1000657592 | 304 |
| 50 | 3300005618 | Ga0068864_100034288 | Ga0068864_1000342882 | 304 |
| 51 | 3300005718 | Ga0068866_10002901 | Ga0068866_100029012 | 304 |
| 52 | 3300005719 | Ga0068861_100163944 | Ga0068861_1001639442 | 304 |
| 53 | 3300005842 | Ga0068858_100028590 | Ga0068858_1000285904 | 304 |
| 54 | 3300006163 | Ga0070715_10059385 | Ga0070715_100593852 | 304 |
| 55 | 3300006173 | Ga0070716_100022575 | Ga0070716_1000225752 | 304 |
| 56 | 3300006173 | Ga0070716_100053803 | Ga0070716_1000538032 | 304 |
| 57 | 3300006175 | Ga0070712_100001651 | Ga0070712_1000016515 | 304 |
| 58 | 3300006175 | Ga0070712_100147136 | Ga0070712_1001471362 | 304 |
| 59 | 3300006846 | Ga0075430_100034651 | Ga0075430_1000346512 | 304 |
| 60 | 3300006852 | Ga0075433_10000110 | Ga0075433_1000011010 | 304 |
| 61 | 3300006852 | Ga0075433_10109950 | Ga0075433_101099502 | 304 |
| 62 | 3300006871 | Ga0075434_100133112 | Ga0075434_1001331122 | 304 |
| 63 | 3300006880 | Ga0075429_100118416 | Ga0075429_1001184162 | 304 |
| 64 | 3300009093 | Ga0105240_10127435 | Ga0105240_101274352 | 304 |
| 65 | 3300009176 | Ga0105242_10003813 | Ga0105242_100038139 | 304 |
| 66 | 3300009545 | Ga0105237_10624609 | Ga0105237_106246091 | 304 |
| 67 | 3300014326 | Ga0157380_10146563 | Ga0157380_101465632 | 304 |
| 68 | 3300025321 | Ga0207656_10037209 | Ga0207656_100372092 | 304 |
| 69 | 3300025903 | Ga0207680_10005277 | Ga0207680_100052776 | 304 |
| 70 | 3300025911 | Ga0207654_10085962 | Ga0207654_100859622 | 304 |
| 71 | 3300025915 | Ga0207693_10000449 | Ga0207693_1000044922 | 304 |
| 72 | 3300025915 | Ga0207693_10090350 | Ga0207693_100903502 | 304 |
| 73 | 3300025916 | Ga0207663_10003365 | Ga0207663_100033657 | 304 |
| 74 | 3300025918 | Ga0207662_10070888 | Ga0207662_100708882 | 304 |
| 75 | 3300025920 | Ga0207649_10029443 | Ga0207649_100294433 | 304 |
| 76 | 3300025925 | Ga0207650_10020902 | Ga0207650_100209023 | 304 |
| 77 | 3300025927 | Ga0207687_10005787 | Ga0207687_100057873 | 304 |
| 78 | 3300025928 | Ga0207700_10012513 | Ga0207700_100125133 | 304 |
| 79 | 3300025929 | Ga0207664_10028558 | Ga0207664_100285581 | 304 |
| 80 | 3300025932 | Ga0207690_10164364 | Ga0207690_101643642 | 304 |
| 81 | 3300025933 | Ga0207706_10043412 | Ga0207706_100434122 | 304 |
| 82 | 3300025936 | Ga0207670_10000001 | Ga0207670_10000001560 | 304 |
| 83 | 3300025939 | Ga0207665_10014728 | Ga0207665_100147286 | 304 |
| 84 | 3300025941 | Ga0207711_10002490 | Ga0207711_1000249011 | 304 |
| 85 | 3300025942 | Ga0207689_10041855 | Ga0207689_100418552 | 304 |
| 86 | 3300025960 | Ga0207651_10007117 | Ga0207651_100071174 | 304 |
| 87 | 3300025960 | Ga0207651_10080227 | Ga0207651_100802271 | 304 |
| 88 | 3300025986 | Ga0207658_10087484 | Ga0207658_100874842 | 304 |
| 89 | 3300026023 | Ga0207677_10009935 | Ga0207677_100099354 | 304 |
| 90 | 3300026088 | Ga0207641_10015550 | Ga0207641_100155502 | 304 |
| 91 | 3300026089 | Ga0207648_10090444 | Ga0207648_100904442 | 304 |
| 92 | 3300026089 | Ga0207648_10124429 | Ga0207648_101244292 | 304 |
| 93 | 3300026095 | Ga0207676_10025612 | Ga0207676_100256122 | 304 |
| 94 | 3300026116 | Ga0207674_10018103 | Ga0207674_100181033 | 304 |
| 95 | 3300026118 | Ga0207675_100075163 | Ga0207675_1000751634 | 304 |
| 96 | 3300026121 | Ga0207683_10214645 | Ga0207683_102146452 | 304 |
| 97 | 3300028379 | Ga0268266_10041082 | Ga0268266_100410822 | 304 |
| 98 | 3300028381 | Ga0268264_10033840 | Ga0268264_100338402 | 304 |
| 99 | 3300035118 | Ga0373954_0016592 | Ga0373954_0016592_1340_2293 | 304 |
| 100 | 3300037068 | Ga0373925_0073259 | Ga0373925_0073259_254_1207 | 304 |
| 101 | 3300037471 | Ga0395905_0078422 | Ga0395905_0078422_1061_1981 | 304 |
| 102 | 3300042876 | Ga0451577_0003501 | Ga0451577_0003501_1820_2734 | 304 |
| 103 | 3300042876 | Ga0451577_0004085 | Ga0451577_0004085_729_1643 | 304 |
| 104 | 3300042876 | Ga0451577_0201804 | Ga0451577_0201804_367_1398 | 304 |
| 105 | 3300044694 | Ga0466963_0025591 | Ga0466963_0025591_1074_2018 | 304 |
| 106 | 3300045051 | Ga0451576_0001979 | Ga0451576_0001979_17576_18490 | 304 |
| 107 | 3300045976 | Ga0466967_0014124 | Ga0466967_0014124_1771_2715 | 304 |
| 108 | 3300046454 | Ga0495592_0084947 | Ga0495592_0084947_819_1772 | 304 |
| 109 | 3300046457 | Ga0495590_0020783 | Ga0495590_0020783_387_1307 | 304 |
| 110 | 3300046460 | Ga0495638_0018489 | Ga0495638_0018489_771_1691 | 304 |
| 111 | 3300046471 | Ga0495650_0001345 | Ga0495650_0001345_3247_4164 | 304 |
| 112 | 3300046471 | Ga0495650_0005814 | Ga0495650_0005814_3196_4116 | 304 |
| 113 | 3300046472 | Ga0495580_0078136 | Ga0495580_0078136_595_1515 | 304 |
| 114 | 3300046474 | Ga0495605_0001689 | Ga0495605_0001689_11338_12258 | 304 |
| 115 | 3300046507 | Ga0495606_0010357 | Ga0495606_0010357_1131_2051 | 304 |
| 116 | 3300046515 | Ga0495620_0008826 | Ga0495620_0008826_3224_4144 | 304 |
| 117 | 3300046517 | Ga0495630_0015929 | Ga0495630_0015929_3647_4567 | 304 |
| 118 | 3300046526 | Ga0495666_0000965 | Ga0495666_0000965_11045_11998 | 304 |
| 119 | 3300046528 | Ga0495642_0036410 | Ga0495642_0036410_1045_1965 | 304 |
| 120 | 3300046648 | Ga0495611_0005417 | Ga0495611_0005417_1051_1971 | 304 |
| 121 | 3300046660 | Ga0495625_0063884 | Ga0495625_0063884_995_1915 | 304 |
| 122 | 3300046678 | Ga0495599_0002751 | Ga0495599_0002751_5898_6818 | 304 |
| 123 | 3300046690 | Ga0495624_0251198 | Ga0495624_0251198_114_1034 | 304 |
| 124 | 3300046694 | Ga0495649_0047648 | Ga0495649_0047648_1132_2052 | 304 |
| 125 | 3300047321 | Ga0495676_0093467 | Ga0495676_0093467_107_1027 | 304 |
| 126 | 3300047323 | Ga0495683_0067986 | Ga0495683_0067986_324_1244 | 304 |
