F470437

General Info

Members Datasets Scaffolds Average Seq Length
626 332 576 380

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100062367|Ga0070694_1000623673
Length 429
Sequence LPRWQGGWSEASGAFAFQNRKLPVRLRLTTPLSEGRQGSAVNARIEHFVCRDPWDPYEAEKLTPEQERFYRASQWQIMWWKFRRHRIAVAAAIVLALFYASILVSELLAPYNLHTRDTKHIYAPPQRIHFIDEGRFIGPFVYGYNMRLNMENLRREYTDDPAKVYRLRFFCLGDEYRFWGLLDGRFHLVCPADGGTLYVLGTDRLGRDLFSRIIYGTRISLTVGLFGIVVSFIIGLTLGGISGYYGGWIDTVIQRFIEMVRSFPELPLWMALSAALPVNWSPILVYFGITIILGLLDWPGLARAVRSKLLALREEDFATAAILMGASPARVIGRHLLPSFASHLIASATLSVPAMILGETALSFLGLGLRPPVTSWGVLLNEAQNINVVALYPWLMLSVVPVFIVVLAFNFFGDGLRDAADPYSSAARS

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
4 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
5 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
6 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
7 2643221629 Devosia sp. Root105 Isolate Unclassified
8 2643221662 Devosia sp. Root413D1 Isolate Unclassified
9 2643221736 Bosea sp. Root483D1 Isolate Unclassified
10 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
11 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
12 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
13 2818991467 Bosea vestrisii 3192 Isolate Unclassified
14 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
15 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
16 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
17 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
18 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
19 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
20 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
21 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
22 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
23 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
24 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
25 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
26 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
27 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
28 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
29 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
30 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
31 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
32 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
33 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
34 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
35 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
36 2902330777 Methylobacterium sp. 2A Isolate Unclassified
37 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
38 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
39 2909042592 Labrys sp. LIt4 Isolate Nodule
40 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
41 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
42 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
43 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
46 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
47 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
48 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
49 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
50 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
51 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
52 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
53 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
73 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
76 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
81 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
82 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
83 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
92 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
100 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
131 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
132 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
133 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
139 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
140 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
144 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
195 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
196 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
200 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
209 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
210 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
215 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
219 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
220 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
225 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
226 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
227 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
230 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
231 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
232 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
233 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
234 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
235 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
246 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
247 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
255 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
267 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
291 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
292 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
293 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
294 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
295 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
304 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
307 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
308 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
309 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
310 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
311 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
314 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
315 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
316 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
317 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
318 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
327 641522639 Methylobacterium sp. 4-46 Isolate Nodule
328 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
329 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
330 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
331 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
332 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.21
Metatranscriptomes 0.8
Isolates 7.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.55
Nodule 2.08
Rhizoplane 0.16
Rhizosphere 82.43
Stem 0
Stem Tuber 0
Unclassified 8.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000240 3300003187 Bacteria 64258
2 JGI25160J50197_1000079 3300003354 Bacteria 101859
3 JGI25160J50197_1013154 3300003354 Bacteria 2835
4 JGI25161J50226_1000060 3300003374 Bacteria 101859
5 Ga0055526_1000017 3300003771 Bacteria 210613
6 Ga0055543_1000086 3300004625 Bacteria 81231
7 Ga0065165_1000208 3300005262 Bacteria 101897
8 Ga0065165_1001191 3300005262 Bacteria 30063
9 Ga0065704_10079484 3300005289 Bacteria 4150
10 Ga0065707_10083698 3300005295 Bacteria 8411
11 Ga0070658_10081300 3300005327 Bacteria 2661
12 Ga0070690_100186454 3300005330 Bacteria 1436
13 Ga0070670_100008130 3300005331 Bacteria 8930
14 Ga0070670_100136567 3300005331 Bacteria 2119
15 Ga0070680_100143180 3300005336 Bacteria 2005
16 Ga0070680_100153392 3300005336 Bacteria 1934
17 Ga0070660_100075931 3300005339 Bacteria 2632
18 Ga0070689_100005772 3300005340 Bacteria 8487
19 Ga0070689_100022192 3300005340 Bacteria 4738
20 Ga0070692_10053247 3300005345 Bacteria 2109
21 Ga0070668_100017821 3300005347 Bacteria 5326
22 Ga0070669_100011416 3300005353 Bacteria 6307
23 Ga0070671_100012908 3300005355 Bacteria 6734
24 Ga0070673_100167648 3300005364 Bacteria 1873
25 Ga0070659_100217291 3300005366 Bacteria 1577
26 Ga0070713_100060613 3300005436 Bacteria 3163
27 Ga0070713_100171603 3300005436 Bacteria 1943
28 Ga0070710_10090830 3300005437 Bacteria 1801
29 Ga0070711_100020211 3300005439 Bacteria 4288
30 Ga0070705_100013871 3300005440 Bacteria 4131
31 Ga0070700_100013204 3300005441 Bacteria 4634
32 Ga0070700_100193699 3300005441 Bacteria 1423
33 Ga0070694_100062367 3300005444 Bacteria 2546
34 Ga0070678_100077663 3300005456 Bacteria 2506
35 Ga0070662_100145750 3300005457 Bacteria 1839
36 Ga0070681_10001653 3300005458 Bacteria 19898
37 Ga0070681_10006766 3300005458 Bacteria 11161
38 Ga0070681_10009814 3300005458 Bacteria 9428
39 Ga0068867_100001491 3300005459 Bacteria 16215
40 Ga0070706_100022333 3300005467 Bacteria 5827
41 Ga0070706_100027185 3300005467 Bacteria 5264
42 Ga0070706_100077413 3300005467 Bacteria 3078
43 Ga0070706_100228768 3300005467 Bacteria 1736
44 Ga0070706_100316802 3300005467 Bacteria 1455
45 Ga0070707_100015782 3300005468 Bacteria 7090
46 Ga0070698_100030391 3300005471 Bacteria 5601
47 Ga0070698_100035508 3300005471 Bacteria 5155
48 Ga0070698_100058330 3300005471 Bacteria 3903
49 Ga0070698_100084281 3300005471 Bacteria 3167
50 Ga0070698_100180773 3300005471 Bacteria 2048
51 Ga0070698_100187533 3300005471 Bacteria 2006