| 127 | 3300047443 | Ga0495687_072736 | Ga0495687_072736_274_1194 | 304 |
| 128 | 3300047444 | Ga0495675_0016416 | Ga0495675_0016416_17_970 | 304 |
| 129 | 3300047446 | Ga0495679_000048 | Ga0495679_000048_78869_79789 | 304 |
| 130 | 3300048091 | Ga0495626_0027564 | Ga0495626_0027564_170_1090 | 304 |
| 131 | 3300048915 | Ga0496112_0247295 | Ga0496112_0247295_547_1461 | 304 |
| 132 | 3300048921 | Ga0496118_0067713 | Ga0496118_0067713_348_1268 | 304 |
| 133 | 3300048929 | Ga0496126_0344927 | Ga0496126_0344927_68_988 | 304 |
| 134 | 3300049459 | Ga0495678_010827 | Ga0495678_010827_1186_2106 | 304 |
| 135 | 3300049570 | Ga0501033_0016074 | Ga0501033_0016074_3762_4676 | 304 |
| 136 | 3300049571 | Ga0501034_0060213 | Ga0501034_0060213_1270_2184 | 304 |
| 137 | 3300049573 | Ga0501037_0167328 | Ga0501037_0167328_235_1149 | 304 |
| 138 | 3300049579 | Ga0501043_0206543 | Ga0501043_0206543_101_1015 | 304 |
| 139 | 3300049581 | Ga0501047_0005185 | Ga0501047_0005185_10818_11732 | 304 |
| 140 | 3300049582 | Ga0501048_0138571 | Ga0501048_0138571_262_1176 | 304 |
| 141 | 3300049743 | Ga0501081_0281314 | Ga0501081_0281314_269_1201 | 304 |
| 142 | 3300049822 | Ga0501035_0007523 | Ga0501035_0007523_6482_7396 | 304 |
| 143 | 3300049822 | Ga0501035_0016321 | Ga0501035_0016321_3950_4864 | 304 |
| 144 | 3300050508 | nmdc:mga09592_414747_c1 | nmdc:mga09592_414747_c1_151_1122 | 304 |
| 145 | 3300050511 | nmdc:mga08y16_5020_c1 | nmdc:mga08y16_5020_c1_6487_7434 | 304 |
| 146 | 3300050514 | nmdc:mga08x19_341184_c1 | nmdc:mga08x19_341184_c1_43_966 | 304 |
| 147 | 3300050515 | nmdc:mga0a205_127157_c1 | nmdc:mga0a205_127157_c1_511_1482 | 304 |
| 148 | 3300050515 | nmdc:mga0a205_798_c1 | nmdc:mga0a205_798_c1_11195_12166 | 304 |
| 149 | 3300053077 | Ga0495601_0011921 | Ga0495601_0011921_1859_2812 | 304 |
| 150 | 3300053140 | Ga0500573_0034193 | Ga0500573_0034193_770_1684 | 304 |
| 151 | iso_pu_bacteria | 2510917013 | 2511093491 | 304 |
| 152 | 3300032168 | Ga0316593_10019538 | Ga0316593_100195382 | 305 |
| 153 | 3300003187 | JGI25151J46595_10000516 | JGI25151J46595_100005166 | 306 |
| 154 | 3300005290 | Ga0065712_10131402 | Ga0065712_101314022 | 306 |
| 155 | 3300005327 | Ga0070658_10005401 | Ga0070658_100054016 | 306 |
| 156 | 3300005327 | Ga0070658_10067962 | Ga0070658_100679623 | 306 |
| 157 | 3300005327 | Ga0070658_10136018 | Ga0070658_101360182 | 306 |
| 158 | 3300005329 | Ga0070683_100036866 | Ga0070683_1000368661 | 306 |
| 159 | 3300005329 | Ga0070683_100179863 | Ga0070683_1001798631 | 306 |
| 160 | 3300005330 | Ga0070690_100162491 | Ga0070690_1001624912 | 306 |
| 161 | 3300005336 | Ga0070680_100126865 | Ga0070680_1001268652 | 306 |
| 162 | 3300005337 | Ga0070682_100193864 | Ga0070682_1001938641 | 306 |
| 163 | 3300005338 | Ga0068868_100040558 | Ga0068868_1000405584 | 306 |
| 164 | 3300005338 | Ga0068868_100222258 | Ga0068868_1002222582 | 306 |
| 165 | 3300005339 | Ga0070660_100080497 | Ga0070660_1000804972 | 306 |
| 166 | 3300005355 | Ga0070671_100544467 | Ga0070671_1005444671 | 306 |
| 167 | 3300005366 | Ga0070659_100045031 | Ga0070659_1000450315 | 306 |
| 168 | 3300005435 | Ga0070714_100015455 | Ga0070714_1000154552 | 306 |
| 169 | 3300005435 | Ga0070714_100026067 | Ga0070714_1000260673 | 306 |
| 170 | 3300005435 | Ga0070714_100040552 | Ga0070714_1000405522 | 306 |
| 171 | 3300005435 | Ga0070714_100053819 | Ga0070714_1000538191 | 306 |
| 172 | 3300005436 | Ga0070713_100036705 | Ga0070713_1000367055 | 306 |
| 173 | 3300005436 | Ga0070713_100452149 | Ga0070713_1004521492 | 306 |
| 174 | 3300005437 | Ga0070710_10006053 | Ga0070710_100060535 | 306 |
| 175 | 3300005437 | Ga0070710_10013499 | Ga0070710_100134994 | 306 |
| 176 | 3300005439 | Ga0070711_100101318 | Ga0070711_1001013182 | 306 |
| 177 | 3300005444 | Ga0070694_100037526 | Ga0070694_1000375264 | 306 |
| 178 | 3300005444 | Ga0070694_100180368 | Ga0070694_1001803682 | 306 |
| 179 | 3300005455 | Ga0070663_100019603 | Ga0070663_1000196035 | 306 |
| 180 | 3300005458 | Ga0070681_10019793 | Ga0070681_100197932 | 306 |
| 181 | 3300005458 | Ga0070681_10061415 | Ga0070681_100614153 | 306 |
| 182 | 3300005458 | Ga0070681_10066867 | Ga0070681_100668671 | 306 |
| 183 | 3300005458 | Ga0070681_10268538 | Ga0070681_102685381 | 306 |
| 184 | 3300005471 | Ga0070698_100074104 | Ga0070698_1000741042 | 306 |
| 185 | 3300005530 | Ga0070679_100011258 | Ga0070679_1000112584 | 306 |
| 186 | 3300005535 | Ga0070684_100046695 | Ga0070684_1000466952 | 306 |
| 187 | 3300005536 | Ga0070697_100000387 | Ga0070697_10000038710 | 306 |
| 188 | 3300005536 | Ga0070697_100075256 | Ga0070697_1000752562 | 306 |
| 189 | 3300005539 | Ga0068853_100030959 | Ga0068853_1000309595 | 306 |
| 190 | 3300005539 | Ga0068853_100093308 | Ga0068853_1000933083 | 306 |
| 191 | 3300005539 | Ga0068853_100121269 | Ga0068853_1001212692 | 306 |
| 192 | 3300005544 | Ga0070686_100059500 | Ga0070686_1000595003 | 306 |
| 193 | 3300005544 | Ga0070686_100134337 | Ga0070686_1001343371 | 306 |
| 194 | 3300005546 | Ga0070696_100002413 | Ga0070696_1000024134 | 306 |
| 195 | 3300005546 | Ga0070696_100007006 | Ga0070696_1000070063 | 306 |
| 196 | 3300005546 | Ga0070696_100053156 | Ga0070696_1000531562 | 306 |
| 197 | 3300005547 | Ga0070693_100124204 | Ga0070693_1001242042 | 306 |
| 198 | 3300005549 | Ga0070704_100082574 | Ga0070704_1000825742 | 306 |
| 199 | 3300005549 | Ga0070704_100117310 | Ga0070704_1001173101 | 306 |
| 200 | 3300005563 | Ga0068855_100024894 | Ga0068855_1000248945 | 306 |
| 201 | 3300005563 | Ga0068855_100026030 | Ga0068855_1000260306 | 306 |
| 202 | 3300005563 | Ga0068855_100128167 | Ga0068855_1001281672 | 306 |
| 203 | 3300005563 | Ga0068855_100460578 | Ga0068855_1004605782 | 306 |
| 204 | 3300005564 | Ga0070664_100215209 | Ga0070664_1002152093 | 306 |
| 205 | 3300005577 | Ga0068857_100136792 | Ga0068857_1001367922 | 306 |
| 206 | 3300005578 | Ga0068854_100016671 | Ga0068854_1000166716 | 306 |
| 207 | 3300005614 | Ga0068856_100013711 | Ga0068856_1000137113 | 306 |
| 208 | 3300005614 | Ga0068856_100049933 | Ga0068856_1000499335 | 306 |
| 209 | 3300005616 | Ga0068852_100000554 | Ga0068852_10000055424 | 306 |
| 210 | 3300005616 | Ga0068852_100001905 | Ga0068852_10000190515 | 306 |
| 211 | 3300005616 | Ga0068852_100015681 | Ga0068852_1000156811 | 306 |
| 212 | 3300005616 | Ga0068852_100204595 | Ga0068852_1002045952 | 306 |
| 213 | 3300005834 | Ga0068851_10000229 | Ga0068851_100002293 | 306 |
| 214 | 3300005834 | Ga0068851_10071717 | Ga0068851_100717173 | 306 |
| 215 | 3300005840 | Ga0068870_10055741 | Ga0068870_100557412 | 306 |
| 216 | 3300005842 | Ga0068858_100017245 | Ga0068858_1000172456 | 306 |
| 217 | 3300005842 | Ga0068858_100093425 | Ga0068858_1000934253 | 306 |
| 218 | 3300005843 | Ga0068860_100599073 | Ga0068860_1005990731 | 306 |
| 219 | 3300006028 | Ga0070717_10124226 | Ga0070717_101242262 | 306 |
| 220 | 3300006042 | Ga0075368_10039954 | Ga0075368_100399542 | 306 |
| 221 | 3300006163 | Ga0070715_10056243 | Ga0070715_100562432 | 306 |
| 222 | 3300006175 | Ga0070712_100045826 | Ga0070712_1000458263 | 306 |
| 223 | 3300006186 | Ga0075369_10014439 | Ga0075369_100144392 | 306 |
| 224 | 3300006195 | Ga0075366_10009881 | Ga0075366_100098812 | 306 |
| 225 | 3300006195 | Ga0075366_10076709 | Ga0075366_100767093 | 306 |
| 226 | 3300006237 | Ga0097621_100036037 | Ga0097621_1000360375 | 306 |
| 227 | 3300006358 | Ga0068871_100004374 | Ga0068871_1000043742 | 306 |
| 228 | 3300006358 | Ga0068871_100017486 | Ga0068871_1000174867 | 306 |
| 229 | 3300006358 | Ga0068871_100203600 | Ga0068871_1002036002 | 306 |
| 230 | 3300006844 | Ga0075428_100002905 | Ga0075428_10000290516 | 306 |
| 231 | 3300006844 | Ga0075428_100044527 | Ga0075428_1000445276 | 306 |
| 232 | 3300006846 | Ga0075430_100056974 | Ga0075430_1000569744 | 306 |
| 233 | 3300006847 | Ga0075431_100404571 | Ga0075431_1004045712 | 306 |
| 234 | 3300006852 | Ga0075433_10109726 | Ga0075433_101097262 | 306 |
| 235 | 3300006871 | Ga0075434_100065115 | Ga0075434_1000651153 | 306 |
| 236 | 3300006871 | Ga0075434_100098714 | Ga0075434_1000987144 | 306 |
| 237 | 3300006880 | Ga0075429_100033171 | Ga0075429_1000331713 | 306 |
| 238 | 3300006931 | Ga0097620_100132747 | Ga0097620_1001327473 | 306 |
| 239 | 3300007788 | Ga0099795_10028029 | Ga0099795_100280292 | 306 |
| 240 | 3300009093 | Ga0105240_10018674 | Ga0105240_100186742 | 306 |
| 241 | 3300009093 | Ga0105240_10060469 | Ga0105240_100604694 | 306 |
| 242 | 3300009093 | Ga0105240_10074744 | Ga0105240_100747442 | 306 |
| 243 | 3300009093 | Ga0105240_10106295 | Ga0105240_101062953 | 306 |
| 244 | 3300009094 | Ga0111539_10003499 | Ga0111539_1000349914 | 306 |
| 245 | 3300009098 | Ga0105245_10011124 | Ga0105245_100111242 | 306 |
| 246 | 3300009098 | Ga0105245_10252393 | Ga0105245_102523933 | 306 |
| 247 | 3300009101 | Ga0105247_10029850 | Ga0105247_100298502 | 306 |
| 248 | 3300009147 | Ga0114129_10046541 | Ga0114129_100465414 | 306 |
| 249 | 3300009148 | Ga0105243_10090156 | Ga0105243_100901562 | 306 |
| 250 | 3300009174 | Ga0105241_10010136 | Ga0105241_100101363 | 306 |
| 251 | 3300009174 | Ga0105241_10113850 | Ga0105241_101138502 | 306 |
| 252 | 3300009176 | Ga0105242_10009597 | Ga0105242_100095977 | 306 |
| 253 | 3300009176 | Ga0105242_10042004 | Ga0105242_100420043 | 306 |
| 254 | 3300009177 | Ga0105248_10021630 | Ga0105248_100216304 | 306 |
| 255 | 3300009545 | Ga0105237_10021527 | Ga0105237_100215272 | 306 |
| 256 | 3300009545 | Ga0105237_10178560 | Ga0105237_101785602 | 306 |
| 257 | 3300009551 | Ga0105238_10065776 | Ga0105238_100657764 | 306 |
| 258 | 3300009551 | Ga0105238_10120614 | Ga0105238_101206142 | 306 |
| 259 | 3300009551 | Ga0105238_10460445 | Ga0105238_104604451 | 306 |
| 260 | 3300010375 | Ga0105239_10086834 | Ga0105239_100868341 | 306 |
| 261 | 3300010375 | Ga0105239_10163494 | Ga0105239_101634942 | 306 |
| 262 | 3300010375 | Ga0105239_10175387 | Ga0105239_101753872 | 306 |
| 263 | 3300011119 | Ga0105246_10038730 | Ga0105246_100387305 | 306 |
| 264 | 3300013100 | Ga0157373_10035289 | Ga0157373_100352893 | 306 |
| 265 | 3300013100 | Ga0157373_10298022 | Ga0157373_102980221 | 306 |
| 266 | 3300013102 | Ga0157371_10019530 | Ga0157371_100195302 | 306 |
| 267 | 3300013102 | Ga0157371_10131682 | Ga0157371_101316822 | 306 |
| 268 | 3300013104 | Ga0157370_10002509 | Ga0157370_1000250914 | 306 |
| 269 | 3300013104 | Ga0157370_10019075 | Ga0157370_100190752 | 306 |
| 270 | 3300013104 | Ga0157370_10029259 | Ga0157370_100292592 | 306 |
| 271 | 3300013104 | Ga0157370_10032996 | Ga0157370_100329963 | 306 |
| 272 | 3300013105 | Ga0157369_10000904 | Ga0157369_100009044 | 306 |
| 273 | 3300013105 | Ga0157369_10044093 | Ga0157369_100440932 | 306 |
| 274 | 3300013105 | Ga0157369_10245566 | Ga0157369_102455662 | 306 |
| 275 | 3300013105 | Ga0157369_10652329 | Ga0157369_106523291 | 306 |
| 276 | 3300013296 | Ga0157374_10035131 | Ga0157374_100351312 | 306 |
| 277 | 3300013306 | Ga0163162_10125806 | Ga0163162_101258062 | 306 |
| 278 | 3300013306 | Ga0163162_10148202 | Ga0163162_101482022 | 306 |
| 279 | 3300013306 | Ga0163162_10264232 | Ga0163162_102642322 | 306 |
| 280 | 3300013307 | Ga0157372_10010371 | Ga0157372_100103712 | 306 |
| 281 | 3300013307 | Ga0157372_10122441 | Ga0157372_101224412 | 306 |