52 Ga0070698_100288933 3300005471 Bacteria 1571
53 Ga0070679_100010271 3300005530 Bacteria 8876
54 Ga0070679_100037525 3300005530 Bacteria 4814
55 Ga0070679_100096520 3300005530 Bacteria 2943
56 Ga0070679_100144647 3300005530 Bacteria 2356
57 Ga0070697_100013462 3300005536 Bacteria 6418
58 Ga0070697_100015339 3300005536 Bacteria 6014
59 Ga0070697_100093819 3300005536 Bacteria 2486
60 Ga0070697_100130463 3300005536 Bacteria 2107
61 Ga0068853_100087664 3300005539 Bacteria 2731
62 Ga0070695_100022343 3300005545 Bacteria 3880
63 Ga0070695_100042439 3300005545 Bacteria 2888
64 Ga0070696_100005400 3300005546 Bacteria 8523
65 Ga0070696_100012064 3300005546 Bacteria 5789
66 Ga0070665_100004527 3300005548 Bacteria 14562
67 Ga0070665_100037069 3300005548 Bacteria 4903
68 Ga0070704_100000515 3300005549 Bacteria 18450
69 Ga0070704_100041042 3300005549 Bacteria 3191
70 Ga0070704_100052921 3300005549 Bacteria 2867
71 Ga0070704_100195779 3300005549 Bacteria 1628
72 Ga0068855_100015362 3300005563 Bacteria 9217
73 Ga0068855_100158889 3300005563 Bacteria 2567
74 Ga0070664_100021043 3300005564 Bacteria 5373
75 Ga0068857_100064620 3300005577 Bacteria 3254
76 Ga0068856_100005040 3300005614 Bacteria 13076
77 Ga0068856_100016514 3300005614 Bacteria 7144
78 Ga0068856_100170252 3300005614 Bacteria 2190
79 Ga0068852_100034175 3300005616 Bacteria 4228
80 Ga0068859_100019534 3300005617 Bacteria 6808
81 Ga0068859_100033208 3300005617 Bacteria 5183
82 Ga0068859_100037857 3300005617 Bacteria 4841
83 Ga0068859_100060339 3300005617 Bacteria 3821
84 Ga0068859_100200672 3300005617 Bacteria 2079
85 Ga0068864_100029890 3300005618 Bacteria 4618
86 Ga0068864_100094173 3300005618 Bacteria 2646
87 Ga0068866_10020634 3300005718 Bacteria 3022
88 Ga0068861_100007086 3300005719 Bacteria 7672
89 Ga0068860_100029381 3300005843 Bacteria 5287
90 Ga0068860_100068680 3300005843 Bacteria 3367
91 Ga0068862_100003167 3300005844 Bacteria 14285
92 Ga0068862_100006557 3300005844 Bacteria 9656
93 Ga0068862_100045976 3300005844 Bacteria 3726
94 Ga0081455_10015319 3300005937 Bacteria 7456
95 Ga0081455_10033090 3300005937 Bacteria 4649
96 Ga0081455_10061993 3300005937 Bacteria 3144
97 Ga0081455_10095748 3300005937 Bacteria 2396
98 Ga0081538_10029744 3300005981 Bacteria 3724
99 Ga0081540_1052171 3300005983 Bacteria 2016
100 Ga0081539_10003913 3300005985 Bacteria 17302
101 Ga0081539_10006851 3300005985 Bacteria 10653
102 Ga0081539_10011372 3300005985 Bacteria 7045
103 Ga0081539_10012452 3300005985 Bacteria 6555
104 Ga0070717_10301491 3300006028 Bacteria 1424
105 Ga0075364_10015590 3300006051 Bacteria 4715
106 Ga0075364_10081909 3300006051 Bacteria 2134
107 Ga0070716_100196702 3300006173 Bacteria 1336
108 Ga0070712_100159088 3300006175 Bacteria 1743
109 Ga0075362_10033980 3300006177 Bacteria 2220
110 Ga0075362_10047463 3300006177 Bacteria 1913
111 Ga0075362_10061508 3300006177 Bacteria 1699
112 Ga0075369_10000726 3300006186 Bacteria 10639
113 Ga0075369_10027100 3300006186 Bacteria 2393
114 Ga0075366_10013681 3300006195 Bacteria 4625
115 Ga0075428_100084885 3300006844 Bacteria 3454
116 Ga0075428_100107602 3300006844 Bacteria 3039
117 Ga0075430_100003688 3300006846 Bacteria 12863
118 Ga0075430_100063925 3300006846 Bacteria 3091
119 Ga0075431_100039212 3300006847 Bacteria 4880
120 Ga0075431_100246673 3300006847 Unclassified 1815
121 Ga0075433_10015871 3300006852 Bacteria 6193
122 Ga0075433_10121532 3300006852 Bacteria 2319
123 Ga0075433_10144363 3300006852 Bacteria 2116
124 Ga0075433_10185143 3300006852 Bacteria 1853
125 Ga0075434_100000065 3300006871 Bacteria 54115
126 Ga0075434_100300131 3300006871 Bacteria 1627
127 Ga0075429_100000081 3300006880 Bacteria 49207
128 Ga0075429_100011596 3300006880 Bacteria 7645
129 Ga0075429_100026668 3300006880 Bacteria 5017
130 Ga0075429_100040281 3300006880 Bacteria 4066
131 Ga0075429_100068320 3300006880 Bacteria 3092
132 Ga0075429_100201720 3300006880 Bacteria 1743
133 Ga0075429_100275345 3300006880 Bacteria 1474
134 Ga0068865_100063020 3300006881 Bacteria 2605
135 Ga0075436_100003710 3300006914 Bacteria 10468
136 Ga0075436_100010046 3300006914 Bacteria 6477
137 Ga0075436_100050353 3300006914 Bacteria 2874
138 Ga0097620_100019532 3300006931 Bacteria 6808
139 Ga0097620_100033208 3300006931 Bacteria 5183
140 Ga0097620_100037854 3300006931 Bacteria 4841
141 Ga0097620_100060339 3300006931 Bacteria 3821
142 Ga0097620_100200653 3300006931 Bacteria 2079
143 Ga0075435_100007399 3300007076 Bacteria 7820
144 Ga0075435_100143233 3300007076 Bacteria 2006
145 Ga0105240_10006044 3300009093 Bacteria 17894
146 Ga0105240_10006997 3300009093 Bacteria 16474
147 Ga0105240_10037423 3300009093 Bacteria 6237
148 Ga0111539_10028395 3300009094 Bacteria 6826
149 Ga0111539_10058153 3300009094 Bacteria 4588
150 Ga0111539_10075054 3300009094 Bacteria 3984
151 Ga0111539_10084700 3300009094 Bacteria 3726
152 Ga0105245_10020034 3300009098 Bacteria 5863
153 Ga0114129_10000105 3300009147 Bacteria 82559
154 Ga0114129_10001937 3300009147 Bacteria 28321
155 Ga0114129_10006706 3300009147 Bacteria 16350
156 Ga0114129_10009096 3300009147 Bacteria 14157
157 Ga0114129_10009609 3300009147 Bacteria 13796
158 Ga0114129_10059554 3300009147 Bacteria 5338
159 Ga0114129_10117400 3300009147 Bacteria 3666
160 Ga0114129_10249333 3300009147 Bacteria 2384
161 Ga0114129_10353134 3300009147 Bacteria 1947
162 Ga0114129_10544629 3300009147 Bacteria 1510
163 Ga0105243_10013644 3300009148 Bacteria 6146
164 Ga0105243_10157033 3300009148 Bacteria 1957
165 Ga0105243_10311209 3300009148 Bacteria 1431
166 Ga0105241_10137448 3300009174 Bacteria 1986
167 Ga0105242_10001714 3300009176 Bacteria 17312
168 Ga0105237_10017905 3300009545 Bacteria 7342
169 Ga0105249_10007193 3300009553 Bacteria 9720
170 Ga0105249_10048567 3300009553 Bacteria 3869
171 Ga0105249_10050232 3300009553 Bacteria 3803
172 Ga0105249_10079618 3300009553 Bacteria 3042
173 Ga0105239_10150801 3300010375 Bacteria 2594
174 Ga0105246_10094138 3300011119 Bacteria 2166
175 Ga0105246_10120783 3300011119 Bacteria 1941
176 Ga0157373_10076729 3300013100 Bacteria 2358
177 Ga0157370_10010002 3300013104 Bacteria 10034
178 Ga0157370_10051289 3300013104 Bacteria 3941
179 Ga0157370_10096560 3300013104 Bacteria 2773
180 Ga0157370_10316730 3300013104 Bacteria 1439
181 Ga0157369_10376121 3300013105 Bacteria 1474
182 Ga0171462_1010 3300013250 Bacteria 310590
183 Ga0157378_10326893 3300013297 Bacteria 1491
184 Ga0163162_10091340 3300013306 Bacteria 3127
185 Ga0157372_10009907 3300013307 Bacteria 10135
186 Ga0157372_10103781 3300013307 Bacteria 3249
187 Ga0157372_10351214 3300013307 Bacteria 1718
188 Ga0157380_10017917 3300014326 Bacteria 5251
189 Ga0157380_10019458 3300014326 Bacteria 5060
190 Ga0213872_10020324 3300021361 Bacteria 3060
191 Ga0213874_10004203 3300021377 Bacteria 3258
192 Ga0213876_10000587 3300021384 Bacteria 27083
193 Ga0213876_10000696 3300021384 Bacteria 23686
194 Ga0213876_10003903 3300021384 Bacteria 8428
195 Ga0213875_10013767 3300021388 Bacteria 3960
196 Ga0213871_10000470 3300021441 Bacteria 5478
197 Ga0209130_1000100 3300025284 Bacteria 140260
198 Ga0209130_1000152 3300025284 Bacteria 105768
199 Ga0209130_1000282 3300025284 Bacteria 62561
200 Ga0209675_1004957 3300025291 Bacteria 5738
201 Ga0209676_1000019 3300025292 Bacteria 620012
202 Ga0209025_1000179 3300025294 Bacteria 157965
203 Ga0209025_1003239 3300025294 Bacteria 15724
204 Ga0209564_1000031 3300025295 Bacteria 494703
205 Ga0209050_1022853 3300025298 Unclassified 2225
206 Ga0209256_1022048 3300025299 Bacteria 1938
207 Ga0207426_1000017 3300025302 Bacteria 577913
208 Ga0207426_1000191 3300025302 Bacteria 151850
209 Ga0207426_1005348 3300025302 Bacteria 5896
210 Ga0207647_10135928 3300025904 Bacteria 1443
211 Ga0207643_10070498 3300025908 Bacteria 2010
212 Ga0207684_10215942 3300025910 Bacteria 1655
213 Ga0207707_10003059 3300025912 Bacteria 14860
214 Ga0207707_10011309 3300025912 Bacteria 7769
215 Ga0207707_10021779 3300025912 Bacteria 5602
216 Ga0207707_10128620 3300025912 Bacteria 2215
217 Ga0207695_10236334 3300025913 Bacteria 1730
218 Ga0207671_10015304 3300025914 Bacteria 6015
219 Ga0207660_10011685 3300025917 Bacteria 5726
220 Ga0207660_10028062 3300025917 Bacteria 3847
221 Ga0207657_10053758 3300025919 Bacteria 3487
222 Ga0207657_10068080 3300025919 Bacteria 3026
223 Ga0207652_10009301 3300025921 Bacteria 7901
224 Ga0207652_10010884 3300025921 Bacteria 7331
225 Ga0207652_10102676 3300025921 Bacteria 2527
226 Ga0207652_10332588 3300025921 Bacteria 1372
227 Ga0207646_10250071 3300025922 Bacteria 1601
228 Ga0207646_10270672 3300025922 Bacteria 1535
229 Ga0207681_10020982 3300025923 Bacteria 4146
230 Ga0207650_10018985 3300025925 Bacteria 4832
231 Ga0207700_10016384 3300025928 Bacteria 4922
232 Ga0207664_10108716 3300025929 Bacteria 2303
233 Ga0207644_10162167 3300025931 Bacteria 1739
234 Ga0207706_10097753 3300025933 Bacteria 2582
235 Ga0207686_10003305 3300025934 Bacteria 8672
236 Ga0207709_10015488 3300025935 Bacteria 4229
237 Ga0207709_10107026 3300025935 Bacteria 1861
238 Ga0207670_10023401 3300025936 Bacteria 3846
239 Ga0207670_10049336 3300025936 Bacteria 2815
240 Ga0207670_10149073 3300025936 Bacteria 1733
241 Ga0207670_10190848 3300025936 Bacteria 1550
242 Ga0207670_10208934 3300025936 Bacteria 1487
243 Ga0207665_10018852 3300025939 Bacteria 4535