| 282 | 3300013307 | Ga0157372_10224221 | Ga0157372_102242212 | 306 |
| 283 | 3300013307 | Ga0157372_10358302 | Ga0157372_103583023 | 306 |
| 284 | 3300013307 | Ga0157372_10417913 | Ga0157372_104179132 | 306 |
| 285 | 3300013307 | Ga0157372_10437194 | Ga0157372_104371941 | 306 |
| 286 | 3300013307 | Ga0157372_10634745 | Ga0157372_106347452 | 306 |
| 287 | 3300013308 | Ga0157375_10042981 | Ga0157375_100429814 | 306 |
| 288 | 3300013308 | Ga0157375_10482650 | Ga0157375_104826502 | 306 |
| 289 | 3300014325 | Ga0163163_10013714 | Ga0163163_100137143 | 306 |
| 290 | 3300014325 | Ga0163163_10038793 | Ga0163163_100387934 | 306 |
| 291 | 3300014497 | Ga0182008_10079861 | Ga0182008_100798613 | 306 |
| 292 | 3300014745 | Ga0157377_10007044 | Ga0157377_100070442 | 306 |
| 293 | 3300014968 | Ga0157379_10018386 | Ga0157379_100183865 | 306 |
| 294 | 3300014968 | Ga0157379_10040838 | Ga0157379_100408382 | 306 |
| 295 | 3300014968 | Ga0157379_10089553 | Ga0157379_100895532 | 306 |
| 296 | 3300014968 | Ga0157379_10103232 | Ga0157379_101032322 | 306 |
| 297 | 3300014969 | Ga0157376_10291370 | Ga0157376_102913702 | 306 |
| 298 | 3300014969 | Ga0157376_10643190 | Ga0157376_106431902 | 306 |
| 299 | 3300017792 | Ga0163161_10079877 | Ga0163161_100798772 | 306 |
| 300 | 3300020081 | Ga0206354_10773014 | Ga0206354_107730143 | 306 |
| 301 | 3300020610 | Ga0154015_1545361 | Ga0154015_15453611 | 306 |
| 302 | 3300025242 | Ga0209258_101933 | Ga0209258_1019332 | 306 |
| 303 | 3300025272 | Ga0209455_1000420 | Ga0209455_100042019 | 306 |
| 304 | 3300025292 | Ga0209676_1016081 | Ga0209676_10160814 | 306 |
| 305 | 3300025294 | Ga0209025_1000141 | Ga0209025_100014178 | 306 |
| 306 | 3300025298 | Ga0209050_1002420 | Ga0209050_10024204 | 306 |
| 307 | 3300025321 | Ga0207656_10004971 | Ga0207656_100049714 | 306 |
| 308 | 3300025321 | Ga0207656_10007459 | Ga0207656_100074595 | 306 |
| 309 | 3300025898 | Ga0207692_10060325 | Ga0207692_100603251 | 306 |
| 310 | 3300025905 | Ga0207685_10008765 | Ga0207685_100087654 | 306 |
| 311 | 3300025906 | Ga0207699_10010741 | Ga0207699_100107412 | 306 |
| 312 | 3300025909 | Ga0207705_10094166 | Ga0207705_100941662 | 306 |
| 313 | 3300025909 | Ga0207705_10115974 | Ga0207705_101159742 | 306 |
| 314 | 3300025909 | Ga0207705_10121753 | Ga0207705_101217532 | 306 |
| 315 | 3300025912 | Ga0207707_10005992 | Ga0207707_100059925 | 306 |
| 316 | 3300025912 | Ga0207707_10034568 | Ga0207707_100345682 | 306 |
| 317 | 3300025912 | Ga0207707_10110746 | Ga0207707_101107463 | 306 |
| 318 | 3300025912 | Ga0207707_10113913 | Ga0207707_101139133 | 306 |
| 319 | 3300025912 | Ga0207707_10209873 | Ga0207707_102098732 | 306 |
| 320 | 3300025913 | Ga0207695_10062423 | Ga0207695_100624233 | 306 |
| 321 | 3300025913 | Ga0207695_10077004 | Ga0207695_100770045 | 306 |
| 322 | 3300025913 | Ga0207695_10116851 | Ga0207695_101168512 | 306 |
| 323 | 3300025913 | Ga0207695_10207195 | Ga0207695_102071952 | 306 |
| 324 | 3300025913 | Ga0207695_10255703 | Ga0207695_102557033 | 306 |
| 325 | 3300025914 | Ga0207671_10332711 | Ga0207671_103327111 | 306 |
| 326 | 3300025916 | Ga0207663_10228616 | Ga0207663_102286162 | 306 |
| 327 | 3300025917 | Ga0207660_10094245 | Ga0207660_100942452 | 306 |
| 328 | 3300025918 | Ga0207662_10094126 | Ga0207662_100941263 | 306 |
| 329 | 3300025919 | Ga0207657_10000297 | Ga0207657_1000029740 | 306 |
| 330 | 3300025920 | Ga0207649_10044989 | Ga0207649_100449892 | 306 |
| 331 | 3300025920 | Ga0207649_10144487 | Ga0207649_101444872 | 306 |
| 332 | 3300025921 | Ga0207652_10045918 | Ga0207652_100459182 | 306 |
| 333 | 3300025921 | Ga0207652_10123772 | Ga0207652_101237722 | 306 |
| 334 | 3300025921 | Ga0207652_10350467 | Ga0207652_103504672 | 306 |
| 335 | 3300025924 | Ga0207694_10033000 | Ga0207694_100330002 | 306 |
| 336 | 3300025927 | Ga0207687_10019194 | Ga0207687_100191944 | 306 |
| 337 | 3300025927 | Ga0207687_10068842 | Ga0207687_100688423 | 306 |
| 338 | 3300025928 | Ga0207700_10326538 | Ga0207700_103265382 | 306 |
| 339 | 3300025928 | Ga0207700_10387906 | Ga0207700_103879061 | 306 |
| 340 | 3300025929 | Ga0207664_10014931 | Ga0207664_100149313 | 306 |
| 341 | 3300025929 | Ga0207664_10027283 | Ga0207664_100272834 | 306 |
| 342 | 3300025929 | Ga0207664_10035835 | Ga0207664_100358352 | 306 |
| 343 | 3300025929 | Ga0207664_10036315 | Ga0207664_100363152 | 306 |
| 344 | 3300025932 | Ga0207690_10090593 | Ga0207690_100905932 | 306 |
| 345 | 3300025934 | Ga0207686_10000474 | Ga0207686_1000047415 | 306 |
| 346 | 3300025934 | Ga0207686_10008745 | Ga0207686_100087455 | 306 |
| 347 | 3300025935 | Ga0207709_10188392 | Ga0207709_101883921 | 306 |
| 348 | 3300025939 | Ga0207665_10004123 | Ga0207665_100041234 | 306 |
| 349 | 3300025944 | Ga0207661_10088947 | Ga0207661_100889472 | 306 |
| 350 | 3300025944 | Ga0207661_10228401 | Ga0207661_102284012 | 306 |
| 351 | 3300025945 | Ga0207679_10156516 | Ga0207679_101565162 | 306 |
| 352 | 3300025949 | Ga0207667_10013735 | Ga0207667_100137358 | 306 |
| 353 | 3300025949 | Ga0207667_10023013 | Ga0207667_100230134 | 306 |
| 354 | 3300025949 | Ga0207667_10031080 | Ga0207667_100310804 | 306 |
| 355 | 3300025949 | Ga0207667_10099563 | Ga0207667_100995632 | 306 |
| 356 | 3300025949 | Ga0207667_10114860 | Ga0207667_101148604 | 306 |
| 357 | 3300025949 | Ga0207667_10288493 | Ga0207667_102884932 | 306 |
| 358 | 3300026035 | Ga0207703_10007141 | Ga0207703_100071416 | 306 |
| 359 | 3300026035 | Ga0207703_10058212 | Ga0207703_100582123 | 306 |
| 360 | 3300026041 | Ga0207639_10044835 | Ga0207639_100448352 | 306 |
| 361 | 3300026041 | Ga0207639_10112617 | Ga0207639_101126173 | 306 |
| 362 | 3300026041 | Ga0207639_10318047 | Ga0207639_103180471 | 306 |
| 363 | 3300026041 | Ga0207639_10411903 | Ga0207639_104119031 | 306 |
| 364 | 3300026067 | Ga0207678_10012275 | Ga0207678_100122753 | 306 |
| 365 | 3300026078 | Ga0207702_10022087 | Ga0207702_100220873 | 306 |
| 366 | 3300026078 | Ga0207702_10118288 | Ga0207702_101182883 | 306 |
| 367 | 3300026078 | Ga0207702_10186557 | Ga0207702_101865573 | 306 |
| 368 | 3300026116 | Ga0207674_10000396 | Ga0207674_1000039634 | 306 |
| 369 | 3300026116 | Ga0207674_10123583 | Ga0207674_101235833 | 306 |
| 370 | 3300026118 | Ga0207675_100502022 | Ga0207675_1005020222 | 306 |
| 371 | 3300026121 | Ga0207683_10001287 | Ga0207683_1000128711 | 306 |
| 372 | 3300026142 | Ga0207698_10003759 | Ga0207698_100037594 | 306 |
| 373 | 3300026142 | Ga0207698_10043816 | Ga0207698_100438164 | 306 |
| 374 | 3300026142 | Ga0207698_10135461 | Ga0207698_101354613 | 306 |
| 375 | 3300027424 | Ga0209984_1011203 | Ga0209984_10112032 | 306 |
| 376 | 3300027462 | Ga0210000_1010652 | Ga0210000_10106523 | 306 |
| 377 | 3300027665 | Ga0209983_1008059 | Ga0209983_10080593 | 306 |
| 378 | 3300027876 | Ga0209974_10001325 | Ga0209974_100013253 | 306 |
| 379 | 3300027907 | Ga0207428_10004905 | Ga0207428_100049058 | 306 |
| 380 | 3300027907 | Ga0207428_10005350 | Ga0207428_100053504 | 306 |
| 381 | 3300028380 | Ga0268265_10281681 | Ga0268265_102816812 | 306 |
| 382 | 3300028381 | Ga0268264_10509306 | Ga0268264_105093061 | 306 |
| 383 | 3300030521 | Ga0307511_10000164 | Ga0307511_1000016414 | 306 |
| 384 | 3300031238 | Ga0265332_10000004 | Ga0265332_1000000463 | 306 |
| 385 | 3300031238 | Ga0265332_10021756 | Ga0265332_100217562 | 306 |
| 386 | 3300031241 | Ga0265325_10025196 | Ga0265325_100251965 | 306 |
| 387 | 3300031251 | Ga0265327_10028560 | Ga0265327_100285603 | 306 |
| 388 | 3300031251 | Ga0265327_10052087 | Ga0265327_100520872 | 306 |
| 389 | 3300031344 | Ga0265316_10071091 | Ga0265316_100710912 | 306 |
| 390 | 3300031548 | Ga0307408_100079001 | Ga0307408_1000790013 | 306 |
| 391 | 3300031548 | Ga0307408_100095572 | Ga0307408_1000955723 | 306 |
| 392 | 3300031548 | Ga0307408_100184031 | Ga0307408_1001840312 | 306 |
| 393 | 3300031616 | Ga0307508_10049204 | Ga0307508_100492044 | 306 |
| 394 | 3300031665 | Ga0316575_10054877 | Ga0316575_100548773 | 306 |
| 395 | 3300031824 | Ga0307413_10232493 | Ga0307413_102324931 | 306 |
| 396 | 3300031911 | Ga0307412_10000148 | Ga0307412_1000014837 | 306 |
| 397 | 3300032002 | Ga0307416_100077509 | Ga0307416_1000775092 | 306 |
| 398 | 3300032002 | Ga0307416_100665530 | Ga0307416_1006655302 | 306 |
| 399 | 3300032004 | Ga0307414_10045164 | Ga0307414_100451644 | 306 |
| 400 | 3300032004 | Ga0307414_10235851 | Ga0307414_102358513 | 306 |
| 401 | 3300032133 | Ga0316583_10000345 | Ga0316583_100003458 | 306 |
| 402 | 3300032133 | Ga0316583_10010803 | Ga0316583_100108033 | 306 |
| 403 | 3300033179 | Ga0307507_10039851 | Ga0307507_100398513 | 306 |
| 404 | 3300034819 | Ga0373958_0011459 | Ga0373958_0011459_33_1007 | 306 |
| 405 | 3300035086 | Ga0373934_0003046 | Ga0373934_0003046_1493_2452 | 306 |
| 406 | 3300035113 | Ga0373936_0001904 | Ga0373936_0001904_3022_3981 | 306 |
| 407 | 3300035115 | Ga0373941_0018556 | Ga0373941_0018556_806_1780 | 306 |
| 408 | 3300035118 | Ga0373954_0004840 | Ga0373954_0004840_2726_3655 | 306 |
| 409 | 3300035119 | Ga0373956_0000103 | Ga0373956_0000103_5548_6507 | 306 |
| 410 | 3300035119 | Ga0373956_0017262 | Ga0373956_0017262_338_1297 | 306 |
| 411 | 3300035120 | Ga0373957_0002129 | Ga0373957_0002129_3519_4478 | 306 |
| 412 | 3300035170 | Ga0373943_0007528 | Ga0373943_0007528_1894_2853 | 306 |
| 413 | 3300035170 | Ga0373943_0044243 | Ga0373943_0044243_290_1210 | 306 |
| 414 | 3300035172 | Ga0373955_0002776 | Ga0373955_0002776_2936_3865 | 306 |
| 415 | 3300035172 | Ga0373955_0010947 | Ga0373955_0010947_1890_2849 | 306 |
| 416 | 3300035172 | Ga0373955_0012200 | Ga0373955_0012200_1423_2382 | 306 |
| 417 | 3300035241 | Ga0373961_0005558 | Ga0373961_0005558_233_1207 | 306 |
| 418 | 3300035398 | Ga0316574_0053217 | Ga0316574_0053217_992_1981 | 306 |
| 419 | 3300035398 | Ga0316574_0221173 | Ga0316574_0221173_55_1035 | 306 |
| 420 | 3300035410 | Ga0373924_0001467 | Ga0373924_0001467_5744_6703 | 306 |
| 421 | 3300035410 | Ga0373924_0011127 | Ga0373924_0011127_2390_3316 | 306 |
| 422 | 3300035410 | Ga0373924_0099455 | Ga0373924_0099455_22_978 | 306 |
| 423 | 3300035691 | Ga0373931_0054923 | Ga0373931_0054923_1074_2105 | 306 |
| 424 | 3300035692 | Ga0373935_0321894 | Ga0373935_0321894_42_1001 | 306 |
| 425 | 3300035695 | Ga0373927_0032817 | Ga0373927_0032817_2349_3308 | 306 |
| 426 | 3300035724 | Ga0373933_0017604 | Ga0373933_0017604_1218_2138 | 306 |
| 427 | 3300035724 | Ga0373933_0020378 | Ga0373933_0020378_2267_3226 | 306 |
| 428 | 3300035724 | Ga0373933_0050711 | Ga0373933_0050711_33_953 | 306 |
| 429 | 3300035724 | Ga0373933_0353750 | Ga0373933_0353750_21_941 | 306 |
| 430 | 3300035725 | Ga0373947_0002381 | Ga0373947_0002381_9145_10065 | 306 |
| 431 | 3300035725 | Ga0373947_0018747 | Ga0373947_0018747_736_1656 | 306 |
| 432 | 3300036401 | Ga0373937_0005811 | Ga0373937_0005811_6585_7505 | 306 |
| 433 | 3300036401 | Ga0373937_0006490 | Ga0373937_0006490_1502_2458 | 306 |
| 434 | 3300036401 | Ga0373937_0010340 | Ga0373937_0010340_3500_4429 | 306 |
| 435 | 3300036401 | Ga0373937_0033702 | Ga0373937_0033702_3682_4641 | 306 |
| 436 | 3300036647 | Ga0316582_0011326 | Ga0316582_0011326_3556_4536 | 306 |
| 437 | 3300037068 | Ga0373925_0188574 | Ga0373925_0188574_380_1333 | 306 |
| 438 | 3300037418 | Ga0395900_0002375 | Ga0395900_0002375_1306_2226 | 306 |