244 Ga0207689_10085873 3300025942 Bacteria 2587
245 Ga0207661_10189429 3300025944 Bacteria 1802
246 Ga0207667_10039363 3300025949 Bacteria 5039
247 Ga0207667_10078570 3300025949 Bacteria 3420
248 Ga0207667_10135733 3300025949 Bacteria 2533
249 Ga0207651_10067291 3300025960 Bacteria 2521
250 Ga0207712_10072253 3300025961 Bacteria 2484
251 Ga0207668_10029022 3300025972 Bacteria 3623
252 Ga0207639_10044344 3300026041 Bacteria 3345
253 Ga0207708_10006718 3300026075 Bacteria 8509
254 Ga0207708_10024590 3300026075 Bacteria 4556
255 Ga0207708_10126290 3300026075 Bacteria 1997
256 Ga0207702_10009678 3300026078 Bacteria 8092
257 Ga0207702_10058352 3300026078 Bacteria 3284
258 Ga0207702_10114797 3300026078 Bacteria 2400
259 Ga0207648_10002662 3300026089 Bacteria 19053
260 Ga0207676_10023544 3300026095 Bacteria 4546
261 Ga0207676_10037938 3300026095 Bacteria 3676
262 Ga0207674_10221024 3300026116 Bacteria 1842
263 Ga0207675_100004370 3300026118 Bacteria 13660
264 Ga0207675_100165206 3300026118 Bacteria 2113
265 Ga0207683_10236506 3300026121 Bacteria 1666
266 Ga0209969_1001861 3300027360 Bacteria 2905
267 Ga0209967_1000550 3300027364 Bacteria 4930
268 Ga0209968_1002151 3300027526 Bacteria 2983
269 Ga0209999_1003291 3300027543 Bacteria 2882
270 Ga0209971_1001006 3300027682 Bacteria 7219
271 Ga0209971_1029952 3300027682 Bacteria 1303
272 Ga0207428_10083065 3300027907 Bacteria 2499
273 Ga0207428_10093314 3300027907 Bacteria 2335
274 Ga0268265_10001132 3300028380 Bacteria 23559
275 Ga0268265_10079768 3300028380 Bacteria 2579
276 Ga0268265_10144666 3300028380 Bacteria 1995
277 Ga0268264_10015528 3300028381 Bacteria 6243
278 Ga0268264_10052613 3300028381 Bacteria 3396
279 Ga0265340_10044346 3300031247 Bacteria 2176
280 Ga0265339_10029989 3300031249 Bacteria 3082
281 Ga0265331_10004567 3300031250 Bacteria 8618
282 Ga0265327_10013091 3300031251 Bacteria 5534
283 Ga0307513_10183288 3300031456 Bacteria 1954
284 Ga0265313_10000325 3300031595 Bacteria 51942
285 Ga0316575_10007457 3300031665 Bacteria 3962
286 Ga0316579_10002106 3300031691 Bacteria 7458
287 Ga0316579_10002804 3300031691 Bacteria 6665
288 Ga0316579_10005070 3300031691 Bacteria 5285
289 Ga0316579_10007589 3300031691 Bacteria 4488
290 Ga0265342_10008835 3300031712 Bacteria 7183
291 Ga0316578_10033911 3300031728 Bacteria 2928
292 Ga0316577_10000196 3300031733 Bacteria 20258
293 Ga0316577_10005746 3300031733 Bacteria 6518
294 Ga0316577_10007402 3300031733 Bacteria 5856
295 Ga0316577_10035869 3300031733 Bacteria 2772
296 Ga0316577_10098834 3300031733 Bacteria 1635
297 Ga0307410_10049094 3300031852 Bacteria 2831
298 Ga0307410_10081436 3300031852 Bacteria 2274
299 Ga0307410_10083814 3300031852 Bacteria 2246
300 Ga0307412_10066156 3300031911 Bacteria 2449
301 Ga0307416_100035482 3300032002 Bacteria 3809
302 Ga0307416_100079056 3300032002 Bacteria 2770
303 Ga0307416_100105586 3300032002 Bacteria 2466
304 Ga0307416_100315139 3300032002 Bacteria 1563
305 Ga0307411_10011514 3300032005 Bacteria 4779
306 Ga0316593_10000895 3300032168 Bacteria 6085
307 Ga0316593_10009955 3300032168 Bacteria 2708
308 Ga0373929_0012885 3300035085 Bacteria 1595
309 Ga0373936_0002667 3300035113 Bacteria 6671
310 Ga0373941_0042071 3300035115 Bacteria 1417
311 Ga0373954_0000094 3300035118 Bacteria 30419
312 Ga0316574_0004932 3300035398 Bacteria 7068
313 Ga0373935_0002303 3300035692 Bacteria 10889
314 Ga0373927_0012815 3300035695 Bacteria 5577
315 Ga0373927_0058828 3300035695 Bacteria 2486
316 Ga0373933_0006147 3300035724 Bacteria 6536
317 Ga0373937_0000449 3300036401 Bacteria 37990
318 Ga0373937_0184371 3300036401 Bacteria 1960
319 Ga0373937_0229066 3300036401 Bacteria 1750
320 Ga0316582_0000887 3300036647 Bacteria 12261
321 Ga0316582_0003909 3300036647 Bacteria 7429
322 Ga0316582_0015677 3300036647 Bacteria 4343
323 Ga0316582_0016608 3300036647 Bacteria 4237
324 Ga0316582_0029782 3300036647 Unclassified 3319
325 Ga0316582_0083189 3300036647 Bacteria 2094
326 Ga0316584_0001901 3300036712 Bacteria 12998
327 Ga0316584_0023182 3300036712 Bacteria 4535
328 Ga0316584_0036444 3300036712 Bacteria 3650
329 Ga0316584_0123974 3300036712 Bacteria 1930
330 Ga0316584_0210122 3300036712 Bacteria 1433
331 Ga0373925_0115571 3300037068 Bacteria 2078
332 Ga0373925_0306585 3300037068 Bacteria 1283
333 Ga0395899_0077748 3300037312 Bacteria 2419
334 Ga0395900_0003162 3300037418 Bacteria 17854
335 Ga0395900_0044584 3300037418 Bacteria 4568
336 Ga0395900_0191818 3300037418 Bacteria 2072
337 Ga0395898_0018654 3300037466 Bacteria 7072
338 Ga0395898_0461966 3300037466 Bacteria 1208
339 Ga0395905_0087430 3300037471 Bacteria 2922
340 Ga0316581_0004975 3300037588 Unclassified 3425
341 Ga0316581_0016129 3300037588 Bacteria 2142
342 Ga0316581_0018473 3300037588 Bacteria 2025
343 Ga0316581_0021660 3300037588 Bacteria 1891
344 Ga0316581_0022088 3300037588 Bacteria 1875
345 Ga0395901_0000716 3300038443 Bacteria 37850
346 Ga0395901_0004892 3300038443 Bacteria 13516
347 Ga0400483_038099 3300039062 Bacteria 4892
348 Ga0400483_069555 3300039062 Bacteria 2417
349 Ga0400483_115796 3300039062 Bacteria 2522
350 Ga0400483_202757 3300039062 Bacteria 2411
351 Ga0400483_264970 3300039062 Bacteria 1949
352 Ga0400483_270483 3300039062 Bacteria 15504
353 Ga0436365_0287509 3300039437 Bacteria 17014
354 Ga0436365_0440943 3300039437 Bacteria 12168
355 Ga0436365_1034188 3300039437 Bacteria 34077
356 Ga0436360_0814764 3300039438 Bacteria 6771
357 Ga0436361_0158562 3300039447 Bacteria 29012
358 Ga0436361_0690975 3300039447 Bacteria 2164
359 Ga0436363_0364582 3300039450 Bacteria 7635
360 Ga0436363_0684837 3300039450 Bacteria 10130
361 Ga0439453_0005601 3300041408 Bacteria 1919
362 Ga0439441_000406 3300042001 Bacteria 4518
363 Ga0439445_0014570 3300042004 Bacteria 1916
364 Ga0450923_023587 3300042125 Bacteria 1215
365 Ga0439434_0002555 3300042435 Bacteria 5298
366 Ga0439435_0000006 3300042436 Bacteria 24825
367 Ga0439435_0013530 3300042436 Bacteria 1997
368 Ga0439460_0002148 3300042461 Bacteria 4731
369 Ga0451577_0031762 3300042876 Bacteria 4764
370 Ga0451577_0169065 3300042876 Bacteria 1970
371 Ga0451577_0256871 3300042876 Bacteria 1582
372 Ga0466972_0061085 3300044658 Bacteria 1808
373 Ga0466963_0012243 3300044694 Bacteria 5246
374 Ga0466964_0025992 3300044706 Bacteria 2289
375 Ga0453684_0000770 3300044712 Bacteria 110820
376 Ga0453684_0005373 3300044712 Bacteria 25458
377 Ga0453684_0013741 3300044712 Bacteria 13096
378 Ga0453684_0018532 3300044712 Bacteria 10674
379 Ga0453684_0092923 3300044712 Bacteria 3717
380 Ga0453684_0237003 3300044712 Bacteria 2103
381 Ga0453684_0250943 3300044712 Bacteria 2032
382 Ga0466957_0104641 3300044842 Bacteria 1788
383 Ga0451576_0006617 3300045051 Bacteria 14166
384 Ga0451576_0043201 3300045051 Bacteria 4756
385 Ga0451576_0049186 3300045051 Bacteria 4425
386 Ga0451576_0182726 3300045051 Bacteria 2189
387 Ga0451576_0205265 3300045051 Bacteria 2058
388 Ga0466958_0125855 3300045836 Bacteria 1607
389 Ga0466967_0046146 3300045976 Bacteria 3791
390 Ga0495662_0002674 3300046476 Bacteria 9002
391 Ga0495608_0001424 3300046511 Bacteria 17020
392 Ga0495610_0054962 3300046512 Bacteria 1921
393 Ga0495610_0055155 3300046512 Bacteria 1917
394 Ga0495628_0011773 3300046516 Bacteria 7385
395 Ga0495630_0007240 3300046517 Bacteria 7916
396 Ga0495640_0000867 3300046533 Bacteria 23161
397 Ga0495587_0029656 3300046536 Bacteria 3321
398 Ga0495598_0020122 3300046537 Bacteria 1759
399 Ga0495667_0014441 3300046559 Bacteria 5336
400 Ga0495657_0041621 3300046675 Bacteria 3143
401 Ga0495599_0000904 3300046678 Bacteria 16610
402 Ga0495658_0014452 3300046683 Bacteria 4035
403 Ga0495669_0005551 3300046684 Bacteria 5262
404 Ga0495613_0001898 3300046689 Bacteria 15860
405 Ga0495649_0052549 3300046694 Bacteria 2208
406 Ga0495600_0007097 3300046809 Bacteria 6846
407 Ga0495604_0003544 3300047317 Bacteria 12450
408 Ga0495674_0012844 3300047319 Bacteria 7887
409 Ga0495680_0016229 3300047322 Bacteria 6404
410 Ga0495675_0050784 3300047444 Bacteria 2636
411 Ga0496106_0068447 3300048909 Bacteria 2708
412 Ga0496117_0011860 3300048920 Bacteria 7755
413 Ga0496117_0024275 3300048920 Bacteria 4801
414 Ga0496120_0032805 3300048923 Bacteria 3127
415 Ga0496121_0038629 3300048924 Bacteria 4221
416 Ga0496122_0003969 3300048925 Bacteria 18889
417 Ga0496122_0053594 3300048925 Bacteria 3039
418 Ga0496123_0007848 3300048926 Bacteria 9926
419 Ga0496126_0023040 3300048929 Bacteria 6040
420 Ga0496126_0052163 3300048929 Bacteria 3719
421 Ga0501031_0014450 3300049568 Bacteria 5131
422 Ga0501032_0000116 3300049569 Bacteria 67350
423 Ga0501032_0171455 3300049569 Bacteria 1423
424 Ga0501033_0000346 3300049570 Bacteria 44155
425 Ga0501033_0013797 3300049570 Bacteria 6146
426 Ga0501034_0002590 3300049571 Bacteria 21498
427 Ga0501034_0002641 3300049571 Bacteria 21239
428 Ga0501036_0000117 3300049572 Bacteria 49511
429 Ga0501036_0000940 3300049572 Bacteria 21876
430 Ga0501037_0000108 3300049573 Bacteria 77753
431 Ga0501037_0083928 3300049573 Bacteria 2308
432 Ga0501038_0000126 3300049574 Bacteria 64756
433 Ga0501039_0000003 3300049575 Bacteria 357424
434 Ga0501039_0000511 3300049575 Bacteria 28112
435 Ga0501040_0000929 3300049576 Bacteria 18421
436 Ga0501040_0009562 3300049576 Bacteria 6326
437 Ga0501040_0138102 3300049576 Bacteria 1716
438 Ga0501041_0003825 3300049577 Bacteria 8665