| 439 | 3300037588 | Ga0316581_0077521 | Ga0316581_0077521_28_1008 | 306 |
| 440 | 3300037853 | Ga0436364_0438780 | Ga0436364_0438780_56_1063 | 306 |
| 441 | 3300038443 | Ga0395901_0051673 | Ga0395901_0051673_765_1754 | 306 |
| 442 | 3300038443 | Ga0395901_0086884 | Ga0395901_0086884_2092_3012 | 306 |
| 443 | 3300038443 | Ga0395901_0141348 | Ga0395901_0141348_196_1122 | 306 |
| 444 | 3300039447 | Ga0436361_1111140 | Ga0436361_1111140_352_1272 | 306 |
| 445 | 3300042876 | Ga0451577_0003515 | Ga0451577_0003515_6794_7714 | 306 |
| 446 | 3300042876 | Ga0451577_0013830 | Ga0451577_0013830_2123_3043 | 306 |
| 447 | 3300042876 | Ga0451577_0037150 | Ga0451577_0037150_2126_3055 | 306 |
| 448 | 3300042876 | Ga0451577_0256684 | Ga0451577_0256684_67_1062 | 306 |
| 449 | 3300044673 | Ga0453683_0018786 | Ga0453683_0018786_1372_2298 | 306 |
| 450 | 3300044684 | Ga0466966_0153162 | Ga0466966_0153162_440_1393 | 306 |
| 451 | 3300044712 | Ga0453684_0000065 | Ga0453684_0000065_459045_459965 | 306 |
| 452 | 3300044712 | Ga0453684_0001131 | Ga0453684_0001131_74077_74997 | 306 |
| 453 | 3300044712 | Ga0453684_0001181 | Ga0453684_0001181_72949_73869 | 306 |
| 454 | 3300044712 | Ga0453684_0001452 | Ga0453684_0001452_48988_49917 | 306 |
| 455 | 3300044712 | Ga0453684_0003292 | Ga0453684_0003292_9315_10247 | 306 |
| 456 | 3300044712 | Ga0453684_0009602 | Ga0453684_0009602_2043_2963 | 306 |
| 457 | 3300044712 | Ga0453684_0010067 | Ga0453684_0010067_8559_9479 | 306 |
| 458 | 3300044712 | Ga0453684_0058382 | Ga0453684_0058382_2283_3212 | 306 |
| 459 | 3300044719 | Ga0466971_0064903 | Ga0466971_0064903_508_1461 | 306 |
| 460 | 3300045051 | Ga0451576_0000335 | Ga0451576_0000335_78326_79246 | 306 |
| 461 | 3300045051 | Ga0451576_0000526 | Ga0451576_0000526_73949_74869 | 306 |
| 462 | 3300045051 | Ga0451576_0028559 | Ga0451576_0028559_461_1381 | 306 |
| 463 | 3300045051 | Ga0451576_0036754 | Ga0451576_0036754_2587_3513 | 306 |
| 464 | 3300045051 | Ga0451576_0056353 | Ga0451576_0056353_253_1182 | 306 |
| 465 | 3300045051 | Ga0451576_0062696 | Ga0451576_0062696_1969_2895 | 306 |
| 466 | 3300045836 | Ga0466958_0118908 | Ga0466958_0118908_156_1109 | 306 |
| 467 | 3300046454 | Ga0495592_0001049 | Ga0495592_0001049_16808_17767 | 306 |
| 468 | 3300046454 | Ga0495592_0095526 | Ga0495592_0095526_1025_1954 | 306 |
| 469 | 3300046459 | Ga0495629_0015666 | Ga0495629_0015666_2226_3146 | 306 |
| 470 | 3300046461 | Ga0495641_0001109 | Ga0495641_0001109_6467_7426 | 306 |
| 471 | 3300046461 | Ga0495641_0071068 | Ga0495641_0071068_245_1177 | 306 |
| 472 | 3300046462 | Ga0495651_0001335 | Ga0495651_0001335_13340_14299 | 306 |
| 473 | 3300046462 | Ga0495651_0008602 | Ga0495651_0008602_940_1899 | 306 |
| 474 | 3300046462 | Ga0495651_0081151 | Ga0495651_0081151_291_1211 | 306 |
| 475 | 3300046463 | Ga0495653_0005924 | Ga0495653_0005924_4653_5612 | 306 |
| 476 | 3300046463 | Ga0495653_0029699 | Ga0495653_0029699_2603_3535 | 306 |
| 477 | 3300046463 | Ga0495653_0060736 | Ga0495653_0060736_165_1097 | 306 |
| 478 | 3300046463 | Ga0495653_0188121 | Ga0495653_0188121_276_1202 | 306 |
| 479 | 3300046472 | Ga0495580_0000419 | Ga0495580_0000419_3744_4676 | 306 |
| 480 | 3300046472 | Ga0495580_0044957 | Ga0495580_0044957_1798_2718 | 306 |
| 481 | 3300046472 | Ga0495580_0139893 | Ga0495580_0139893_160_1080 | 306 |
| 482 | 3300046473 | Ga0495582_0155665 | Ga0495582_0155665_206_1126 | 306 |
| 483 | 3300046475 | Ga0495639_0039475 | Ga0495639_0039475_1131_2051 | 306 |
| 484 | 3300046476 | Ga0495662_0016429 | Ga0495662_0016429_1951_2871 | 306 |
| 485 | 3300046499 | Ga0495594_0016852 | Ga0495594_0016852_2457_3416 | 306 |
| 486 | 3300046511 | Ga0495608_0025886 | Ga0495608_0025886_1423_2382 | 306 |
| 487 | 3300046511 | Ga0495608_0041098 | Ga0495608_0041098_639_1595 | 306 |
| 488 | 3300046516 | Ga0495628_0028030 | Ga0495628_0028030_3637_4569 | 306 |
| 489 | 3300046516 | Ga0495628_0028451 | Ga0495628_0028451_407_1339 | 306 |
| 490 | 3300046516 | Ga0495628_0035453 | Ga0495628_0035453_1630_2589 | 306 |
| 491 | 3300046516 | Ga0495628_0067801 | Ga0495628_0067801_1516_2475 | 306 |
| 492 | 3300046516 | Ga0495628_0106034 | Ga0495628_0106034_372_1328 | 306 |
| 493 | 3300046517 | Ga0495630_0001348 | Ga0495630_0001348_12196_13155 | 306 |
| 494 | 3300046526 | Ga0495666_0005962 | Ga0495666_0005962_4328_5260 | 306 |
| 495 | 3300046526 | Ga0495666_0045685 | Ga0495666_0045685_380_1312 | 306 |
| 496 | 3300046529 | Ga0495652_0082592 | Ga0495652_0082592_856_1815 | 306 |
| 497 | 3300046529 | Ga0495652_0118386 | Ga0495652_0118386_658_1617 | 306 |
| 498 | 3300046531 | Ga0495665_0023624 | Ga0495665_0023624_2086_3045 | 306 |
| 499 | 3300046535 | Ga0495586_0007778 | Ga0495586_0007778_3355_4314 | 306 |
| 500 | 3300046536 | Ga0495587_0016844 | Ga0495587_0016844_2326_3255 | 306 |
| 501 | 3300046539 | Ga0495621_0002360 | Ga0495621_0002360_3743_4663 | 306 |
| 502 | 3300046543 | Ga0495645_0000056 | Ga0495645_0000056_14075_15034 | 306 |
| 503 | 3300046543 | Ga0495645_0000842 | Ga0495645_0000842_9240_10196 | 306 |
| 504 | 3300046559 | Ga0495667_0004484 | Ga0495667_0004484_6059_7018 | 306 |
| 505 | 3300046559 | Ga0495667_0040464 | Ga0495667_0040464_663_1589 | 306 |
| 506 | 3300046663 | Ga0495635_0025265 | Ga0495635_0025265_1333_2289 | 306 |
| 507 | 3300046663 | Ga0495635_0028419 | Ga0495635_0028419_1965_2924 | 306 |
| 508 | 3300046675 | Ga0495657_0034293 | Ga0495657_0034293_275_1312 | 306 |
| 509 | 3300046675 | Ga0495657_0072632 | Ga0495657_0072632_467_1426 | 306 |
| 510 | 3300046678 | Ga0495599_0000353 | Ga0495599_0000353_12310_13269 | 306 |