439 Ga0501041_0015763 3300049577 Bacteria 4490
440 Ga0501041_0051353 3300049577 Bacteria 2513
441 Ga0501042_0077622 3300049578 Bacteria 2378
442 Ga0501042_0141288 3300049578 Bacteria 1736
443 Ga0501043_0003930 3300049579 Bacteria 12190
444 Ga0501043_0018445 3300049579 Bacteria 5473
445 Ga0501043_0111919 3300049579 Bacteria 2144
446 Ga0501046_0002083 3300049580 Bacteria 18973
447 Ga0501046_0073929 3300049580 Bacteria 2644
448 Ga0501046_0089265 3300049580 Bacteria 2373
449 Ga0501047_0102822 3300049581 Bacteria 2737
450 Ga0501048_0000500 3300049582 Bacteria 27434
451 Ga0501048_0005968 3300049582 Bacteria 9273
452 Ga0501048_0039507 3300049582 Bacteria 3385
453 Ga0501048_0070918 3300049582 Bacteria 2460
454 Ga0501068_0192929 3300049584 Bacteria 1290
455 Ga0501069_0122916 3300049585 Bacteria 1483
456 Ga0501070_0048652 3300049586 Bacteria 3521
457 Ga0501070_0155295 3300049586 Bacteria 1887
458 Ga0501071_0005451 3300049587 Bacteria 8180
459 Ga0501071_0020063 3300049587 Bacteria 4644
460 Ga0501071_0051111 3300049587 Bacteria 2978
461 Ga0501071_0070189 3300049587 Bacteria 2552
462 Ga0501071_0153526 3300049587 Bacteria 1718
463 Ga0501072_0001628 3300049588 Bacteria 16803
464 Ga0501072_0003891 3300049588 Bacteria 11290
465 Ga0501072_0019870 3300049588 Bacteria 5198
466 Ga0501072_0034266 3300049588 Bacteria 3978
467 Ga0501072_0071949 3300049588 Bacteria 2732
468 Ga0501072_0242204 3300049588 Bacteria 1436
469 Ga0501074_0002133 3300049590 Bacteria 13672
470 Ga0501074_0031850 3300049590 Bacteria 3821
471 Ga0501074_0092473 3300049590 Bacteria 2166
472 Ga0501075_0000002 3300049591 Bacteria 202033
473 Ga0501075_0003321 3300049591 Bacteria 10755
474 Ga0501075_0010756 3300049591 Bacteria 6445
475 Ga0501075_0041538 3300049591 Bacteria 3446
476 Ga0501076_0000268 3300049592 Bacteria 32260
477 Ga0501076_0000687 3300049592 Bacteria 21786
478 Ga0501076_0003986 3300049592 Bacteria 10428
479 Ga0501076_0017805 3300049592 Bacteria 5402
480 Ga0501076_0056980 3300049592 Bacteria 3102
481 Ga0501076_0224411 3300049592 Bacteria 1535
482 Ga0501076_0272445 3300049592 Bacteria 1386
483 Ga0501076_0327520 3300049592 Bacteria 1257
484 Ga0501077_0000021 3300049593 Bacteria 78108
485 Ga0501077_0013701 3300049593 Bacteria 5082
486 Ga0501077_0042409 3300049593 Bacteria 2893
487 Ga0501077_0060173 3300049593 Bacteria 2411
488 Ga0501077_0073692 3300049593 Bacteria 2163
489 Ga0501079_0000401 3300049741 Bacteria 27968
490 Ga0501079_0039454 3300049741 Bacteria 3642
491 Ga0501079_0277571 3300049741 Bacteria 1310
492 Ga0501080_0002976 3300049742 Bacteria 14913
493 Ga0501080_0030672 3300049742 Bacteria 5009
494 Ga0501080_0051117 3300049742 Bacteria 3845
495 Ga0501080_0068228 3300049742 Bacteria 3308
496 Ga0501080_0129765 3300049742 Bacteria 2333
497 Ga0501080_0189912 3300049742 Bacteria 1888
498 Ga0501081_0000620 3300049743 Bacteria 20284
499 Ga0501081_0018655 3300049743 Bacteria 4610
500 Ga0501081_0043811 3300049743 Bacteria 3070
501 Ga0501035_0000032 3300049822 Bacteria 175435
502 Ga0501035_0062801 3300049822 Bacteria 3304
503 Ga0501035_0146981 3300049822 Bacteria 2047
504 Ga0501044_0003043 3300049823 Bacteria 18983
505 Ga0501044_0072919 3300049823 Bacteria 3490
506 Ga0501044_0139995 3300049823 Bacteria 2409
507 Ga0501045_0000078 3300049824 Bacteria 46366
508 Ga0501045_0024389 3300049824 Bacteria 4342
509 Ga0501045_0075694 3300049824 Bacteria 2479
510 nmdc:mga03683_3359_c1 3300050489 Bacteria 1935
511 nmdc:mga03683_4209_c1 3300050489 Bacteria 4744
512 nmdc:mga03683_51127_c1 3300050489 Bacteria 1724
513 nmdc:mga00v17_22780_c1 3300050491 Bacteria 3618
514 nmdc:mga0yw44_37252_c1 3300050492 Bacteria 2871
515 nmdc:mga05p37_133_c1 3300050507 Bacteria 68369
516 nmdc:mga05p37_150141_c1 3300050507 Bacteria 2851
517 nmdc:mga05p37_206171_c1 3300050507 Bacteria 2378
518 nmdc:mga05p37_243104_c1 3300050507 Bacteria 2163
519 nmdc:mga05p37_255_c1 3300050507 Bacteria 55016
520 nmdc:mga05p37_394_c1 3300050507 Bacteria 47366
521 nmdc:mga05p37_433285_c1 3300050507 Bacteria 1527
522 nmdc:mga05p37_50755_c1 3300050507 Bacteria 5102
523 nmdc:mga09592_1037_c1 3300050508 Bacteria 22052
524 nmdc:mga09592_18426_c1 3300050508 Bacteria 5727
525 nmdc:mga09592_26_c1 3300050508 Bacteria 84260
526 nmdc:mga0qj67_20558_c1 3300050509 Bacteria 5056
527 nmdc:mga0qj67_27202_c1 3300050509 Bacteria 4430
528 nmdc:mga0qj67_8646_c1 3300050509 Bacteria 7554
529 nmdc:mga0qj67_98279_c1 3300050509 Unclassified 2358
530 nmdc:mga06r32_103056_c1 3300050510 Bacteria 2802
531 nmdc:mga06r32_15737_c1 3300050510 Bacteria 6874
532 nmdc:mga06r32_21681_c1 3300050510 Bacteria 5933
533 nmdc:mga06r32_326577_c1 3300050510 Bacteria 1519
534 nmdc:mga08y16_125934_c1 3300050511 Unclassified 2665
535 nmdc:mga08y16_40019_c1 3300050511 Bacteria 4916
536 nmdc:mga08y16_65261_c1 3300050511 Bacteria 3800
537 nmdc:mga0n895_139860_c1 3300050512 Bacteria 2448
538 nmdc:mga0n895_268880_c1 3300050512 Bacteria 1729
539 nmdc:mga0n895_3697_c1 3300050512 Bacteria 12368
540 nmdc:mga0rr50_1932_c1 3300050513 Bacteria 11522
541 nmdc:mga0rr50_2786_c1 3300050513 Bacteria 9936
542 nmdc:mga0rr50_30898_c1 3300050513 Bacteria 3797
543 nmdc:mga08x19_1059_c1 3300050514 Bacteria 17205
544 nmdc:mga08x19_206146_c1 3300050514 Bacteria 1349
545 nmdc:mga08x19_5635_c1 3300050514 Bacteria 7399
546 nmdc:mga0a205_114745_c1 3300050515 Bacteria 2592
547 nmdc:mga0a205_200476_c1 3300050515 Bacteria 1886
548 nmdc:mga0a205_34615_c1 3300050515 Bacteria 4846
549 nmdc:mga0a205_364403_c1 3300050515 Bacteria 1311
550 nmdc:mga0a205_85848_c1 3300050515 Bacteria 3039
551 nmdc:mga0sz30_2311_c1 3300050516 Bacteria 6809
552 Ga0500643_023992 3300053087 Bacteria 1942
553 Ga0500647_0059087 3300053091 Bacteria 1844
554 Ga0500641_0001854 3300053096 Bacteria 7500
555 Ga0500658_0015511 3300053134 Bacteria 2830
556 Ga0500616_0004891 3300053153 Bacteria 9319
557 Ga0500552_000660 3300053733 Bacteria 3226
558 Ga0501084_0003296 3300054114 Bacteria 13060
559 Ga0501084_0096999 3300054114 Bacteria 2475
560 Ga0501084_0153225 3300054114 Bacteria 1943
561 Ga0501084_0255692 3300054114 Bacteria 1478
562 Ga0501084_0267631 3300054114 Bacteria 1443
563 Ga0587085_001383 3300059506 Unclassified 2221
564 Ga0587094_003076 3300059513 Bacteria 1784
565 Ga0587101_000286 3300059623 Bacteria 3243
566 Ga0501082_0003362 3300060353 Bacteria 13967
567 Ga0501082_0004466 3300060353 Bacteria 12218
568 Ga0501082_0044417 3300060353 Bacteria 3833
569 Ga0501082_0078376 3300060353 Bacteria 2850
570 Ga0501082_0168895 3300060353 Bacteria 1901
571 Ga0530510_0000007 3300061734 Bacteria 169436
572 Ga0530510_0000289 3300061734 Bacteria 31902
573 Ga0530510_0002860 3300061734 Bacteria 11867
574 Ga0530510_0069366 3300061734 Bacteria 2558
575 Ga0530510_0166146 3300061734 Bacteria 1633
576 Ga0530510_0281067 3300061734 Bacteria 1243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100041042 Ga0070704_1000410422 305
2 3300005843 Ga0068860_100068680 Ga0068860_1000686803 333
3 3300028381 Ga0268264_10052613 Ga0268264_100526132 333
4 3300049584 Ga0501068_0192929 Ga0501068_0192929_229_1278 333
5 3300009094 Ga0111539_10084700 Ga0111539_100847002 335
6 3300050511 nmdc:mga08y16_125934_c1 nmdc:mga08y16_125934_c1_332_1381 335
7 3300005549 Ga0070704_100052921 Ga0070704_1000529212 337
8 3300005441 Ga0070700_100193699 Ga0070700_1001936992 341
9 3300005457 Ga0070662_100145750 Ga0070662_1001457502 341
10 3300013306 Ga0163162_10091340 Ga0163162_100913402 341
11 3300025933 Ga0207706_10097753 Ga0207706_100977532 341
12 3300037588 Ga0316581_0022088 Ga0316581_0022088_600_1739 341
13 3300036647 Ga0316582_0003909 Ga0316582_0003909_5053_6219 342
14 3300036712 Ga0316584_0036444 Ga0316584_0036444_1676_2842 342
15 3300049742 Ga0501080_0068228 Ga0501080_0068228_2238_3281 342
16 3300025294 Ga0209025_1003239 Ga0209025_10032397 343
17 3300025299 Ga0209256_1022048 Ga0209256_10220482 343
18 3300025922 Ga0207646_10270672 Ga0207646_102706722 343
19 3300006880 Ga0075429_100026668 Ga0075429_1000266681 344
20 3300006847 Ga0075431_100246673 Ga0075431_1002466732 345
21 3300006880 Ga0075429_100068320 Ga0075429_1000683203 345
22 3300006880 Ga0075429_100275345 Ga0075429_1002753452 345
23 3300009147 Ga0114129_10009609 Ga0114129_100096098 345
24 3300044712 Ga0453684_0250943 Ga0453684_0250943_137_1309 345
25 3300050507 nmdc:mga05p37_50755_c1 nmdc:mga05p37_50755_c1_3194_4354 345
26 3300050509 nmdc:mga0qj67_98279_c1 nmdc:mga0qj67_98279_c1_848_2008 345
27 3300050515 nmdc:mga0a205_364403_c1 nmdc:mga0a205_364403_c1_73_1122 345
28 3300005336 Ga0070680_100143180 Ga0070680_1001431802 346
29 3300021361 Ga0213872_10020324 Ga0213872_100203242 346
30 3300042436 Ga0439435_0013530 Ga0439435_0013530_106_1263 346
31 3300005345 Ga0070692_10053247 Ga0070692_100532472 347
32 3300005347 Ga0070668_100017821 Ga0070668_1000178213 347
33 3300005353 Ga0070669_100011416 Ga0070669_1000114164 347
34 3300005441 Ga0070700_100013204 Ga0070700_1000132042 347
35 3300005459 Ga0068867_100001491 Ga0068867_1000014918 347
36 3300005536 Ga0070697_100093819 Ga0070697_1000938192 347
37 3300005718 Ga0068866_10020634 Ga0068866_100206343 347
38 3300005719 Ga0068861_100007086 Ga0068861_1000070864 347
39 3300005844 Ga0068862_100003167 Ga0068862_10000316710 347
40 3300006846 Ga0075430_100063925 Ga0075430_1000639253 347
41 3300006881 Ga0068865_100063020 Ga0068865_1000630202 347
42 3300009094 Ga0111539_10058153 Ga0111539_100581534 347
43 3300009148 Ga0105243_10013644 Ga0105243_100136443 347
44 3300009553 Ga0105249_10007193 Ga0105249_100071934 347
45 3300014326 Ga0157380_10019458 Ga0157380_100194582 347
46 3300025908 Ga0207643_10070498 Ga0207643_100704983 347
47 3300025923 Ga0207681_10020982 Ga0207681_100209822 347
48 3300025935 Ga0207709_10015488 Ga0207709_100154882 347
49 3300025972 Ga0207668_10029022 Ga0207668_100290224 347
50 3300026075 Ga0207708_10006718 Ga0207708_100067183 347
51 3300026089 Ga0207648_10002662 Ga0207648_100026627 347
52 3300026118 Ga0207675_100004370 Ga0207675_1000043709 347
53 3300027682 Ga0209971_1001006 Ga0209971_10010065 347
54 3300027907 Ga0207428_10083065 Ga0207428_100830652 347
55 3300027907 Ga0207428_10093314 Ga0207428_100933142 347
56 3300028380 Ga0268265_10001132 Ga0268265_1000113222 347
57 3300032002 Ga0307416_100079056 Ga0307416_1000790562 347
58 3300032002 Ga0307416_100105586 Ga0307416_1001055862 347
59 3300044842 Ga0466957_0104641 Ga0466957_0104641_734_1777 347
60 3300046537 Ga0495598_0020122 Ga0495598_0020122_461_1519 347
61 3300050509 nmdc:mga0qj67_27202_c1 nmdc:mga0qj67_27202_c1_445_1500 347
62 3300050510 nmdc:mga06r32_326577_c1 nmdc:mga06r32_326577_c1_24_1079 347
63 3300050511 nmdc:mga08y16_40019_c1 nmdc:mga08y16_40019_c1_1138_2196 347
64 3300044712 Ga0453684_0000770 Ga0453684_0000770_93293_94453 348
65 3300006880 Ga0075429_100201720 Ga0075429_1002017202 349
66 3300009147 Ga0114129_10544629 Ga0114129_105446292 349
67 3300009148 Ga0105243_10157033 Ga0105243_101570332 349
68 3300036712 Ga0316584_0210122 Ga0316584_0210122_58_1185 349
69 3300037588 Ga0316581_0021660 Ga0316581_0021660_101_1228 349
70 3300039450 Ga0436363_0364582 Ga0436363_0364582_5259_6443 349
71 3300059506 Ga0587085_001383 Ga0587085_001383_1080_2198 349
72 3300059513 Ga0587094_003076 Ga0587094_003076_209_1327 349
73 3300059623 Ga0587101_000286 Ga0587101_000286_1605_2723 349
74 3300003354 JGI25160J50197_1000079 JGI25160J50197_100007966 350
75 3300003374 JGI25161J50226_1000060 JGI25161J50226_100006066 350
76 3300004625 Ga0055543_1000086 Ga0055543_10000869 350
77 3300005262 Ga0065165_1000208 Ga0065165_100020866 350
78 3300009147 Ga0114129_10353134 Ga0114129_103531342 350
79 3300025284 Ga0209130_1000152 Ga0209130_100015231 350
80 3300025302 Ga0207426_1000017 Ga0207426_1000017426 350
81 3300048923 Ga0496120_0032805 Ga0496120_0032805_1748_2884 350
82 3300048924 Ga0496121_0038629 Ga0496121_0038629_1295_2431 350
83 3300050507 nmdc:mga05p37_433285_c1 nmdc:mga05p37_433285_c1_221_1339 350
84 3300031733 Ga0316577_10098834 Ga0316577_100988342 352
85 3300039062 Ga0400483_038099 Ga0400483_038099_1006_2154 353
86 3300039447 Ga0436361_0690975 Ga0436361_0690975_743_1906 353
87 iso_pu_bacteria 2524614857 2526061147 353
88 iso_pu_bacteria 2739367875 2740065059 353
89 3300005289 Ga0065704_10079484 Ga0065704_100794843 354
90 3300005295 Ga0065707_10083698 Ga0065707_100836984 354
91 3300005340 Ga0070689_100005772 Ga0070689_1000057725 354
92 3300005467 Ga0070706_100022333 Ga0070706_1000223334 354
93 3300005468 Ga0070707_100015782 Ga0070707_1000157823 354
94 3300005471 Ga0070698_100084281 Ga0070698_1000842812 354
95 3300005471 Ga0070698_100187533 Ga0070698_1001875332 354
96 3300005536 Ga0070697_100015339 Ga0070697_1000153393 354
97 3300005617 Ga0068859_100019534 Ga0068859_1000195344 354
98 3300005618 Ga0068864_100029890 Ga0068864_1000298904 354
99 3300005844 Ga0068862_100006557 Ga0068862_1000065574 354
100 3300006871 Ga0075434_100300131 Ga0075434_1003001312 354
101 3300006931 Ga0097620_100019532 Ga0097620_1000195324 354
102 3300025936 Ga0207670_10149073 Ga0207670_101490732 354
103 3300026095 Ga0207676_10023544 Ga0207676_100235442 354
104 3300028380 Ga0268265_10144666 Ga0268265_101446662 354
105 3300036647 Ga0316582_0029782 Ga0316582_0029782_2194_3273 354
106 3300037466 Ga0395898_0461966 Ga0395898_0461966_128_1192 354
107 3300042876 Ga0451577_0169065 Ga0451577_0169065_303_1481 354
108 3300050512 nmdc:mga0n895_139860_c1 nmdc:mga0n895_139860_c1_407_1567 354
109 3300050512 nmdc:mga0n895_268880_c1 nmdc:mga0n895_268880_c1_484_1596 354
110 3300021377 Ga0213874_10004203 Ga0213874_100042032 355
111 3300021384 Ga0213876_10000587 Ga0213876_100005874 355
112 3300021384 Ga0213876_10000696 Ga0213876_100006963 355
113 3300021388 Ga0213875_10013767 Ga0213875_100137672 355
114 3300031691 Ga0316579_10007589 Ga0316579_100075893 355
115 3300036647 Ga0316582_0000887 Ga0316582_0000887_10417_11556 355
116 3300037588 Ga0316581_0018473 Ga0316581_0018473_554_1690 355
117 3300039437 Ga0436365_0287509 Ga0436365_0287509_11040_12224 355
118 3300039437 Ga0436365_0440943 Ga0436365_0440943_6503_7687 355
119 3300039450 Ga0436363_0684837 Ga0436363_0684837_3275_4459 355
120 3300005262 Ga0065165_1001191 Ga0065165_100119113 356
121 3300006186 Ga0075369_10027100 Ga0075369_100271002 356
122 3300009147 Ga0114129_10059554 Ga0114129_100595543 356
123 3300013250 Ga0171462_1010 Ga0171462_1010262 356
124 3300025284 Ga0209130_1000100 Ga0209130_100010013 356
125 3300044712 Ga0453684_0237003 Ga0453684_0237003_526_1695 356
126 3300048920 Ga0496117_0011860 Ga0496117_0011860_6300_7439 356
127 3300048925 Ga0496122_0003969 Ga0496122_0003969_2568_3707 356
128 3300048926 Ga0496123_0007848 Ga0496123_0007848_5284_6423 356
129 3300050507 nmdc:mga05p37_150141_c1 nmdc:mga05p37_150141_c1_837_1997 356
130 3300050509 nmdc:mga0qj67_20558_c1 nmdc:mga0qj67_20558_c1_2060_3235 356
131 3300036712 Ga0316584_0123974 Ga0316584_0123974_657_1820 357
132 3300039062 Ga0400483_264970 Ga0400483_264970_519_1694 357
133 3300006844 Ga0075428_100107602 Ga0075428_1001076022 358
134 3300009147 Ga0114129_10001937 Ga0114129_100019373 358
135 3300021384 Ga0213876_10003903 Ga0213876_100039035 358
136 3300025291 Ga0209675_1004957 Ga0209675_10049573 358
137 3300039062 Ga0400483_069555 Ga0400483_069555_972_2135 358
138 3300039437 Ga0436365_1034188 Ga0436365_1034188_9350_10516 358
139 3300044658 Ga0466972_0061085 Ga0466972_0061085_54_1217 358
140 3300050507 nmdc:mga05p37_394_c1 nmdc:mga05p37_394_c1_25394_26584 358
141 3300050508 nmdc:mga09592_1037_c1 nmdc:mga09592_1037_c1_18503_19693 358
142 3300031852 Ga0307410_10083814 Ga0307410_100838142 360
143 3300049592 Ga0501076_0272445 Ga0501076_0272445_112_1272 360
144 3300037471 Ga0395905_0087430 Ga0395905_0087430_1728_2891 361
145 3300006880 Ga0075429_100011596 Ga0075429_1000115965 362
146 3300009147 Ga0114129_10006706 Ga0114129_1000670612 362
147 3300049823 Ga0501044_0072919 Ga0501044_0072919_1678_2847 362
148 3300050507 nmdc:mga05p37_243104_c1 nmdc:mga05p37_243104_c1_504_1682 362
149 3300050508 nmdc:mga09592_18426_c1 nmdc:mga09592_18426_c1_1959_3119 362
150 3300049570 Ga0501033_0013797 Ga0501033_0013797_1819_2961 363
151 3300049572 Ga0501036_0000940 Ga0501036_0000940_9650_10792 363
152 3300049575 Ga0501039_0000511 Ga0501039_0000511_19773_20915 363
153 3300049576 Ga0501040_0000929 Ga0501040_0000929_11959_13101 363
154 3300049579 Ga0501043_0018445 Ga0501043_0018445_4285_5427 363
155 3300049580 Ga0501046_0002083 Ga0501046_0002083_9922_11064 363
156 3300049582 Ga0501048_0000500 Ga0501048_0000500_15385_16527 363
157 3300049585 Ga0501069_0122916 Ga0501069_0122916_38_1180 363
158 3300049586 Ga0501070_0155295 Ga0501070_0155295_392_1534 363
159 3300049587 Ga0501071_0005451 Ga0501071_0005451_868_2010 363
160 3300049588 Ga0501072_0001628 Ga0501072_0001628_6793_7935 363
161 3300049590 Ga0501074_0002133 Ga0501074_0002133_7217_8359 363
162 3300049591 Ga0501075_0003321 Ga0501075_0003321_7783_8925 363
163 3300049592 Ga0501076_0000687 Ga0501076_0000687_9838_10980 363
164 3300049593 Ga0501077_0000021 Ga0501077_0000021_36576_37718 363
165 3300049741 Ga0501079_0000401 Ga0501079_0000401_12028_13170 363
166 3300049742 Ga0501080_0002976 Ga0501080_0002976_9521_10663 363
167 3300049743 Ga0501081_0000620 Ga0501081_0000620_7911_9053 363
168 3300049822 Ga0501035_0062801 Ga0501035_0062801_32_1174 363
169 3300049824 Ga0501045_0000078 Ga0501045_0000078_12333_13475 363
170 3300054114 Ga0501084_0003296 Ga0501084_0003296_3989_5131 363
171 3300060353 Ga0501082_0003362 Ga0501082_0003362_6870_8012 363
172 3300061734 Ga0530510_0000289 Ga0530510_0000289_4891_6033 363
173 3300061734 Ga0530510_0281067 Ga0530510_0281067_12_1103 363
174 iso_pu_bacteria 2643221629 2644164279 363
175 iso_pu_bacteria 2643221662 2644348051 363
176 3300031691 Ga0316579_10005070 Ga0316579_100050703 364
177 3300031733 Ga0316577_10005746 Ga0316577_100057465 364
178 3300039062 Ga0400483_270483 Ga0400483_270483_11315_12478 364
179 3300042125 Ga0450923_023587 Ga0450923_023587_57_1178 364
180 3300044712 Ga0453684_0005373 Ga0453684_0005373_10657_11829 364
181 iso_pu_bacteria 2643221736 2644745680 364
182 iso_pu_bacteria 2818991467 2819720074 364
183 iso_pu_bacteria 2841911363 2841914280 364
184 iso_pu_bacteria 2841917233 2841919724 364
185 iso_pu_bacteria 2867346516 2867349680 364
186 iso_pu_bacteria 2868088558 2868094780 364
187 iso_pu_bacteria 2868088558 2868094939 364
188 3300005340 Ga0070689_100022192 Ga0070689_1000221922 365
189 3300005471 Ga0070698_100288933 Ga0070698_1002889332 365
190 3300005617 Ga0068859_100200672 Ga0068859_1002006722 365
191 3300005844 Ga0068862_100045976 Ga0068862_1000459763 365
192 3300006931 Ga0097620_100200653 Ga0097620_1002006532 365
193 3300009147 Ga0114129_10249333 Ga0114129_102493332 365