| 511 | 3300046678 | Ga0495599_0013228 | Ga0495599_0013228_501_1457 | 306 |
| 512 | 3300046678 | Ga0495599_0028664 | Ga0495599_0028664_2422_3354 | 306 |
| 513 | 3300046678 | Ga0495599_0078578 | Ga0495599_0078578_78_1037 | 306 |
| 514 | 3300046679 | Ga0495623_0001978 | Ga0495623_0001978_10091_11017 | 306 |
| 515 | 3300046679 | Ga0495623_0008799 | Ga0495623_0008799_600_1556 | 306 |
| 516 | 3300046679 | Ga0495623_0011173 | Ga0495623_0011173_1571_2500 | 306 |
| 517 | 3300046680 | Ga0495646_0103734 | Ga0495646_0103734_558_1517 | 306 |
| 518 | 3300046681 | Ga0495647_0000531 | Ga0495647_0000531_3899_4858 | 306 |
| 519 | 3300046689 | Ga0495613_0020205 | Ga0495613_0020205_3023_3982 | 306 |
| 520 | 3300046689 | Ga0495613_0080741 | Ga0495613_0080741_740_1660 | 306 |
| 521 | 3300046690 | Ga0495624_0000385 | Ga0495624_0000385_6428_7360 | 306 |
| 522 | 3300046690 | Ga0495624_0000446 | Ga0495624_0000446_29878_30810 | 306 |
| 523 | 3300046690 | Ga0495624_0026061 | Ga0495624_0026061_1453_2412 | 306 |
| 524 | 3300046809 | Ga0495600_0000226 | Ga0495600_0000226_10647_11606 | 306 |
| 525 | 3300046809 | Ga0495600_0065028 | Ga0495600_0065028_1441_2361 | 306 |
| 526 | 3300047315 | Ga0495581_0050005 | Ga0495581_0050005_1085_2005 | 306 |
| 527 | 3300047315 | Ga0495581_0161188 | Ga0495581_0161188_232_1191 | 306 |
| 528 | 3300047317 | Ga0495604_0001989 | Ga0495604_0001989_1126_2052 | 306 |
| 529 | 3300047317 | Ga0495604_0039780 | Ga0495604_0039780_1006_1965 | 306 |
| 530 | 3300047318 | Ga0495636_0083394 | Ga0495636_0083394_259_1218 | 306 |
| 531 | 3300047319 | Ga0495674_0005107 | Ga0495674_0005107_11070_12029 | 306 |
| 532 | 3300047319 | Ga0495674_0352900 | Ga0495674_0352900_217_1176 | 306 |
| 533 | 3300047322 | Ga0495680_0005058 | Ga0495680_0005058_3227_4186 | 306 |
| 534 | 3300047322 | Ga0495680_0029215 | Ga0495680_0029215_2281_3213 | 306 |
| 535 | 3300047444 | Ga0495675_0055961 | Ga0495675_0055961_1382_2308 | 306 |
| 536 | 3300047444 | Ga0495675_0141319 | Ga0495675_0141319_370_1299 | 306 |
| 537 | 3300047471 | Ga0495684_0088090 | Ga0495684_0088090_956_1876 | 306 |
| 538 | 3300047471 | Ga0495684_0266210 | Ga0495684_0266210_229_1185 | 306 |
| 539 | 3300047673 | Ga0495593_0010083 | Ga0495593_0010083_2738_3670 | 306 |
| 540 | 3300048088 | Ga0495602_0005553 | Ga0495602_0005553_5878_6804 | 306 |
| 541 | 3300048904 | Ga0496101_0023939 | Ga0496101_0023939_1031_1960 | 306 |
| 542 | 3300048907 | Ga0496104_0011562 | Ga0496104_0011562_2310_3263 | 306 |
| 543 | 3300048908 | Ga0496105_0004299 | Ga0496105_0004299_9678_10607 | 306 |
| 544 | 3300048909 | Ga0496106_0080556 | Ga0496106_0080556_909_1835 | 306 |
| 545 | 3300048910 | Ga0496107_0037372 | Ga0496107_0037372_808_1737 | 306 |
| 546 | 3300048911 | Ga0496108_0372878 | Ga0496108_0372878_61_987 | 306 |
| 547 | 3300048912 | Ga0496109_0071342 | Ga0496109_0071342_2161_3090 | 306 |
| 548 | 3300048913 | Ga0496110_0305668 | Ga0496110_0305668_229_1158 | 306 |
| 549 | 3300048915 | Ga0496112_0001563 | Ga0496112_0001563_16116_17045 | 306 |
| 550 | 3300048917 | Ga0496114_0021269 | Ga0496114_0021269_3643_4572 | 306 |
| 551 | 3300048917 | Ga0496114_0031136 | Ga0496114_0031136_193_1119 | 306 |
| 552 | 3300048918 | Ga0496115_0125610 | Ga0496115_0125610_592_1512 | 306 |
| 553 | 3300048919 | Ga0496116_0013153 | Ga0496116_0013153_40_972 | 306 |
| 554 | 3300048920 | Ga0496117_0022126 | Ga0496117_0022126_708_1640 | 306 |
| 555 | 3300048920 | Ga0496117_0044020 | Ga0496117_0044020_2190_3110 | 306 |
| 556 | 3300048921 | Ga0496118_0029133 | Ga0496118_0029133_117_1037 | 306 |
| 557 | 3300048923 | Ga0496120_0040401 | Ga0496120_0040401_1215_2147 | 306 |
| 558 | 3300048924 | Ga0496121_0000157 | Ga0496121_0000157_102319_103251 | 306 |
| 559 | 3300048924 | Ga0496121_0006213 | Ga0496121_0006213_13155_14075 | 306 |
| 560 | 3300048924 | Ga0496121_0049065 | Ga0496121_0049065_805_1737 | 306 |
| 561 | 3300048925 | Ga0496122_0000330 | Ga0496122_0000330_67126_68058 | 306 |
| 562 | 3300048925 | Ga0496122_0092372 | Ga0496122_0092372_26_958 | 306 |
| 563 | 3300048926 | Ga0496123_0000449 | Ga0496123_0000449_3551_4483 | 306 |
| 564 | 3300048927 | Ga0496124_0077161 | Ga0496124_0077161_1200_2132 | 306 |
| 565 | 3300048928 | Ga0496125_0000028 | Ga0496125_0000028_247720_248652 | 306 |
| 566 | 3300048928 | Ga0496125_0020130 | Ga0496125_0020130_3288_4220 | 306 |
| 567 | 3300048928 | Ga0496125_0027602 | Ga0496125_0027602_102_1022 | 306 |
| 568 | 3300048929 | Ga0496126_0086776 | Ga0496126_0086776_1115_2047 | 306 |
| 569 | 3300049513 | Ga0501290_005461 | Ga0501290_005461_208_1134 | 306 |
| 570 | 3300049523 | Ga0501300_015448 | Ga0501300_015448_172_1092 | 306 |
| 571 | 3300049568 | Ga0501031_0000981 | Ga0501031_0000981_7603_8523 | 306 |
| 572 | 3300049569 | Ga0501032_0001882 | Ga0501032_0001882_9758_10678 | 306 |
| 573 | 3300049570 | Ga0501033_0007174 | Ga0501033_0007174_5291_6211 | 306 |
| 574 | 3300049571 | Ga0501034_0028036 | Ga0501034_0028036_2377_3297 | 306 |
| 575 | 3300049571 | Ga0501034_0060115 | Ga0501034_0060115_1527_2447 | 306 |
| 576 | 3300049572 | Ga0501036_0000457 | Ga0501036_0000457_3322_4242 | 306 |
| 577 | 3300049573 | Ga0501037_0004620 | Ga0501037_0004620_7613_8533 | 306 |
| 578 | 3300049573 | Ga0501037_0021935 | Ga0501037_0021935_1359_2279 | 306 |
| 579 | 3300049574 | Ga0501038_0002486 | Ga0501038_0002486_7009_7929 | 306 |
| 580 | 3300049574 | Ga0501038_0187165 | Ga0501038_0187165_468_1388 | 306 |
| 581 | 3300049577 | Ga0501041_0112393 | Ga0501041_0112393_199_1176 | 306 |
| 582 | 3300049579 | Ga0501043_0001931 | Ga0501043_0001931_13236_14156 | 306 |
| 583 | 3300049580 | Ga0501046_0011855 | Ga0501046_0011855_1422_2342 | 306 |