194 3300009553 Ga0105249_10079618 Ga0105249_100796182 365
195 3300011119 Ga0105246_10094138 Ga0105246_100941382 365
196 3300025936 Ga0207670_10023401 Ga0207670_100234012 365
197 3300025936 Ga0207670_10190848 Ga0207670_101908482 365
198 3300026075 Ga0207708_10126290 Ga0207708_101262902 365
199 3300028380 Ga0268265_10079768 Ga0268265_100797682 365
200 3300032168 Ga0316593_10000895 Ga0316593_100008952 365
201 3300037588 Ga0316581_0004975 Ga0316581_0004975_160_1311 365
202 3300050507 nmdc:mga05p37_206171_c1 nmdc:mga05p37_206171_c1_385_1572 365
203 3300053087 Ga0500643_023992 Ga0500643_023992_723_1892 365
204 3300005467 Ga0070706_100027185 Ga0070706_1000271852 366
205 3300005471 Ga0070698_100030391 Ga0070698_1000303912 366
206 3300005618 Ga0068864_100094173 Ga0068864_1000941732 366
207 3300025292 Ga0209676_1000019 Ga0209676_1000019126 367
208 3300025298 Ga0209050_1022853 Ga0209050_10228532 367
209 3300036647 Ga0316582_0083189 Ga0316582_0083189_885_2012 367
210 3300003771 Ga0055526_1000017 Ga0055526_100001764 368
211 3300025295 Ga0209564_1000031 Ga0209564_1000031143 368
212 3300049581 Ga0501047_0102822 Ga0501047_0102822_176_1381 368
213 3300037068 Ga0373925_0306585 Ga0373925_0306585_107_1267 369
214 3300044712 Ga0453684_0092923 Ga0453684_0092923_2492_3643 369
215 3300045051 Ga0451576_0049186 Ga0451576_0049186_2311_3489 369
216 iso_pu_bacteria 8008485437 8008491131 369
217 iso_pu_bacteria 8025524527 8025530460 369
218 3300053733 Ga0500552_000660 Ga0500552_000660_509_1714 370
219 3300006051 Ga0075364_10015590 Ga0075364_100155902 371
220 3300031691 Ga0316579_10002106 Ga0316579_100021063 371
221 3300031733 Ga0316577_10007402 Ga0316577_100074023 371
222 3300036647 Ga0316582_0015677 Ga0316582_0015677_2395_3564 371
223 3300036712 Ga0316584_0001901 Ga0316584_0001901_9034_10203 371
224 3300050491 nmdc:mga00v17_22780_c1 nmdc:mga00v17_22780_c1_1369_2532 371
225 iso_pu_bacteria 2887443736 2887447069 371
226 3300005366 Ga0070659_100217291 Ga0070659_1002172911 372
227 3300005437 Ga0070710_10090830 Ga0070710_100908301 372
228 3300005439 Ga0070711_100020211 Ga0070711_1000202113 372
229 3300005530 Ga0070679_100037525 Ga0070679_1000375253 372
230 3300005546 Ga0070696_100005400 Ga0070696_1000054003 372
231 3300009093 Ga0105240_10037423 Ga0105240_100374232 372
232 3300013104 Ga0157370_10051289 Ga0157370_100512893 372
233 3300013307 Ga0157372_10103781 Ga0157372_101037813 372
234 3300006847 Ga0075431_100039212 Ga0075431_1000392122 373
235 3300009147 Ga0114129_10117400 Ga0114129_101174003 373
236 3300031665 Ga0316575_10007457 Ga0316575_100074573 373
237 3300031691 Ga0316579_10002804 Ga0316579_100028042 373
238 3300031733 Ga0316577_10035869 Ga0316577_100358692 373
239 3300032168 Ga0316593_10009955 Ga0316593_100099552 373
240 3300035398 Ga0316574_0004932 Ga0316574_0004932_2364_3539 373
241 3300036647 Ga0316582_0016608 Ga0316582_0016608_1874_3013 373
242 3300037068 Ga0373925_0115571 Ga0373925_0115571_22_1263 373
243 3300037588 Ga0316581_0016129 Ga0316581_0016129_829_1968 373
244 3300044712 Ga0453684_0018532 Ga0453684_0018532_2177_3370 373
245 3300049568 Ga0501031_0014450 Ga0501031_0014450_3090_4259 373
246 3300049569 Ga0501032_0000116 Ga0501032_0000116_26391_27560 373
247 3300049570 Ga0501033_0000346 Ga0501033_0000346_32225_33394 373
248 3300049571 Ga0501034_0002641 Ga0501034_0002641_10762_11931 373
249 3300049572 Ga0501036_0000117 Ga0501036_0000117_16341_17510 373
250 3300049573 Ga0501037_0000108 Ga0501037_0000108_41305_42474 373
251 3300049574 Ga0501038_0000126 Ga0501038_0000126_26263_27432 373
252 3300049575 Ga0501039_0000003 Ga0501039_0000003_192385_193554 373
253 3300049579 Ga0501043_0003930 Ga0501043_0003930_1496_2665 373
254 3300049822 Ga0501035_0000032 Ga0501035_0000032_163633_164802 373
255 3300049823 Ga0501044_0003043 Ga0501044_0003043_1362_2531 373
256 3300050510 nmdc:mga06r32_21681_c1 nmdc:mga06r32_21681_c1_4436_5587 373
257 3300031733 Ga0316577_10000196 Ga0316577_100001967 374
258 3300036712 Ga0316584_0023182 Ga0316584_0023182_977_2158 374
259 3300044712 Ga0453684_0013741 Ga0453684_0013741_968_2161 374
260 3300050507 nmdc:mga05p37_255_c1 nmdc:mga05p37_255_c1_35834_36970 374
261 3300054114 Ga0501084_0267631 Ga0501084_0267631_241_1377 374
262 iso_pu_bacteria 2837268691 2837275709 374
263 3300031728 Ga0316578_10033911 Ga0316578_100339112 375
264 3300049576 Ga0501040_0138102 Ga0501040_0138102_311_1450 375
265 3300049577 Ga0501041_0051353 Ga0501041_0051353_796_1935 375
266 3300049587 Ga0501071_0153526 Ga0501071_0153526_139_1278 375
267 3300049588 Ga0501072_0242204 Ga0501072_0242204_178_1317 375
268 3300049591 Ga0501075_0041538 Ga0501075_0041538_44_1183 375
269 3300049592 Ga0501076_0224411 Ga0501076_0224411_219_1358 375
270 3300049593 Ga0501077_0013701 Ga0501077_0013701_487_1626 375
271 3300049741 Ga0501079_0277571 Ga0501079_0277571_70_1209 375
272 3300049742 Ga0501080_0189912 Ga0501080_0189912_653_1792 375
273 3300060353 Ga0501082_0168895 Ga0501082_0168895_679_1818 375
274 iso_pu_bacteria 2885526491 2885528893 375
275 iso_pu_bacteria 2904162308 2904168245 375
276 3300005331 Ga0070670_100136567 Ga0070670_1001365672 376
277 3300005355 Ga0070671_100012908 Ga0070671_1000129085 376
278 3300005617 Ga0068859_100060339 Ga0068859_1000603392 376
279 3300006852 Ga0075433_10121532 Ga0075433_101215322 376
280 3300006931 Ga0097620_100060339 Ga0097620_1000603392 376
281 3300009094 Ga0111539_10075054 Ga0111539_100750542 376
282 3300009147 Ga0114129_10000105 Ga0114129_1000010527 376
283 3300009553 Ga0105249_10048567 Ga0105249_100485672 376
284 3300014326 Ga0157380_10017917 Ga0157380_100179171 376
285 3300032002 Ga0307416_100315139 Ga0307416_1003151392 376
286 3300048909 Ga0496106_0068447 Ga0496106_0068447_591_1733 376
287 3300049569 Ga0501032_0171455 Ga0501032_0171455_254_1396 376
288 3300049577 Ga0501041_0015763 Ga0501041_0015763_447_1589 376
289 3300049578 Ga0501042_0077622 Ga0501042_0077622_327_1469 376
290 3300049579 Ga0501043_0111919 Ga0501043_0111919_989_2131 376
291 3300049580 Ga0501046_0073929 Ga0501046_0073929_1300_2442 376
292 3300049582 Ga0501048_0005968 Ga0501048_0005968_539_1681 376
293 3300049582 Ga0501048_0039507 Ga0501048_0039507_1821_2963 376
294 3300049587 Ga0501071_0020063 Ga0501071_0020063_3344_4486 376
295 3300049587 Ga0501071_0070189 Ga0501071_0070189_472_1614 376
296 3300049588 Ga0501072_0019870 Ga0501072_0019870_3326_4468 376
297 3300049588 Ga0501072_0071949 Ga0501072_0071949_443_1585 376
298 3300049591 Ga0501075_0000002 Ga0501075_0000002_83267_84409 376
299 3300049591 Ga0501075_0010756 Ga0501075_0010756_3283_4425 376
300 3300049592 Ga0501076_0000268 Ga0501076_0000268_9531_10673 376
301 3300049592 Ga0501076_0017805 Ga0501076_0017805_444_1586 376
302 3300049592 Ga0501076_0056980 Ga0501076_0056980_426_1568 376
303 3300049593 Ga0501077_0073692 Ga0501077_0073692_910_2052 376
304 3300049741 Ga0501079_0039454 Ga0501079_0039454_1730_2872 376
305 3300049742 Ga0501080_0051117 Ga0501080_0051117_2291_3433 376
306 3300049742 Ga0501080_0129765 Ga0501080_0129765_1093_2235 376
307 3300049743 Ga0501081_0018655 Ga0501081_0018655_832_1974 376
308 3300049743 Ga0501081_0043811 Ga0501081_0043811_1202_2344 376
309 3300049824 Ga0501045_0024389 Ga0501045_0024389_1384_2526 376
310 3300050515 nmdc:mga0a205_85848_c1 nmdc:mga0a205_85848_c1_520_1662 376
311 3300054114 Ga0501084_0153225 Ga0501084_0153225_684_1826 376
312 3300060353 Ga0501082_0004466 Ga0501082_0004466_9407_10549 376
313 3300061734 Ga0530510_0000007 Ga0530510_0000007_132229_133371 376
314 3300061734 Ga0530510_0069366 Ga0530510_0069366_313_1455 376
315 3300061734 Ga0530510_0166146 Ga0530510_0166146_58_1200 376
316 3300005458 Ga0070681_10006766 Ga0070681_100067664 377
317 3300005467 Ga0070706_100316802 Ga0070706_1003168021 377
318 3300005530 Ga0070679_100010271 Ga0070679_1000102712 377
319 3300005563 Ga0068855_100158889 Ga0068855_1001588893 377
320 3300005614 Ga0068856_100005040 Ga0068856_1000050406 377
321 3300005617 Ga0068859_100033208 Ga0068859_1000332083 377
322 3300006931 Ga0097620_100033208 Ga0097620_1000332083 377
323 3300009174 Ga0105241_10137448 Ga0105241_101374482 377
324 3300013100 Ga0157373_10076729 Ga0157373_100767292 377
325 3300013104 Ga0157370_10316730 Ga0157370_103167302 377
326 3300013307 Ga0157372_10009907 Ga0157372_100099075 377
327 3300025912 Ga0207707_10011309 Ga0207707_100113094 377
328 3300025917 Ga0207660_10028062 Ga0207660_100280623 377
329 3300025921 Ga0207652_10009301 Ga0207652_100093012 377
330 3300025949 Ga0207667_10078570 Ga0207667_100785703 377
331 3300025961 Ga0207712_10072253 Ga0207712_100722532 377
332 3300026078 Ga0207702_10058352 Ga0207702_100583522 377
333 3300026121 Ga0207683_10236506 Ga0207683_102365061 377
334 3300049571 Ga0501034_0002590 Ga0501034_0002590_15115_16299 377
335 3300049592 Ga0501076_0327520 Ga0501076_0327520_26_1171 377
336 iso_pu_bacteria 2883821847 2883824977 377
337 iso_pu_bacteria 2902330777 2902333392 377
338 iso_pu_bacteria 2902405164 2902407021 377
339 iso_pu_bacteria 2928125067 2928127201 377
340 3300025910 Ga0207684_10215942 Ga0207684_102159422 378
341 3300031251 Ga0265327_10013091 Ga0265327_100130912 378
342 3300005937 Ga0081455_10033090 Ga0081455_100330904 379
343 3300005981 Ga0081538_10029744 Ga0081538_100297443 379
344 3300005985 Ga0081539_10003913 Ga0081539_1000391317 379
345 3300005985 Ga0081539_10012452 Ga0081539_100124529 379
346 3300006051 Ga0075364_10081909 Ga0075364_100819092 379
347 3300006177 Ga0075362_10047463 Ga0075362_100474632 379
348 3300006177 Ga0075362_10061508 Ga0075362_100615081 379
349 3300006186 Ga0075369_10000726 Ga0075369_1000072610 379
350 3300006195 Ga0075366_10013681 Ga0075366_100136817 379
351 3300011119 Ga0105246_10120783 Ga0105246_101207832 379
352 3300026118 Ga0207675_100165206 Ga0207675_1001652062 379
353 3300050489 nmdc:mga03683_3359_c1 nmdc:mga03683_3359_c1_456_1634 379
354 3300050489 nmdc:mga03683_4209_c1 nmdc:mga03683_4209_c1_2829_4007 379
355 3300050492 nmdc:mga0yw44_37252_c1 nmdc:mga0yw44_37252_c1_131_1324 379
356 3300050516 nmdc:mga0sz30_2311_c1 nmdc:mga0sz30_2311_c1_2202_3380 379
357 iso_pu_bacteria 2837678835 2837681188 379
358 iso_pu_bacteria 2894817345 2894821498 379
359 iso_pu_bacteria 8045864390 8045867167 379
360 3300005336 Ga0070680_100153392 Ga0070680_1001533922 380
361 3300005440 Ga0070705_100013871 Ga0070705_1000138714 380
362 3300005536 Ga0070697_100013462 Ga0070697_1000134624 380
363 3300005549 Ga0070704_100195779 Ga0070704_1001957791 380
364 3300005985 Ga0081539_10011372 Ga0081539_100113722 380
365 3300006844 Ga0075428_100084885 Ga0075428_1000848853 380
366 3300006846 Ga0075430_100003688 Ga0075430_10000368813 380
367 3300006852 Ga0075433_10015871 Ga0075433_100158713 380
368 3300006852 Ga0075433_10144363 Ga0075433_101443632 380
369 3300006852 Ga0075433_10185143 Ga0075433_101851432 380
370 3300006871 Ga0075434_100000065 Ga0075434_10000006510 380
371 3300006880 Ga0075429_100040281 Ga0075429_1000402815 380
372 3300006914 Ga0075436_100003710 Ga0075436_1000037105 380
373 3300006914 Ga0075436_100010046 Ga0075436_1000100464 380
374 3300007076 Ga0075435_100007399 Ga0075435_1000073996 380
375 3300007076 Ga0075435_100143233 Ga0075435_1001432332 380
376 3300025936 Ga0207670_10208934 Ga0207670_102089342 380
377 3300025942 Ga0207689_10085873 Ga0207689_100858732 380
378 3300026075 Ga0207708_10024590 Ga0207708_100245903 380
379 3300026095 Ga0207676_10037938 Ga0207676_100379382 380
380 3300027360 Ga0209969_1001861 Ga0209969_10018613 380
381 3300027364 Ga0209967_1000550 Ga0209967_10005503 380
382 3300027526 Ga0209968_1002151 Ga0209968_10021513 380
383 3300027543 Ga0209999_1003291 Ga0209999_10032911 380
384 3300027682 Ga0209971_1029952 Ga0209971_10299522 380
385 3300032002 Ga0307416_100035482 Ga0307416_1000354822 380
386 3300032005 Ga0307411_10011514 Ga0307411_100115144 380
387 3300035118 Ga0373954_0000094 Ga0373954_0000094_22247_23425 380
388 3300035724 Ga0373933_0006147 Ga0373933_0006147_700_1878 380
389 3300036401 Ga0373937_0000449 Ga0373937_0000449_3730_4908 380
390 3300041408 Ga0439453_0005601 Ga0439453_0005601_686_1870 380
391 3300042435 Ga0439434_0002555 Ga0439434_0002555_1778_2956 380
392 3300042436 Ga0439435_0000006 Ga0439435_0000006_14517_15695 380
393 3300042461 Ga0439460_0002148 Ga0439460_0002148_3109_4293 380
394 3300042876 Ga0451577_0031762 Ga0451577_0031762_3553_4743 380
395 3300042876 Ga0451577_0256871 Ga0451577_0256871_152_1342 380
396 3300044706 Ga0466964_0025992 Ga0466964_0025992_163_1341 380
397 3300045051 Ga0451576_0043201 Ga0451576_0043201_2104_3282 380
398 3300045051 Ga0451576_0182726 Ga0451576_0182726_534_1703 380
399 3300045836 Ga0466958_0125855 Ga0466958_0125855_64_1242 380
400 3300045976 Ga0466967_0046146 Ga0466967_0046146_1039_2217 380
401 3300046476 Ga0495662_0002674 Ga0495662_0002674_5902_7071 380
402 3300046511 Ga0495608_0001424 Ga0495608_0001424_9172_10341 380
403 3300046516 Ga0495628_0011773 Ga0495628_0011773_2684_3853 380
404 3300046517 Ga0495630_0007240 Ga0495630_0007240_3607_4776 380
405 3300046533 Ga0495640_0000867 Ga0495640_0000867_15325_16494 380
406 3300046536 Ga0495587_0029656 Ga0495587_0029656_1251_2420 380
407 3300046559 Ga0495667_0014441 Ga0495667_0014441_4022_5191 380
408 3300046675 Ga0495657_0041621 Ga0495657_0041621_1010_2188 380
409 3300046678 Ga0495599_0000904 Ga0495599_0000904_11400_12569 380
410 3300046683 Ga0495658_0014452 Ga0495658_0014452_448_1617 380
411 3300046684 Ga0495669_0005551 Ga0495669_0005551_833_1996 380
412 3300046689 Ga0495613_0001898 Ga0495613_0001898_14655_15824 380
413 3300046809 Ga0495600_0007097 Ga0495600_0007097_372_1541 380
414 3300047317 Ga0495604_0003544 Ga0495604_0003544_2271_3440 380
415 3300047319 Ga0495674_0012844 Ga0495674_0012844_753_1922 380
416 3300047322 Ga0495680_0016229 Ga0495680_0016229_2711_3880 380
417 3300047444 Ga0495675_0050784 Ga0495675_0050784_517_1686 380
418 3300049577 Ga0501041_0003825 Ga0501041_0003825_344_1513 380
419 3300050509 nmdc:mga0qj67_8646_c1 nmdc:mga0qj67_8646_c1_5699_6868 380
420 3300050510 nmdc:mga06r32_103056_c1 nmdc:mga06r32_103056_c1_86_1255 380
421 3300050512 nmdc:mga0n895_3697_c1 nmdc:mga0n895_3697_c1_7400_8584 380
422 3300050513 nmdc:mga0rr50_1932_c1 nmdc:mga0rr50_1932_c1_7716_8900 380
423 3300050513 nmdc:mga0rr50_2786_c1 nmdc:mga0rr50_2786_c1_6198_7367 380
424 3300050513 nmdc:mga0rr50_30898_c1 nmdc:mga0rr50_30898_c1_2391_3560 380
425 3300050514 nmdc:mga08x19_1059_c1 nmdc:mga08x19_1059_c1_8750_9916 380
426 3300050514 nmdc:mga08x19_206146_c1 nmdc:mga08x19_206146_c1_120_1295 380
427 3300050514 nmdc:mga08x19_5635_c1 nmdc:mga08x19_5635_c1_2810_3976 380
428 3300050515 nmdc:mga0a205_114745_c1 nmdc:mga0a205_114745_c1_878_2062 380
429 3300050515 nmdc:mga0a205_200476_c1 nmdc:mga0a205_200476_c1_459_1628 380
430 3300050515 nmdc:mga0a205_34615_c1 nmdc:mga0a205_34615_c1_2036_3205 380
431 3300054114 Ga0501084_0255692 Ga0501084_0255692_112_1290 380
432 iso_pu_bacteria 2791355123 2792747447 380
433 iso_pu_bacteria 2842333319 2842335399 380
434 iso_pu_bacteria 2874168670 2874172262 380
435 iso_pu_bacteria 2909042592 2909044644 380
436 iso_pu_bacteria 2937822353 2937823481 380
437 iso_pu_bacteria 2996336353 2996339202 380
438 3300005937 Ga0081455_10061993 Ga0081455_100619933 381
439 3300039062 Ga0400483_115796 Ga0400483_115796_384_1538 381
440 iso_pu_bacteria 2545555834 2545678871 381
441 iso_pu_bacteria 2595698237 2596373276 381
442 iso_pu_bacteria 641522639 641646568 381
443 iso_pu_bacteria 643348564 643604784 381
444 3300005436 Ga0070713_100171603 Ga0070713_1001716032 382
445 3300005458 Ga0070681_10001653 Ga0070681_1000165313 382
446 3300005530 Ga0070679_100144647 Ga0070679_1001446472 382
447 3300025912 Ga0207707_10003059 Ga0207707_100030598 382
448 3300025921 Ga0207652_10010884 Ga0207652_100108843 382
449 3300037418 Ga0395900_0191818 Ga0395900_0191818_103_1293 382
450 iso_pu_bacteria 2508501050 2508733578 382
451 iso_pu_bacteria 2508501114 2509079639 382
452 iso_pu_bacteria 2775506901 2776261483 382
453 iso_pu_bacteria 2835312727 2835317931 382
454 iso_pu_bacteria 2884298095 2884299477 382
455 iso_pu_bacteria 2894232714 2894239220 382
456 3300005327 Ga0070658_10081300 Ga0070658_100813001 383
457 3300005330 Ga0070690_100186454 Ga0070690_1001864542 383
458 3300005331 Ga0070670_100008130 Ga0070670_1000081304 383
459 3300005339 Ga0070660_100075931 Ga0070660_1000759312 383
460 3300005458 Ga0070681_10009814 Ga0070681_100098146 383
461 3300005467 Ga0070706_100228768 Ga0070706_1002287682 383
462 3300005471 Ga0070698_100180773 Ga0070698_1001807732 383
463 3300005530 Ga0070679_100096520 Ga0070679_1000965203 383
464 3300005545 Ga0070695_100042439 Ga0070695_1000424393 383
465 3300005548 Ga0070665_100004527 Ga0070665_1000045274 383
466 3300005563 Ga0068855_100015362 Ga0068855_1000153623 383
467 3300005614 Ga0068856_100170252 Ga0068856_1001702522 383
468 3300005843 Ga0068860_100029381 Ga0068860_1000293814 383
469 3300009093 Ga0105240_10006997 Ga0105240_100069978 383
470 3300009098 Ga0105245_10020034 Ga0105245_100200344 383
471 3300009176 Ga0105242_10001714 Ga0105242_100017142 383
472 3300025904 Ga0207647_10135928 Ga0207647_101359281 383
473 3300025912 Ga0207707_10021779 Ga0207707_100217797 383
474 3300025917 Ga0207660_10011685 Ga0207660_100116852 383
475 3300025919 Ga0207657_10068080 Ga0207657_100680802 383
476 3300025921 Ga0207652_10102676 Ga0207652_101026762 383
477 3300025925 Ga0207650_10018985 Ga0207650_100189853 383
478 3300025934 Ga0207686_10003305 Ga0207686_100033054 383
479 3300025949 Ga0207667_10135733 Ga0207667_101357332 383
480 3300028381 Ga0268264_10015528 Ga0268264_100155284 383
481 3300031456 Ga0307513_10183288 Ga0307513_101832882 383
482 3300039062 Ga0400483_202757 Ga0400483_202757_135_1298 383
483 3300039447 Ga0436361_0158562 Ga0436361_0158562_13572_14729 383
484 3300049580 Ga0501046_0089265 Ga0501046_0089265_1106_2287 383
485 3300053091 Ga0500647_0059087 Ga0500647_0059087_235_1401 383
486 iso_pu_bacteria 3003665799 3003667926 383
487 3300005364 Ga0070673_100167648 Ga0070673_1001676482 384
488 3300005456 Ga0070678_100077663 Ga0070678_1000776632 384
489 3300005471 Ga0070698_100058330 Ga0070698_1000583303 384
490 3300005539 Ga0068853_100087664 Ga0068853_1000876643 384
491 3300005548 Ga0070665_100037069 Ga0070665_1000370691 384
492 3300005549 Ga0070704_100000515 Ga0070704_10000051519 384
493 3300005564 Ga0070664_100021043 Ga0070664_1000210431 384
494 3300005577 Ga0068857_100064620 Ga0068857_1000646202 384
495 3300005614 Ga0068856_100016514 Ga0068856_1000165147 384
496 3300005616 Ga0068852_100034175 Ga0068852_1000341753 384
497 3300005617 Ga0068859_100037857 Ga0068859_1000378574 384
498 3300005937 Ga0081455_10015319 Ga0081455_100153192 384
499 3300006880 Ga0075429_100000081 Ga0075429_10000008115 384
500 3300006931 Ga0097620_100037854 Ga0097620_1000378544 384
501 3300009093 Ga0105240_10006044 Ga0105240_100060443 384
502 3300009094 Ga0111539_10028395 Ga0111539_100283954 384
503 3300009147 Ga0114129_10009096 Ga0114129_100090963 384
504 3300009148 Ga0105243_10311209 Ga0105243_103112092 384
505 3300009545 Ga0105237_10017905 Ga0105237_100179053 384
506 3300009553 Ga0105249_10050232 Ga0105249_100502323 384
507 3300010375 Ga0105239_10150801 Ga0105239_101508012 384
508 3300013104 Ga0157370_10096560 Ga0157370_100965601 384
509 3300013105 Ga0157369_10376121 Ga0157369_103761211 384
510 3300013307 Ga0157372_10351214 Ga0157372_103512141 384
511 3300025302 Ga0207426_1005348 Ga0207426_10053487 384
512 3300025912 Ga0207707_10128620 Ga0207707_101286202 384
513 3300025913 Ga0207695_10236334 Ga0207695_102363342 384
514 3300025914 Ga0207671_10015304 Ga0207671_100153043 384
515 3300025919 Ga0207657_10053758 Ga0207657_100537582 384
516 3300025921 Ga0207652_10332588 Ga0207652_103325881 384
517 3300025929 Ga0207664_10108716 Ga0207664_101087162 384
518 3300025931 Ga0207644_10162167 Ga0207644_101621671 384
519 3300025935 Ga0207709_10107026 Ga0207709_101070262 384
520 3300025936 Ga0207670_10049336 Ga0207670_100493362 384
521 3300025944 Ga0207661_10189429 Ga0207661_101894292 384
522 3300025949 Ga0207667_10039363 Ga0207667_100393631 384
523 3300026041 Ga0207639_10044344 Ga0207639_100443442 384
524 3300026078 Ga0207702_10009678 Ga0207702_100096786 384
525 3300026116 Ga0207674_10221024 Ga0207674_102210242 384
526 3300031852 Ga0307410_10049094 Ga0307410_100490942 384
527 3300031852 Ga0307410_10081436 Ga0307410_100814361 384
528 3300031911 Ga0307412_10066156 Ga0307412_100661561 384
529 3300035113 Ga0373936_0002667 Ga0373936_0002667_2655_3833 384
530 3300035692 Ga0373935_0002303 Ga0373935_0002303_7533_8711 384
531 3300035695 Ga0373927_0012815 Ga0373927_0012815_2131_3309 384
532 3300036401 Ga0373937_0229066 Ga0373937_0229066_132_1310 384
533 3300037312 Ga0395899_0077748 Ga0395899_0077748_1089_2264 384
534 3300037418 Ga0395900_0003162 Ga0395900_0003162_15181_16356 384
535 3300037418 Ga0395900_0044584 Ga0395900_0044584_1460_2635 384
536 3300037466 Ga0395898_0018654 Ga0395898_0018654_3932_5107 384
537 3300038443 Ga0395901_0000716 Ga0395901_0000716_24731_25924 384
538 3300038443 Ga0395901_0004892 Ga0395901_0004892_10227_11402 384
539 3300042001 Ga0439441_000406 Ga0439441_000406_1759_2937 384
540 3300044694 Ga0466963_0012243 Ga0466963_0012243_979_2154 384
541 3300045051 Ga0451576_0006617 Ga0451576_0006617_3589_4761 384
542 3300045051 Ga0451576_0205265 Ga0451576_0205265_358_1536 384
543 3300049586 Ga0501070_0048652 Ga0501070_0048652_2338_3495 384
544 3300049742 Ga0501080_0030672 Ga0501080_0030672_68_1225 384
545 3300050507 nmdc:mga05p37_133_c1 nmdc:mga05p37_133_c1_4640_5812 384
546 3300050508 nmdc:mga09592_26_c1 nmdc:mga09592_26_c1_50608_51780 384
547 3300050510 nmdc:mga06r32_15737_c1 nmdc:mga06r32_15737_c1_3787_4959 384
548 3300050511 nmdc:mga08y16_65261_c1 nmdc:mga08y16_65261_c1_2383_3555 384
549 3300005467 Ga0070706_100077413 Ga0070706_1000774133 385
550 3300005471 Ga0070698_100035508 Ga0070698_1000355082 385
551 3300005536 Ga0070697_100130463 Ga0070697_1001304631 385
552 3300005985 Ga0081539_10006851 Ga0081539_100068513 385
553 3300013104 Ga0157370_10010002 Ga0157370_100100029 385
554 3300013297 Ga0157378_10326893 Ga0157378_103268931 385
555 3300021441 Ga0213871_10000470 Ga0213871_100004703 385
556 3300025922 Ga0207646_10250071 Ga0207646_102500711 385
557 3300025960 Ga0207651_10067291 Ga0207651_100672911 385
558 3300031247 Ga0265340_10044346 Ga0265340_100443462 385
559 3300031249 Ga0265339_10029989 Ga0265339_100299892 385
560 3300031250 Ga0265331_10004567 Ga0265331_100045675 385
561 3300031595 Ga0265313_10000325 Ga0265313_100003255 385
562 3300031712 Ga0265342_10008835 Ga0265342_100088355 385
563 3300035115 Ga0373941_0042071 Ga0373941_0042071_110_1306 385
564 3300035695 Ga0373927_0058828 Ga0373927_0058828_10_1203 385
565 3300036401 Ga0373937_0184371 Ga0373937_0184371_748_1941 385
566 3300039438 Ga0436360_0814764 Ga0436360_0814764_3310_4494 385
567 3300048920 Ga0496117_0024275 Ga0496117_0024275_1891_3078 385
568 3300048925 Ga0496122_0053594 Ga0496122_0053594_583_1770 385
569 3300048929 Ga0496126_0023040 Ga0496126_0023040_1775_2965 385
570 3300048929 Ga0496126_0052163 Ga0496126_0052163_585_1775 385
571 3300053096 Ga0500641_0001854 Ga0500641_0001854_2213_3385 385
572 3300053134 Ga0500658_0015511 Ga0500658_0015511_25_1206 385
573 iso_pu_bacteria 2597490356 2599102755 385
574 iso_pu_bacteria 2846952575 2846952629 385
575 iso_pu_bacteria 2848858292 2848861120 385
576 3300005444 Ga0070694_100062367 Ga0070694_1000623673 386
577 3300005545 Ga0070695_100022343 Ga0070695_1000223433 386
578 3300005546 Ga0070696_100012064 Ga0070696_1000120642 386
579 3300006177 Ga0075362_10033980 Ga0075362_100339802 386
580 3300049573 Ga0501037_0083928 Ga0501037_0083928_543_1751 386
581 3300049576 Ga0501040_0009562 Ga0501040_0009562_2025_3233 386
582 3300049578 Ga0501042_0141288 Ga0501042_0141288_160_1368 386
583 3300049582 Ga0501048_0070918 Ga0501048_0070918_1129_2337 386
584 3300049587 Ga0501071_0051111 Ga0501071_0051111_743_1951 386
585 3300049588 Ga0501072_0003891 Ga0501072_0003891_290_1498 386
586 3300049590 Ga0501074_0031850 Ga0501074_0031850_1658_2866 386
587 3300049823 Ga0501044_0139995 Ga0501044_0139995_456_1655 386
588 3300050489 nmdc:mga03683_51127_c1 nmdc:mga03683_51127_c1_328_1530 386
589 3300053153 Ga0500616_0004891 Ga0500616_0004891_355_1557 386
590 3300060353 Ga0501082_0078376 Ga0501082_0078376_510_1718 386
591 3300061734 Ga0530510_0002860 Ga0530510_0002860_9888_11096 386
592 iso_pu_bacteria 2844533157 2844537739 386
593 iso_pu_bacteria 2882456835 2882461618 386
594 3300005937 Ga0081455_10095748 Ga0081455_100957481 387
595 3300005983 Ga0081540_1052171 Ga0081540_10521712 387
596 3300042004 Ga0439445_0014570 Ga0439445_0014570_19_1182 387
597 3300046512 Ga0495610_0054962 Ga0495610_0054962_400_1563 387
598 3300049593 Ga0501077_0060173 Ga0501077_0060173_428_1612 387
599 3300049822 Ga0501035_0146981 Ga0501035_0146981_838_2004 387
600 3300049824 Ga0501045_0075694 Ga0501045_0075694_539_1729 387
601 iso_pu_bacteria 2821443989 2821450196 387
602 iso_pu_bacteria 2883291878 2883297166 388
603 iso_pu_bacteria 2883354860 2883359948 388
604 iso_pu_bacteria 8054563764 8054566574 388
605 3300005436 Ga0070713_100060613 Ga0070713_1000606132 389
606 3300006028 Ga0070717_10301491 Ga0070717_103014912 389
607 3300006173 Ga0070716_100196702 Ga0070716_1001967021 389
608 3300006175 Ga0070712_100159088 Ga0070712_1001590881 389
609 3300006914 Ga0075436_100050353 Ga0075436_1000503532 389
610 3300025928 Ga0207700_10016384 Ga0207700_100163842 389
611 3300025939 Ga0207665_10018852 Ga0207665_100188523 389
612 3300026078 Ga0207702_10114797 Ga0207702_101147972 389
613 3300035085 Ga0373929_0012885 Ga0373929_0012885_87_1310 389
614 3300049588 Ga0501072_0034266 Ga0501072_0034266_710_1906 389
615 3300049590 Ga0501074_0092473 Ga0501074_0092473_706_1902 389
616 3300049592 Ga0501076_0003986 Ga0501076_0003986_716_1912 389
617 3300049593 Ga0501077_0042409 Ga0501077_0042409_549_1745 389
618 3300054114 Ga0501084_0096999 Ga0501084_0096999_555_1751 389
619 3300060353 Ga0501082_0044417 Ga0501082_0044417_379_1575 389
620 3300003187 JGI25151J46595_10000240 JGI25151J46595_100002403 390
621 3300003354 JGI25160J50197_1013154 JGI25160J50197_10131542 390
622 3300025284 Ga0209130_1000282 Ga0209130_10002827 390
623 3300025294 Ga0209025_1000179 Ga0209025_100017931 390
624 3300025302 Ga0207426_1000191 Ga0207426_100019154 390
625 3300046512 Ga0495610_0055155 Ga0495610_0055155_93_1265 390
626 3300046694 Ga0495649_0052549 Ga0495649_0052549_79_1251 390

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

73

125

0.99

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

235

424

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7502 175 390
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7348 175 390
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7321 186 323
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.732 176 380
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7259 175 384
ID Description Score Start End Superfamily
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9606 175 385 1.10.3720.10
af_Q2FZQ8_74_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.958 176 384 1.10.3720.10
af_Q2FYQ6_61_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9565 175 384 1.10.3720.10
af_P77463_85_288_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9506 175 384 1.10.3720.10
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9469 175 385 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A3S4UN22-F1-model_v4 ABC transporter permease 0.9778 44 390 GO:0005886
GO:0055085
AF-A0A2S6TLN5-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9764 58 390 GO:0005886
GO:0015833
GO:0055085
AF-A0A3S4UN22-F1-model_v4 ABC transporter permease 0.9723 44 390 GO:0005886
GO:0055085
AF-A0A356IG16-F1-model_v4 ABC transporter permease 0.9717 163 389 GO:0005886
GO:0055085
AF-A0A2S6TLN5-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9679 58 390 GO:0005886
GO:0015833
GO:0055085

Feature Viewer

pLDDT pTM Quality
86.15 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map