| 584 | 3300049580 | Ga0501046_0045786 | Ga0501046_0045786_2113_3033 | 306 |
| 585 | 3300049581 | Ga0501047_0003333 | Ga0501047_0003333_5480_6400 | 306 |
| 586 | 3300049581 | Ga0501047_0117809 | Ga0501047_0117809_366_1319 | 306 |
| 587 | 3300049585 | Ga0501069_0000469 | Ga0501069_0000469_17165_18118 | 306 |
| 588 | 3300049586 | Ga0501070_0000531 | Ga0501070_0000531_1203_2156 | 306 |
| 589 | 3300049587 | Ga0501071_0001663 | Ga0501071_0001663_2969_3946 | 306 |
| 590 | 3300049589 | Ga0501073_0005354 | Ga0501073_0005354_4450_5403 | 306 |
| 591 | 3300049589 | Ga0501073_0153081 | Ga0501073_0153081_18_995 | 306 |
| 592 | 3300049590 | Ga0501074_0004628 | Ga0501074_0004628_8094_9047 | 306 |
| 593 | 3300049591 | Ga0501075_0434884 | Ga0501075_0434884_35_955 | 306 |
| 594 | 3300049592 | Ga0501076_0023409 | Ga0501076_0023409_2074_3051 | 306 |
| 595 | 3300049592 | Ga0501076_0258499 | Ga0501076_0258499_300_1220 | 306 |
| 596 | 3300049741 | Ga0501079_0026598 | Ga0501079_0026598_2230_3183 | 306 |
| 597 | 3300049742 | Ga0501080_0003248 | Ga0501080_0003248_9784_10761 | 306 |
| 598 | 3300049742 | Ga0501080_0028302 | Ga0501080_0028302_3516_4469 | 306 |
| 599 | 3300049743 | Ga0501081_0006141 | Ga0501081_0006141_3302_4279 | 306 |
| 600 | 3300049744 | Ga0501083_0001601 | Ga0501083_0001601_10884_11837 | 306 |
| 601 | 3300049776 | Ga0501280_000307 | Ga0501280_000307_3886_4806 | 306 |
| 602 | 3300049822 | Ga0501035_0000848 | Ga0501035_0000848_8264_9184 | 306 |
| 603 | 3300049822 | Ga0501035_0015273 | Ga0501035_0015273_4644_5564 | 306 |
| 604 | 3300049823 | Ga0501044_0000336 | Ga0501044_0000336_24054_24974 | 306 |
| 605 | 3300049823 | Ga0501044_0002803 | Ga0501044_0002803_2999_3919 | 306 |
| 606 | 3300049823 | Ga0501044_0006254 | Ga0501044_0006254_8880_9800 | 306 |
| 607 | 3300049823 | Ga0501044_0027660 | Ga0501044_0027660_3594_4514 | 306 |
| 608 | 3300049823 | Ga0501044_0337351 | Ga0501044_0337351_84_1058 | 306 |
| 609 | 3300050493 | nmdc:mga0k408_43245_c1 | nmdc:mga0k408_43245_c1_294_1217 | 306 |
| 610 | 3300050507 | nmdc:mga05p37_1696_c1 | nmdc:mga05p37_1696_c1_16145_17113 | 306 |
| 611 | 3300050508 | nmdc:mga09592_112397_c1 | nmdc:mga09592_112397_c1_1270_2220 | 306 |
| 612 | 3300050508 | nmdc:mga09592_432_c1 | nmdc:mga09592_432_c1_16618_17586 | 306 |
| 613 | 3300050509 | nmdc:mga0qj67_7099_c1 | nmdc:mga0qj67_7099_c1_213_1187 | 306 |
| 614 | 3300050511 | nmdc:mga08y16_63414_c1 | nmdc:mga08y16_63414_c1_371_1339 | 306 |
| 615 | 3300050512 | nmdc:mga0n895_127075_c1 | nmdc:mga0n895_127075_c1_619_1548 | 306 |
| 616 | 3300050513 | nmdc:mga0rr50_152923_c1 | nmdc:mga0rr50_152923_c1_858_1787 | 306 |
| 617 | 3300050516 | nmdc:mga0sz30_18054_c1 | nmdc:mga0sz30_18054_c1_777_1787 | 306 |
| 618 | 3300053077 | Ga0495601_0000678 | Ga0495601_0000678_5762_6721 | 306 |
| 619 | 3300053077 | Ga0495601_0002100 | Ga0495601_0002100_6553_7509 | 306 |
| 620 | 3300053077 | Ga0495601_0108025 | Ga0495601_0108025_73_1032 | 306 |
| 621 | 3300053078 | Ga0495612_0075236 | Ga0495612_0075236_403_1323 | 306 |
| 622 | 3300053078 | Ga0495612_0090646 | Ga0495612_0090646_127_1047 | 306 |
| 623 | 3300053084 | Ga0495595_0003664 | Ga0495595_0003664_1870_2829 | 306 |
| 624 | 3300053084 | Ga0495595_0039283 | Ga0495595_0039283_926_1846 | 306 |
| 625 | 3300053090 | Ga0500646_0002822 | Ga0500646_0002822_769_1791 | 306 |
| 626 | 3300053133 | Ga0500655_003214 | Ga0500655_003214_1234_2256 | 306 |
| 627 | 3300060353 | Ga0501082_0203665 | Ga0501082_0203665_743_1696 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4whx-assembly1.cif.gz_E | x-ray crystal structure of an amino acid aminotransferase from burkholderia pseudomallei bound to the co-factor pyridoxal phosphate | 0.976 | 2 | 306 |
| 6nst-assembly1.cif.gz_B | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9758 | 2 | 306 |
| 6nst-assembly1.cif.gz_F | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9748 | 1 | 305 |
| 6nst-assembly1.cif.gz_A | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.974 | 1 | 305 |
| 6nst-assembly1.cif.gz_D | crystal structure of branched chain amino acid aminotransferase from pseudomonas aeruginosa | 0.9735 | 2 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3u0gF02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.982 | 129 | 294 | 3.20.10.10 |
| af_P0AB80_137_302_3.30.470.10 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain | 0.9818 | 138 | 294 | 3.30.470.10 |
| 6h65B02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9752 | 135 | 294 | 3.20.10.10 |
| af_I1JRF2_385_551_3.20.10.10 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9711 | 136 | 290 | 3.20.10.10 |
| 3u0gF02 | Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 | 0.9705 | 129 | 294 | 3.20.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A349S5M3-F1-model_v4 | branched-chain-amino-acid transaminase (EC 2.6.1.42) | 0.9941 | 173 | 306 |
GO:0005829
GO:0006532 GO:0009098 GO:0009099 GO:0052655 GO:0052656 |
| AF-A0A532D543-F1-model_v4 | Branched chain amino acid aminotransferase (EC 2.6.1.42) | 0.9936 | 170 | 306 |
GO:0005829
GO:0008652 GO:0009082 GO:0052655 GO:0052656 |
| AF-A0A2N2SIT2-F1-model_v4 | branched-chain-amino-acid transaminase (EC 2.6.1.42) | 0.9928 | 136 | 306 |
GO:0004084
GO:0005829 GO:0046394 |
| AF-A0A532E8X2-F1-model_v4 | Branched chain amino acid aminotransferase (EC 2.6.1.42) | 0.9927 | 139 | 306 |
GO:0005829
GO:0008652 GO:0009082 GO:0052655 GO:0052656 |
| AF-A0A3N5GLS2-F1-model_v4 | Branched-chain-amino-acid aminotransferase (BCAT) (EC 2.6.1.42) | 0.9915 | 93 | 306 |
GO:0005829
GO:0009097 GO:0009098 GO:0009099 GO:0052655 GO:0052656 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar