F470381
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 625 | 361 | 589 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0008057|Ga0466969_0008057_330_1124 |
| Length | 264 |
| Sequence | MQKKETSLMKRFIASVLVAVAALAGAAPAVAQEGGPAWDRFPAERVTDLAALQNGARLFVNYCLNCHQASYMRYNRLHDIGLSDDQIKSNLLFTGEKVGDLMKTPLDPKDAKAFFGTVPPDLSVIARSRSGPNGSGADYLYTYLRSFYRDETRPTGWNNRVFPNVGMPHVLWELQGTQRPVYEDEKGEGGEVEHVFKGFRLETPGTLSAADYNADVADLVAYLQWMSEPAQNFRVKLGVWVLIFLGVFWVICWRLNASYWKDVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 3 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 4 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 5 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 6 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 7 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 8 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 9 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 10 | 2738543012 | Acidovorax sp. CF301 | Isolate | Unclassified |
| 11 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 12 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 13 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 14 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 15 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 16 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 17 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 18 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 19 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 20 | 2881101125 | Ramlibacter rhizophilus CCTCC AB2015357 | Isolate | Rhizosphere |
| 21 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 22 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 23 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 24 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 25 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 26 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 27 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 28 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 29 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 30 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 31 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 32 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 33 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 34 | 2932422444 | Comamonas sp. 4034 | Isolate | Rhizosphere |
| 35 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 36 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 37 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 38 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 39 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 40 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 41 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 42 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 43 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 44 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 45 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 46 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 47 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 48 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 49 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 50 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 51 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 52 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 53 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 54 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 55 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 56 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 57 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 58 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 59 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 60 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 61 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 63 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 65 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 66 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 67 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 68 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 69 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 70 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 72 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 73 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 75 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 86 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 90 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 97 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 105 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 109 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 110 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 111 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 112 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 113 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 135 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 136 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 137 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 139 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 149 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 150 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 152 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 153 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 206 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 207 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 208 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 209 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 210 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 211 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 212 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 213 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 228 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 229 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 230 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 231 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 232 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 233 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 234 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 235 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 236 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 237 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 238 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 239 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 243 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 244 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 245 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 246 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 247 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 248 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 249 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 250 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 251 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 252 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 253 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 254 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 258 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 266 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 267 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 268 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 269 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 270 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 311 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 312 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 318 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 319 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 320 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 321 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 324 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 326 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 327 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 328 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 329 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 332 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 333 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 334 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 336 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 337 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 338 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 339 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 340 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 342 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 343 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 344 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 345 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 346 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 347 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 349 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 350 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 351 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 354 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 355 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 356 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 358 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 359 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 360 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.76 |
| Metatranscriptomes | 0.48 |
| Isolates | 5.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 32.48 |
| Nodule | 0.64 |
| Rhizoplane | 2.88 |
| Rhizosphere | 52.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_12867 | 2162886007 | Bacteria | 1973 |
| 2 | SwRhRL2b_contig_3103763 | 2162886007 | Bacteria | 1880 |
| 3 | JGI24740J21852_10011180 | 3300001979 | Bacteria | 3426 |
| 4 | JGI25155J39150_1000022 | 3300002704 | Bacteria | 142950 |
| 5 | JGI25156J39149_1000005 | 3300002705 | Bacteria | 263980 |
| 6 | JGI25156J39149_1004039 | 3300002705 | Bacteria | 4603 |
| 7 | JGI25154J39366_1000017 | 3300002738 | Bacteria | 252448 |
| 8 | JGI25154J39366_1001087 | 3300002738 | Bacteria | 10661 |
| 9 | JGI25157J39369_1000003 | 3300002741 | Bacteria | 274935 |
| 10 | JGI25157J39369_1000245 | 3300002741 | Bacteria | 41331 |
| 11 | JGI25152J39213_1013354 | 3300002773 | Bacteria | 1715 |
| 12 | JGI25159J45721_1001343 | 3300002987 | Bacteria | 10319 |
| 13 | JGI25159J45721_1020505 | 3300002987 | Bacteria | 1271 |
| 14 | JGI25151J46595_10000864 | 3300003187 | Bacteria | 24005 |
| 15 | JGI25151J46595_10023979 | 3300003187 | Bacteria | 2503 |
| 16 | JGI25151J46595_10026761 | 3300003187 | Bacteria | 2322 |
| 17 | JGI25151J46595_10037206 | 3300003187 | Bacteria | 1827 |
| 18 | JGI25153J46596_10038610 | 3300003215 | Bacteria | 1502 |
| 19 | rootL2_10001954 | 3300003322 | Bacteria | 1426 |
| 20 | rootL2_10001955 | 3300003322 | Bacteria | 1498 |
| 21 | rootH1_10028675 | 3300003323 | Bacteria | 1826 |
| 22 | rootH1_10059193 | 3300003323 | Bacteria | 1509 |
| 23 | rootH1_10063216 | 3300003323 | Bacteria | 1293 |
| 24 | rootH1_10152291 | 3300003323 | Bacteria | 1074 |
| 25 | JGI25160J50197_1000273 | 3300003354 | Bacteria | 38119 |
| 26 | JGI25161J50226_1000095 | 3300003374 | Bacteria | 72343 |
| 27 | JGI25161J50226_1006851 | 3300003374 | Bacteria | 1997 |
| 28 | Ga0006562J51391_1143153 | 3300003578 | Bacteria | 1579 |
| 29 | Ga0055539_1004233 | 3300003752 | Bacteria | 1922 |
| 30 | Ga0055533_1000045 | 3300003756 | Bacteria | 223637 |
| 31 | Ga0055525_1000681 | 3300003759 | Bacteria | 12795 |
| 32 | Ga0055535_1000047 | 3300003761 | Bacteria | 139836 |
| 33 | Ga0055535_1001458 | 3300003761 | Bacteria | 11925 |
| 34 | Ga0055535_1008828 | 3300003761 | Bacteria | 1783 |
| 35 | Ga0055542_1000080 | 3300003762 | Bacteria | 129634 |
| 36 | Ga0055529_1000148 | 3300003763 | Bacteria | 100809 |
| 37 | Ga0055526_1035680 | 3300003771 | Bacteria | 1334 |
| 38 | Ga0055526_1040515 | 3300003771 | Bacteria | 1173 |
| 39 | Ga0055526_1054393 | 3300003771 | Bacteria | 890 |
| 40 | Ga0055537_1000150 | 3300003773 | Bacteria | 52097 |
| 41 | Ga0055537_1000205 | 3300003773 | Bacteria | 44266 |
| 42 | Ga0055537_1012545 | 3300003773 | Bacteria | 1645 |
| 43 | Ga0055537_1016229 | 3300003773 | Bacteria | 1271 |
| 44 | Ga0055524_1000073 | 3300003775 | Bacteria | 123033 |
| 45 | Ga0055524_1037856 | 3300003775 | Bacteria | 1271 |
| 46 | Ga0055536_1017554 | 3300003781 | Bacteria | 2337 |
| 47 | Ga0055536_1020774 | 3300003781 | Bacteria | 2015 |
| 48 | Ga0055536_1041960 | 3300003781 | Bacteria | 1074 |
| 49 | Ga0055534_1000016 | 3300003784 | Bacteria | 144444 |
| 50 | Ga0055534_1000363 | 3300003784 | Bacteria | 28579 |
| 51 | Ga0055534_1002375 | 3300003784 | Bacteria | 6557 |
| 52 | Ga0055528_1000289 | 3300003790 | Bacteria | 42964 |
| 53 | Ga0055528_1018942 | 3300003790 | Bacteria | 2309 |
| 54 | Ga0055528_1034095 | 3300003790 | Bacteria | 1262 |
| 55 | Ga0055530_10001804 | 3300003791 | Bacteria | 14848 |
| 56 | Ga0055530_10013917 | 3300003791 | Bacteria | 2714 |
| 57 | Ga0055530_10020135 | 3300003791 | Bacteria | 2002 |
| 58 | Ga0055540_1000037 | 3300003792 | Bacteria | 162957 |
| 59 | Ga0055540_1013552 | 3300003792 | Bacteria | 2484 |
| 60 | Ga0055540_1016696 | 3300003792 | Bacteria | 2077 |
| 61 | Ga0055540_1017448 | 3300003792 | Bacteria | 2003 |
| 62 | Ga0055531_10013523 | 3300003794 | Bacteria | 3754 |
| 63 | Ga0055531_10027364 | 3300003794 | Bacteria | 2003 |
| 64 | Ga0055543_1000218 | 3300004625 | Bacteria | 46120 |
| 65 | Ga0055543_1009440 | 3300004625 | Bacteria | 2095 |
| 66 | Ga0065165_1020502 | 3300005262 | Bacteria | 2323 |
| 67 | Ga0065165_1028953 | 3300005262 | Bacteria | 1780 |
| 68 | Ga0065704_10003100 | 3300005289 | Bacteria | 4362 |
| 69 | Ga0070658_10122976 | 3300005327 | Bacteria | 2157 |
| 70 | Ga0070658_10185759 | 3300005327 | Bacteria | 1750 |
| 71 | Ga0070658_10233536 | 3300005327 | Bacteria | 1558 |
| 72 | Ga0070690_100050185 | 3300005330 | Bacteria | 2661 |
| 73 | Ga0068869_100392877 | 3300005334 | Bacteria | 1139 |
| 74 | Ga0070680_100199107 | 3300005336 | Bacteria | 1689 |
| 75 | Ga0068868_100408899 | 3300005338 | Bacteria | 1172 |
| 76 | Ga0070660_100284005 | 3300005339 | Bacteria | 1354 |
| 77 | Ga0070660_100672394 | 3300005339 | Bacteria | 867 |
| 78 | Ga0070668_100315975 | 3300005347 | Bacteria | 1314 |
| 79 | Ga0070669_100074138 | 3300005353 | Bacteria | 2522 |
| 80 | Ga0070674_100387459 | 3300005356 | Bacteria | 1138 |
| 81 | Ga0070659_100120453 | 3300005366 | Bacteria | 2125 |
| 82 | Ga0070667_100024333 | 3300005367 | Bacteria | 5029 |
| 83 | Ga0070714_100083618 | 3300005435 | Bacteria | 2784 |
| 84 | Ga0070663_100367993 | 3300005455 | Bacteria | 1167 |
| 85 | Ga0070678_100144392 | 3300005456 | Bacteria | 1908 |
| 86 | Ga0070678_100161283 | 3300005456 | Bacteria | 1817 |
| 87 | Ga0070678_100391141 | 3300005456 | Bacteria | 1205 |
| 88 | Ga0070662_100120239 | 3300005457 | Bacteria | 2012 |
| 89 | Ga0068867_100330050 | 3300005459 | Bacteria | 1266 |
| 90 | Ga0070685_10060194 | 3300005466 | Bacteria | 2219 |
| 91 | Ga0070679_100018152 | 3300005530 | Bacteria | 6822 |
| 92 | Ga0070684_100240023 | 3300005535 | Bacteria | 1656 |
| 93 | Ga0068853_100093937 | 3300005539 | Bacteria | 2641 |
| 94 | Ga0068853_100460639 | 3300005539 | Bacteria | 1197 |
| 95 | Ga0070672_100229911 | 3300005543 | Bacteria | 1558 |
| 96 | Ga0070665_100198795 | 3300005548 | Bacteria | 2005 |
| 97 | Ga0070665_100208694 | 3300005548 | Bacteria | 1954 |
| 98 | Ga0070665_100755340 | 3300005548 | Bacteria | 985 |
| 99 | Ga0068855_100058788 | 3300005563 | Bacteria | 4500 |
| 100 | Ga0068855_100314650 | 3300005563 | Bacteria | 1731 |
| 101 | Ga0068855_100663926 | 3300005563 | Bacteria | 1119 |
| 102 | Ga0068857_100113459 | 3300005577 | Bacteria | 2437 |
| 103 | Ga0068854_100006652 | 3300005578 | Bacteria | 7365 |
| 104 | Ga0068856_100001716 | 3300005614 | Bacteria | 22915 |
| 105 | Ga0068856_100103103 | 3300005614 | Bacteria | 2847 |
| 106 | Ga0068852_100074653 | 3300005616 | Bacteria | 2987 |
| 107 | Ga0068861_100127322 | 3300005719 | Bacteria | 2062 |
| 108 | Ga0070717_10155290 | 3300006028 | Bacteria | 1982 |
| 109 | Ga0075365_10085442 | 3300006038 | Bacteria | 2143 |
| 110 | Ga0075365_10335112 | 3300006038 | Bacteria | 1066 |
| 111 | Ga0075365_10351819 | 3300006038 | Bacteria | 1038 |
| 112 | Ga0075368_10021135 | 3300006042 | Bacteria | 2470 |
| 113 | Ga0075363_100046512 | 3300006048 | Bacteria | 2302 |
| 114 | Ga0075363_100102574 | 3300006048 | Bacteria | 1584 |
| 115 | Ga0075363_100184856 | 3300006048 | Bacteria | 1187 |
| 116 | Ga0075364_10088058 | 3300006051 | Bacteria | 2058 |
| 117 | Ga0075432_10002101 | 3300006058 | Bacteria | 6636 |
| 118 | Ga0075362_10018885 | 3300006177 | Bacteria | 2860 |
| 119 | Ga0075362_10030388 | 3300006177 | Bacteria | 2333 |
| 120 | Ga0075362_10059452 | 3300006177 | Bacteria | 1726 |
| 121 | Ga0075362_10166112 | 3300006177 | Bacteria | 1064 |
| 122 | Ga0075367_10173370 | 3300006178 | Bacteria | 1344 |
| 123 | Ga0075366_10005340 | 3300006195 | Bacteria | 6964 |
| 124 | Ga0075366_10027848 | 3300006195 | Bacteria | 3316 |
| 125 | Ga0075366_10040299 | 3300006195 | Bacteria | 2762 |
| 126 | Ga0075366_10060547 | 3300006195 | Bacteria | 2249 |
| 127 | Ga0075366_10068694 | 3300006195 | Bacteria | 2108 |
| 128 | Ga0075366_10074728 | 3300006195 | Bacteria | 2021 |
| 129 | Ga0075366_10076797 | 3300006195 | Bacteria | 1993 |
| 130 | Ga0075366_10105788 | 3300006195 | Bacteria | 1691 |
| 131 | Ga0075366_10172023 | 3300006195 | Bacteria | 1314 |
| 132 | Ga0075366_10335153 | 3300006195 | Bacteria | 927 |
| 133 | Ga0097621_100587714 | 3300006237 | Bacteria | 1017 |
| 134 | Ga0075370_10002013 | 3300006353 | Bacteria | 9212 |
| 135 | Ga0075370_10003632 | 3300006353 | Bacteria | 7383 |
| 136 | Ga0075370_10050148 | 3300006353 | Bacteria | 2367 |
| 137 | Ga0075370_10063133 | 3300006353 | Bacteria | 2111 |
| 138 | Ga0075370_10102025 | 3300006353 | Bacteria | 1661 |
| 139 | Ga0075370_10225733 | 3300006353 | Bacteria | 1107 |
| 140 | Ga0075370_10261441 | 3300006353 | Bacteria | 1026 |
| 141 | Ga0068871_100102473 | 3300006358 | Bacteria | 2399 |
| 142 | Ga0075430_100169916 | 3300006846 | Bacteria | 1814 |
| 143 | Ga0079104_1040443 | 3300006946 | Bacteria | 1092 |
| 144 | Ga0099826_10079164 | 3300006948 | Bacteria | 2055 |
| 145 | Ga0105244_10003719 | 3300009036 | Bacteria | 10768 |
| 146 | Ga0105240_10008945 | 3300009093 | Bacteria | 14239 |
| 147 | Ga0105240_10271816 | 3300009093 | Bacteria | 1951 |
| 148 | Ga0105240_10283589 | 3300009093 | Bacteria | 1902 |
| 149 | Ga0105240_10719343 | 3300009093 | Bacteria | 1088 |
| 150 | Ga0105245_10188958 | 3300009098 | Bacteria | 1972 |
| 151 | Ga0105243_10047127 | 3300009148 | Bacteria | 3392 |
| 152 | Ga0105243_10162587 | 3300009148 | Bacteria | 1926 |
| 153 | Ga0105243_10460871 | 3300009148 | Bacteria | 1195 |
| 154 | Ga0105241_10220982 | 3300009174 | Bacteria | 1592 |
| 155 | Ga0105242_10004226 | 3300009176 | Bacteria | 11196 |
| 156 | Ga0105242_10343592 | 3300009176 | Bacteria | 1376 |
| 157 | Ga0105242_10631114 | 3300009176 | Bacteria | 1039 |
| 158 | Ga0105237_10027197 | 3300009545 | Bacteria | 5841 |
| 159 | Ga0105237_10306461 | 3300009545 | Bacteria | 1591 |
| 160 | Ga0105238_10025724 | 3300009551 | Bacteria | 6002 |
| 161 | Ga0105238_10163019 | 3300009551 | Bacteria | 2205 |
| 162 | Ga0105238_10167037 | 3300009551 | Bacteria | 2176 |
| 163 | Ga0105239_10160843 | 3300010375 | Bacteria | 2508 |
| 164 | Ga0105239_10919566 | 3300010375 | Bacteria | 1004 |
| 165 | Ga0105246_10048846 | 3300011119 | Bacteria | 2894 |
| 166 | Ga0105246_10310789 | 3300011119 | Bacteria | 1277 |
| 167 | Ga0157371_10198264 | 3300013102 | Bacteria | 1439 |
| 168 | Ga0157369_10022693 | 3300013105 | Bacteria | 6999 |
| 169 | Ga0157369_10024224 | 3300013105 | Bacteria | 6755 |
| 170 | Ga0157374_10919092 | 3300013296 | Bacteria | 893 |
| 171 | Ga0157378_10292403 | 3300013297 | Bacteria | 1574 |
| 172 | Ga0163162_10083970 | 3300013306 | Bacteria | 3259 |
| 173 | Ga0163162_10458657 | 3300013306 | Bacteria | 1406 |
| 174 | Ga0157372_10197385 | 3300013307 | Bacteria | 2331 |
| 175 | Ga0157372_10268779 | 3300013307 | Bacteria | 1981 |
| 176 | Ga0157375_10246811 | 3300013308 | Bacteria | 1946 |
| 177 | Ga0157375_10966913 | 3300013308 | Bacteria | 993 |
| 178 | Ga0157380_10330018 | 3300014326 | Bacteria | 1418 |
| 179 | Ga0182008_10058182 | 3300014497 | Bacteria | 1909 |
| 180 | Ga0182008_10060953 | 3300014497 | Bacteria | 1860 |
| 181 | Ga0182008_10061799 | 3300014497 | Bacteria | 1846 |
| 182 | Ga0182008_10076765 | 3300014497 | Bacteria | 1643 |
| 183 | Ga0182008_10161869 | 3300014497 | Bacteria | 1126 |
| 184 | Ga0157379_10206476 | 3300014968 | Bacteria | 1777 |
| 185 | Ga0157376_10188012 | 3300014969 | Bacteria | 1892 |
| 186 | Ga0157376_10441386 | 3300014969 | Bacteria | 1267 |
| 187 | Ga0182006_1027212 | 3300015261 | Bacteria | 2335 |
| 188 | Ga0182006_1039095 | 3300015261 | Bacteria | 1874 |
| 189 | Ga0182006_1107396 | 3300015261 | Bacteria | 983 |
| 190 | Ga0182007_10002638 | 3300015262 | Bacteria | 8809 |
| 191 | Ga0182007_10028387 | 3300015262 | Bacteria | 1923 |
| 192 | Ga0182007_10062422 | 3300015262 | Bacteria | 1221 |
| 193 | Ga0183362_10003 | 3300015683 | Bacteria | 977584 |
| 194 | Ga0163161_10145246 | 3300017792 | Bacteria | 1799 |
| 195 | Ga0163161_10153856 | 3300017792 | Bacteria | 1749 |
| 196 | Ga0163161_10217858 | 3300017792 | Bacteria | 1477 |
| 197 | Ga0163161_10316030 | 3300017792 | Bacteria | 1233 |
| 198 | Ga0213872_10038199 | 3300021361 | Bacteria | 2192 |
| 199 | Ga0209435_100002 | 3300025206 | Bacteria | 794178 |
| 200 | Ga0209436_109303 | 3300025208 | Bacteria | 1883 |
| 201 | Ga0209674_100073 | 3300025226 | Bacteria | 223689 |
| 202 | Ga0209672_102374 | 3300025228 | Bacteria | 4710 |
| 203 | Ga0209147_101277 | 3300025229 | Bacteria | 9822 |
| 204 | Ga0209563_100061 | 3300025230 | Bacteria | 274295 |
| 205 | Ga0207427_101392 | 3300025231 | Bacteria | 8858 |
| 206 | Ga0209258_100009 | 3300025242 | Bacteria | 996276 |
| 207 | Ga0209258_100072 | 3300025242 | Bacteria | 274355 |
| 208 | Ga0209258_104057 | 3300025242 | Bacteria | 2902 |
| 209 | Ga0207425_1002688 | 3300025245 | Bacteria | 6089 |
| 210 | Ga0207425_1003670 | 3300025245 | Bacteria | 4832 |
| 211 | Ga0207425_1008972 | 3300025245 | Bacteria | 2519 |
| 212 | Ga0209646_1000001 | 3300025246 | Bacteria | 3092932 |
| 213 | Ga0209646_1000076 | 3300025246 | Bacteria | 212891 |
| 214 | Ga0209026_1000001 | 3300025250 | Bacteria | 1228671 |
| 215 | Ga0209026_1000011 | 3300025250 | Bacteria | 507291 |
| 216 | Ga0209677_100070 | 3300025253 | Bacteria | 143311 |
| 217 | Ga0209677_102967 | 3300025253 | Bacteria | 5903 |
| 218 | Ga0209148_1000007 | 3300025254 | Bacteria | 1592273 |
| 219 | Ga0209148_1003914 | 3300025254 | Bacteria | 3856 |
| 220 | Ga0209759_1000001 | 3300025256 | Bacteria | 2799452 |
| 221 | Ga0209759_1000034 | 3300025256 | Bacteria | 271209 |
| 222 | Ga0209759_1010366 | 3300025256 | Bacteria | 2736 |
| 223 | Ga0209759_1019829 | 3300025256 | Bacteria | 1582 |
| 224 | Ga0209129_1000404 | 3300025258 | Bacteria | 34228 |
| 225 | Ga0209129_1012367 | 3300025258 | Bacteria | 1964 |
| 226 | Ga0209129_1029630 | 3300025258 | Bacteria | 921 |
| 227 | Ga0209565_1000098 | 3300025263 | Bacteria | 132021 |
| 228 | Ga0209565_1000128 | 3300025263 | Bacteria | 108959 |
| 229 | Ga0209565_1000574 | 3300025263 | Bacteria | 24961 |
| 230 | Ga0209565_1001099 | 3300025263 | Bacteria | 13330 |
| 231 | Ga0209565_1002417 | 3300025263 | Bacteria | 6760 |
| 232 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 233 | Ga0209673_1000008 | 3300025273 | Bacteria | 626013 |
| 234 | Ga0209673_1000058 | 3300025273 | Bacteria | 269028 |
| 235 | Ga0209673_1000410 | 3300025273 | Bacteria | 75829 |
| 236 | Ga0209673_1000705 | 3300025273 | Bacteria | 47171 |
| 237 | Ga0209130_1000072 | 3300025284 | Bacteria | 175726 |
| 238 | Ga0209130_1000295 | 3300025284 | Bacteria | 60748 |
| 239 | Ga0209130_1001611 | 3300025284 | Bacteria | 14009 |
| 240 | Ga0209675_1000010 | 3300025291 | Bacteria | 541927 |
| 241 | Ga0209675_1000099 | 3300025291 | Bacteria | 128911 |
| 242 | Ga0209675_1000151 | 3300025291 | Bacteria | 91172 |
| 243 | Ga0209675_1000381 | 3300025291 | Bacteria | 36963 |
| 244 | Ga0209675_1009484 | 3300025291 | Bacteria | 3434 |
| 245 | Ga0209676_1000023 | 3300025292 | Bacteria | 589732 |
| 246 | Ga0209676_1000028 | 3300025292 | Bacteria | 559745 |
| 247 | Ga0209676_1003664 | 3300025292 | Bacteria | 9208 |
| 248 | Ga0209025_1000289 | 3300025294 | Bacteria | 113555 |
| 249 | Ga0209025_1006053 | 3300025294 | Bacteria | 9568 |
| 250 | Ga0209025_1011304 | 3300025294 | Bacteria | 5901 |
| 251 | Ga0209025_1014674 | 3300025294 | Bacteria | 4795 |
| 252 | Ga0209025_1017536 | 3300025294 | Bacteria | 4123 |
| 253 | Ga0209025_1033673 | 3300025294 | Bacteria | 2361 |
| 254 | Ga0209025_1042659 | 3300025294 | Bacteria | 1924 |
| 255 | Ga0209025_1054201 | 3300025294 | Bacteria | 1564 |
| 256 | Ga0209564_1000724 | 3300025295 | Bacteria | 47354 |
| 257 | Ga0209564_1007849 | 3300025295 | Bacteria | 5410 |
| 258 | Ga0209564_1049592 | 3300025295 | Bacteria | 1037 |
| 259 | Ga0209758_1028519 | 3300025297 | Bacteria | 2357 |
| 260 | Ga0209050_1000022 | 3300025298 | Bacteria | 565239 |
| 261 | Ga0209050_1011134 | 3300025298 | Bacteria | 4312 |
| 262 | Ga0209050_1022890 | 3300025298 | Bacteria | 2221 |
| 263 | Ga0209050_1024981 | 3300025298 | Bacteria | 2047 |
| 264 | Ga0209050_1053999 | 3300025298 | Bacteria | 994 |
| 265 | Ga0209256_1000001 | 3300025299 | Bacteria | 2166974 |
| 266 | Ga0209256_1000088 | 3300025299 | Bacteria | 217236 |
| 267 | Ga0207426_1000038 | 3300025302 | Bacteria | 441522 |
| 268 | Ga0207426_1000319 | 3300025302 | Bacteria | 92696 |
| 269 | Ga0207426_1013921 | 3300025302 | Bacteria | 2965 |
| 270 | Ga0209051_1000013 | 3300025303 | Bacteria | 565239 |
| 271 | Ga0209051_1000015 | 3300025303 | Bacteria | 546798 |
| 272 | Ga0209051_1000056 | 3300025303 | Bacteria | 271616 |
| 273 | Ga0209051_1000509 | 3300025303 | Bacteria | 49288 |
| 274 | Ga0209051_1000904 | 3300025303 | Bacteria | 29543 |
| 275 | Ga0209051_1031226 | 3300025303 | Bacteria | 2053 |
| 276 | Ga0209257_1000042 | 3300025304 | Bacteria | 537149 |
| 277 | Ga0209257_1017914 | 3300025304 | Bacteria | 2758 |
| 278 | Ga0207655_1004477 | 3300025728 | Bacteria | 9895 |
| 279 | Ga0207645_10246467 | 3300025907 | Bacteria | 1181 |
| 280 | Ga0207705_10254625 | 3300025909 | Bacteria | 1339 |
| 281 | Ga0207654_10057855 | 3300025911 | Bacteria | 2255 |
| 282 | Ga0207654_10166896 | 3300025911 | Bacteria | 1426 |
| 283 | Ga0207695_10005493 | 3300025913 | Bacteria | 16778 |
| 284 | Ga0207695_10123790 | 3300025913 | Bacteria | 2551 |
| 285 | Ga0207671_10119636 | 3300025914 | Bacteria | 2012 |
| 286 | Ga0207660_10228767 | 3300025917 | Bacteria | 1462 |
| 287 | Ga0207657_10062642 | 3300025919 | Bacteria | 3183 |
| 288 | Ga0207681_10055268 | 3300025923 | Bacteria | 2703 |
| 289 | Ga0207694_10130298 | 3300025924 | Bacteria | 2015 |
| 290 | Ga0207694_10154125 | 3300025924 | Bacteria | 1852 |
| 291 | Ga0207694_10304733 | 3300025924 | Bacteria | 1312 |
| 292 | Ga0207690_10106426 | 3300025932 | Bacteria | 2013 |
| 293 | Ga0207706_10451288 | 3300025933 | Bacteria | 1112 |
| 294 | Ga0207686_10000954 | 3300025934 | Bacteria | 17260 |
| 295 | Ga0207709_10008426 | 3300025935 | Bacteria | 5703 |
| 296 | Ga0207709_10159034 | 3300025935 | Bacteria | 1573 |
| 297 | Ga0207669_10020071 | 3300025937 | Bacteria | 3495 |
| 298 | Ga0207691_10387692 | 3300025940 | Bacteria | 1192 |
| 299 | Ga0207689_10074760 | 3300025942 | Bacteria | 2784 |
| 300 | Ga0207689_10263201 | 3300025942 | Bacteria | 1427 |
| 301 | Ga0207661_10472575 | 3300025944 | Bacteria | 1144 |
| 302 | Ga0207679_10132187 | 3300025945 | Bacteria | 2004 |
| 303 | Ga0207667_10186192 | 3300025949 | Bacteria | 2131 |
| 304 | Ga0207667_10228580 | 3300025949 | Bacteria | 1905 |
| 305 | Ga0207668_10393799 | 3300025972 | Bacteria | 1169 |
| 306 | Ga0207658_10039090 | 3300025986 | Bacteria | 3422 |
| 307 | Ga0207677_10238017 | 3300026023 | Bacteria | 1471 |
| 308 | Ga0207677_10239766 | 3300026023 | Bacteria | 1466 |
| 309 | Ga0207677_10362980 | 3300026023 | Bacteria | 1217 |
| 310 | Ga0207639_10016347 | 3300026041 | Bacteria | 5248 |
| 311 | Ga0207702_10001565 | 3300026078 | Bacteria | 22647 |
| 312 | Ga0207641_10064069 | 3300026088 | Bacteria | 3141 |
| 313 | Ga0207648_10173845 | 3300026089 | Bacteria | 1904 |
| 314 | Ga0207648_10463245 | 3300026089 | Bacteria | 1156 |
| 315 | Ga0207674_10005653 | 3300026116 | Bacteria | 14825 |
| 316 | Ga0207674_10147041 | 3300026116 | Bacteria | 2315 |
| 317 | Ga0207674_10171110 | 3300026116 | Bacteria | 2126 |
| 318 | Ga0207683_10068293 | 3300026121 | Bacteria | 3137 |
| 319 | Ga0207683_10278496 | 3300026121 | Bacteria | 1528 |
| 320 | Ga0207698_10133560 | 3300026142 | Bacteria | 2125 |
| 321 | Ga0209282_1006082 | 3300027666 | Bacteria | 7471 |
| 322 | Ga0209813_10035939 | 3300027866 | Bacteria | 1485 |
| 323 | Ga0207428_10150538 | 3300027907 | Bacteria | 1771 |
| 324 | Ga0268266_10056764 | 3300028379 | Bacteria | 3368 |
| 325 | Ga0268266_10076416 | 3300028379 | Bacteria | 2911 |
| 326 | Ga0268266_10109427 | 3300028379 | Bacteria | 2447 |
| 327 | Ga0268266_10277308 | 3300028379 | Bacteria | 1558 |
| 328 | Ga0265336_10000036 | 3300028666 | Bacteria | 154609 |
| 329 | Ga0307515_10000084 | 3300028794 | Bacteria | 221434 |
| 330 | Ga0307515_10004716 | 3300028794 | Bacteria | 27939 |
| 331 | Ga0307515_10134564 | 3300028794 | Bacteria | 2697 |
| 332 | Ga0307515_10342685 | 3300028794 | Bacteria | 1146 |
| 333 | Ga0265324_10000136 | 3300029957 | Bacteria | 57490 |
| 334 | Ga0307512_10175081 | 3300030522 | Bacteria | 1220 |
| 335 | Ga0316177_1143531 | 3300030731 | Bacteria | 6959 |
| 336 | Ga0314311_1250141 | 3300030733 | Bacteria | 5028 |
| 337 | Ga0316179_1098234 | 3300030734 | Bacteria | 1187 |
| 338 | Ga0316178_1108036 | 3300030735 | Bacteria | 3060 |
| 339 | Ga0316180_1017895 | 3300030736 | Bacteria | 4023 |
| 340 | Ga0316183_1000995 | 3300030742 | Bacteria | 989 |
| 341 | Ga0316182_1303292 | 3300030745 | Bacteria | 2312 |
| 342 | Ga0265328_10055880 | 3300031239 | Bacteria | 1449 |
| 343 | Ga0265325_10017191 | 3300031241 | Bacteria | 4022 |
| 344 | Ga0265327_10008835 | 3300031251 | Bacteria | 7417 |
| 345 | Ga0265327_10169866 | 3300031251 | Bacteria | 1003 |
| 346 | Ga0307513_10000008 | 3300031456 | Bacteria | 442128 |
| 347 | Ga0307513_10000038 | 3300031456 | Bacteria | 174780 |
| 348 | Ga0307408_100017442 | 3300031548 | Bacteria | 4804 |
| 349 | Ga0307408_100035804 | 3300031548 | Bacteria | 3485 |
| 350 | Ga0307408_100058354 | 3300031548 | Bacteria | 2805 |
| 351 | Ga0307514_10000319 | 3300031649 | Bacteria | 115327 |
| 352 | Ga0307514_10029570 | 3300031649 | Bacteria | 4404 |
| 353 | Ga0307516_10004973 | 3300031730 | Bacteria | 16142 |
| 354 | Ga0307516_10029845 | 3300031730 | Bacteria | 5509 |
| 355 | Ga0307405_10066088 | 3300031731 | Bacteria | 2304 |
| 356 | Ga0307405_10085066 | 3300031731 | Bacteria | 2078 |
| 357 | Ga0307405_10094181 | 3300031731 | Bacteria | 1991 |
| 358 | Ga0307406_10015826 | 3300031901 | Bacteria | 4372 |
| 359 | Ga0307406_10063505 | 3300031901 | Bacteria | 2392 |
| 360 | Ga0307412_10379092 | 3300031911 | Bacteria | 1144 |
| 361 | Ga0307412_10461958 | 3300031911 | Bacteria | 1048 |
| 362 | Ga0307416_100275069 | 3300032002 | Bacteria | 1656 |
| 363 | Ga0307416_100791813 | 3300032002 | Bacteria | 1043 |
| 364 | Ga0307414_10038184 | 3300032004 | Bacteria | 3222 |
| 365 | Ga0307414_10251099 | 3300032004 | Bacteria | 1470 |
| 366 | Ga0307411_10348329 | 3300032005 | Bacteria | 1206 |
| 367 | Ga0373931_0039317 | 3300035691 | Bacteria | 2478 |
| 368 | Ga0373931_0136387 | 3300035691 | Bacteria | 1417 |
| 369 | Ga0395899_0008661 | 3300037312 | Bacteria | 7828 |
| 370 | Ga0395899_0086072 | 3300037312 | Bacteria | 2283 |
| 371 | Ga0395900_0015874 | 3300037418 | Bacteria | 7671 |
| 372 | Ga0395900_0026531 | 3300037418 | Bacteria | 5931 |
| 373 | Ga0395900_0188545 | 3300037418 | Bacteria | 2093 |
| 374 | Ga0395898_0004158 | 3300037466 | Bacteria | 15877 |
| 375 | Ga0395898_0044157 | 3300037466 | Bacteria | 4390 |
| 376 | Ga0395905_0000728 | 3300037471 | Bacteria | 43400 |
| 377 | Ga0395905_0025949 | 3300037471 | Bacteria | 5524 |
| 378 | Ga0395905_0029854 | 3300037471 | Bacteria | 5138 |
| 379 | Ga0395905_0044151 | 3300037471 | Bacteria | 4182 |
| 380 | Ga0395901_0003179 | 3300038443 | Bacteria | 16526 |
| 381 | Ga0395901_0023253 | 3300038443 | Bacteria | 6353 |
| 382 | Ga0395901_0090939 | 3300038443 | Bacteria | 3194 |
| 383 | Ga0395901_0241545 | 3300038443 | Bacteria | 1884 |
| 384 | Ga0395901_0453258 | 3300038443 | Bacteria | 1312 |
| 385 | Ga0436361_0567754 | 3300039447 | Bacteria | 3243 |
| 386 | Ga0436361_0711422 | 3300039447 | Bacteria | 4175 |
| 387 | Ga0439436_0000668 | 3300041404 | Bacteria | 9183 |
| 388 | Ga0439436_0034512 | 3300041404 | Bacteria | 1462 |
| 389 | Ga0439439_0019710 | 3300041406 | Bacteria | 1675 |
| 390 | Ga0439447_039433 | 3300041407 | Bacteria | 1156 |
| 391 | Ga0439461_0017351 | 3300041410 | Bacteria | 1398 |
| 392 | Ga0439466_0008629 | 3300041411 | Bacteria | 3841 |
| 393 | Ga0439466_0016919 | 3300041411 | Bacteria | 2631 |
| 394 | Ga0439465_0004974 | 3300041413 | Bacteria | 4269 |
| 395 | Ga0451791_1208931 | 3300041451 | Bacteria | 996 |
| 396 | Ga0451800_1061636 | 3300041459 | Bacteria | 921 |
| 397 | Ga0451800_1566960 | 3300041459 | Bacteria | 1208 |
| 398 | Ga0451807_0755093 | 3300041486 | Bacteria | 1216 |
| 399 | Ga0439431_0013193 | 3300041997 | Bacteria | 1904 |
| 400 | Ga0439431_0040539 | 3300041997 | Bacteria | 1184 |
| 401 | Ga0439433_0009473 | 3300041999 | Bacteria | 2122 |
| 402 | Ga0439442_033853 | 3300042002 | Bacteria | 1068 |
| 403 | Ga0439445_0000200 | 3300042004 | Bacteria | 10930 |
| 404 | Ga0439445_0023535 | 3300042004 | Bacteria | 1560 |
| 405 | Ga0439432_012869 | 3300042006 | Bacteria | 2851 |
| 406 | Ga0439432_043463 | 3300042006 | Bacteria | 1417 |
| 407 | Ga0439449_0001627 | 3300042007 | Bacteria | 8807 |
| 408 | Ga0439449_0037578 | 3300042007 | Bacteria | 1801 |
| 409 | Ga0439449_0043017 | 3300042007 | Bacteria | 1677 |
| 410 | Ga0439452_013026 | 3300042010 | Bacteria | 2345 |
| 411 | Ga0439452_019885 | 3300042010 | Bacteria | 1768 |
| 412 | Ga0439457_007541 | 3300042014 | Bacteria | 2607 |
| 413 | Ga0439462_0018109 | 3300042015 | Bacteria | 1828 |
| 414 | Ga0450911_000822 | 3300042115 | Bacteria | 8529 |
| 415 | Ga0450911_019713 | 3300042115 | Bacteria | 883 |
| 416 | Ga0450898_005473 | 3300042134 | Bacteria | 1919 |
| 417 | Ga0439446_0024648 | 3300042156 | Bacteria | 1717 |
| 418 | Ga0439446_0065110 | 3300042156 | Bacteria | 1107 |
| 419 | Ga0439434_0005498 | 3300042435 | Bacteria | 3702 |
| 420 | Ga0451577_0121556 | 3300042876 | Bacteria | 2339 |
| 421 | Ga0451577_0274649 | 3300042876 | Bacteria | 1526 |
| 422 | Ga0451577_0347000 | 3300042876 | Bacteria | 1346 |
| 423 | Ga0451577_1072873 | 3300042876 | Bacteria | 721 |
| 424 | Ga0466969_0008057 | 3300044656 | Bacteria | 5596 |
| 425 | Ga0466969_0020418 | 3300044656 | Bacteria | 3431 |
| 426 | Ga0453683_0002261 | 3300044673 | Bacteria | 15209 |
| 427 | Ga0453683_0116928 | 3300044673 | Bacteria | 1678 |
| 428 | Ga0466965_0011708 | 3300044683 | Bacteria | 4115 |
| 429 | Ga0466965_0085773 | 3300044683 | Bacteria | 1596 |
| 430 | Ga0466966_0018169 | 3300044684 | Bacteria | 4639 |
| 431 | Ga0466966_0026697 | 3300044684 | Bacteria | 3769 |
| 432 | Ga0466961_0002913 | 3300044693 | Bacteria | 10623 |
| 433 | Ga0466961_0045949 | 3300044693 | Bacteria | 2793 |
| 434 | Ga0466963_0004061 | 3300044694 | Bacteria | 8468 |
| 435 | Ga0466963_0092730 | 3300044694 | Bacteria | 2058 |
| 436 | Ga0466964_0004782 | 3300044706 | Bacteria | 5008 |
| 437 | Ga0466964_0033527 | 3300044706 | Bacteria | 2046 |
| 438 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 439 | Ga0453684_0000163 | 3300044712 | Bacteria | 296196 |
| 440 | Ga0453684_0000341 | 3300044712 | Bacteria | 194228 |
| 441 | Ga0453684_0000511 | 3300044712 | Bacteria | 150804 |
| 442 | Ga0453684_0076534 | 3300044712 | Bacteria | 4200 |
| 443 | Ga0453684_0324572 | 3300044712 | Bacteria | 1742 |
| 444 | Ga0466971_0009165 | 3300044719 | Bacteria | 4327 |
| 445 | Ga0466971_0019879 | 3300044719 | Bacteria | 2983 |
| 446 | Ga0466957_0038059 | 3300044842 | Bacteria | 2897 |
| 447 | Ga0466959_0000027 | 3300045049 | Bacteria | 114262 |
| 448 | Ga0466959_0032585 | 3300045049 | Bacteria | 3857 |
| 449 | Ga0466959_0115012 | 3300045049 | Bacteria | 1917 |
| 450 | Ga0451576_0000266 | 3300045051 | Bacteria | 127813 |
| 451 | Ga0451576_0040360 | 3300045051 | Bacteria | 4941 |
| 452 | Ga0451576_0100037 | 3300045051 | Bacteria | 3016 |
| 453 | Ga0451576_0161122 | 3300045051 | Bacteria | 2341 |
| 454 | Ga0451576_0311637 | 3300045051 | Bacteria | 1646 |
| 455 | Ga0451576_0524088 | 3300045051 | Bacteria | 1245 |
| 456 | Ga0451576_0746238 | 3300045051 | Bacteria | 1028 |
| 457 | Ga0466958_0009465 | 3300045836 | Bacteria | 5430 |
| 458 | Ga0466967_0013629 | 3300045976 | Bacteria | 6292 |
| 459 | Ga0466967_0120891 | 3300045976 | Bacteria | 2419 |
| 460 | Ga0495627_024060 | 3300046453 | Bacteria | 1989 |
| 461 | Ga0495629_0201584 | 3300046459 | Bacteria | 1376 |
| 462 | Ga0495638_0119328 | 3300046460 | Bacteria | 1560 |
| 463 | Ga0495650_0057591 | 3300046471 | Bacteria | 1572 |
| 464 | Ga0495639_0002158 | 3300046475 | Bacteria | 8677 |
| 465 | Ga0495639_0039662 | 3300046475 | Bacteria | 2117 |
| 466 | Ga0495585_0008753 | 3300046492 | Bacteria | 6118 |
| 467 | Ga0495585_0138317 | 3300046492 | Bacteria | 1277 |
| 468 | Ga0495583_0000418 | 3300046506 | Bacteria | 64708 |
| 469 | Ga0495606_0009174 | 3300046507 | Bacteria | 8412 |
| 470 | Ga0495606_0091840 | 3300046507 | Bacteria | 1866 |
| 471 | Ga0495610_0017794 | 3300046512 | Bacteria | 4041 |
| 472 | Ga0495616_0031740 | 3300046513 | Bacteria | 2764 |
| 473 | Ga0495620_0008764 | 3300046515 | Bacteria | 5413 |
| 474 | Ga0495630_0415275 | 3300046517 | Bacteria | 1031 |
| 475 | Ga0495631_0006138 | 3300046518 | Bacteria | 6228 |
| 476 | Ga0495637_0072024 | 3300046520 | Bacteria | 1392 |
| 477 | Ga0495654_0003583 | 3300046530 | Bacteria | 9454 |
| 478 | Ga0495654_0013618 | 3300046530 | Bacteria | 4349 |
| 479 | Ga0495654_0066438 | 3300046530 | Bacteria | 1719 |
| 480 | Ga0495621_0051475 | 3300046539 | Bacteria | 1474 |
| 481 | Ga0495656_0000757 | 3300046615 | Bacteria | 10411 |
| 482 | Ga0495668_0177201 | 3300046616 | Bacteria | 1168 |
| 483 | Ga0495625_0010094 | 3300046660 | Bacteria | 7844 |
| 484 | Ga0495635_0089763 | 3300046663 | Bacteria | 2103 |
| 485 | Ga0495635_0243226 | 3300046663 | Bacteria | 1214 |
| 486 | Ga0495659_0081908 | 3300046664 | Bacteria | 1226 |
| 487 | Ga0495588_0134207 | 3300046674 | Bacteria | 1306 |
| 488 | Ga0495623_0206178 | 3300046679 | Bacteria | 1128 |
| 489 | Ga0495669_0024291 | 3300046684 | Bacteria | 2640 |
| 490 | Ga0495670_0093600 | 3300046691 | Bacteria | 1540 |
| 491 | Ga0495671_0052500 | 3300046692 | Bacteria | 2026 |
| 492 | Ga0495589_0021916 | 3300046794 | Bacteria | 3264 |
| 493 | Ga0495581_0163543 | 3300047315 | Bacteria | 1301 |
| 494 | Ga0495676_0066313 | 3300047321 | Bacteria | 2798 |
| 495 | Ga0495677_0111153 | 3300047445 | Bacteria | 1042 |
| 496 | Ga0495686_0010557 | 3300047472 | Bacteria | 6561 |
| 497 | Ga0495593_0130545 | 3300047673 | Bacteria | 1275 |
| 498 | Ga0495602_0190336 | 3300048088 | Bacteria | 1574 |
| 499 | Ga0495614_0049079 | 3300048089 | Bacteria | 1809 |
| 500 | Ga0495615_0014509 | 3300048090 | Bacteria | 1667 |
| 501 | Ga0496100_0102783 | 3300048903 | Bacteria | 1972 |
| 502 | Ga0496100_0263640 | 3300048903 | Bacteria | 1279 |
| 503 | Ga0496101_0090785 | 3300048904 | Bacteria | 2272 |
| 504 | Ga0496101_0132709 | 3300048904 | Bacteria | 1892 |
| 505 | Ga0496102_0199998 | 3300048905 | Bacteria | 1883 |
| 506 | Ga0496103_0132834 | 3300048906 | Bacteria | 1590 |
| 507 | Ga0496103_0140032 | 3300048906 | Bacteria | 1547 |
| 508 | Ga0496104_0251383 | 3300048907 | Bacteria | 1680 |
| 509 | Ga0496104_0298285 | 3300048907 | Bacteria | 1524 |
| 510 | Ga0496105_0011369 | 3300048908 | Bacteria | 7031 |
| 511 | Ga0496105_0336379 | 3300048908 | Bacteria | 1208 |
| 512 | Ga0496106_0270485 | 3300048909 | Bacteria | 1360 |
| 513 | Ga0496107_0134858 | 3300048910 | Bacteria | 1824 |
| 514 | Ga0496109_0251001 | 3300048912 | Bacteria | 1666 |
| 515 | Ga0496116_0028608 | 3300048919 | Bacteria | 4033 |
| 516 | Ga0496116_0067609 | 3300048919 | Bacteria | 2281 |
| 517 | Ga0496117_0004519 | 3300048920 | Bacteria | 15279 |
| 518 | Ga0496117_0089738 | 3300048920 | Bacteria | 1983 |
| 519 | Ga0496118_0077444 | 3300048921 | Bacteria | 2358 |
| 520 | Ga0496118_0112549 | 3300048921 | Bacteria | 1801 |
| 521 | Ga0496121_0041134 | 3300048924 | Bacteria | 4044 |
| 522 | Ga0496121_0107715 | 3300048924 | Bacteria | 2133 |
| 523 | Ga0496121_0248710 | 3300048924 | Bacteria | 1234 |
| 524 | Ga0496121_0285992 | 3300048924 | Bacteria | 1125 |
| 525 | Ga0496122_0000612 | 3300048925 | Bacteria | 73307 |
| 526 | Ga0496123_0000274 | 3300048926 | Bacteria | 101783 |
| 527 | Ga0496123_0101262 | 3300048926 | Bacteria | 1675 |
| 528 | Ga0496123_0112237 | 3300048926 | Bacteria | 1555 |
| 529 | Ga0496125_0119390 | 3300048928 | Bacteria | 1885 |
| 530 | Ga0501306_001383 | 3300049127 | Bacteria | 2269 |
| 531 | Ga0501310_001724 | 3300049130 | Bacteria | 2013 |
| 532 | Ga0501223_030423 | 3300049663 | Bacteria | 1050 |
| 533 | Ga0501249_006688 | 3300049679 | Bacteria | 2375 |
| 534 | Ga0501225_0005272 | 3300049705 | Bacteria | 3803 |
| 535 | Ga0501266_000597 | 3300049763 | Bacteria | 4731 |
| 536 | nmdc:mga03683_129285_c1 | 3300050489 | Bacteria | 1129 |
| 537 | nmdc:mga03683_58481_c1 | 3300050489 | Bacteria | 1625 |
| 538 | nmdc:mga03n38_174022_c1 | 3300050490 | Bacteria | 1098 |
| 539 | nmdc:mga03n38_84859_c1 | 3300050490 | Bacteria | 1496 |
| 540 | nmdc:mga00v17_143258_c1 | 3300050491 | Bacteria | 1533 |
| 541 | nmdc:mga0yw44_55092_c1 | 3300050492 | Bacteria | 2419 |
| 542 | nmdc:mga0k408_12109_c1 | 3300050493 | Bacteria | 4710 |
| 543 | nmdc:mga0k408_13299_c1 | 3300050493 | Bacteria | 4510 |
| 544 | nmdc:mga0k408_62654_c1 | 3300050493 | Bacteria | 2163 |
| 545 | nmdc:mga0k408_738_c2 | 3300050493 | Bacteria | 8845 |
| 546 | nmdc:mga0k408_91852_c1 | 3300050493 | Bacteria | 1784 |
| 547 | nmdc:mga06z11_33845_c1 | 3300050494 | Bacteria | 2503 |
| 548 | nmdc:mga07m45_118507_c1 | 3300050496 | Bacteria | 1528 |
| 549 | nmdc:mga07m45_171580_c1 | 3300050496 | Bacteria | 1261 |
| 550 | nmdc:mga07m45_22608_c1 | 3300050496 | Bacteria | 3434 |
| 551 | nmdc:mga07m45_3314_c1 | 3300050496 | Bacteria | 7759 |
| 552 | nmdc:mga07m45_3823_c1 | 3300050496 | Bacteria | 7291 |
| 553 | nmdc:mga07m45_49622_c1 | 3300050496 | Bacteria | 2363 |
| 554 | nmdc:mga07m45_522_c2 | 3300050496 | Bacteria | 2792 |
| 555 | nmdc:mga07m45_58596_c1 | 3300050496 | Bacteria | 2179 |
| 556 | nmdc:mga0sz30_68296_c1 | 3300050516 | Bacteria | 1056 |
| 557 | Ga0500610_0030293 | 3300053079 | Bacteria | 2741 |
| 558 | Ga0500635_0000030 | 3300053080 | Bacteria | 99936 |
| 559 | Ga0500643_018296 | 3300053087 | Bacteria | 2328 |
| 560 | Ga0500651_0011180 | 3300053093 | Bacteria | 5404 |
| 561 | Ga0500569_068011 | 3300053109 | Bacteria | 1115 |
| 562 | Ga0500571_047777 | 3300053110 | Bacteria | 2263 |
| 563 | Ga0500593_000312 | 3300053117 | Bacteria | 19544 |
| 564 | Ga0500593_060071 | 3300053117 | Bacteria | 1671 |
| 565 | Ga0500594_0001013 | 3300053118 | Bacteria | 6025 |
| 566 | Ga0500597_092004 | 3300053120 | Bacteria | 1318 |
| 567 | Ga0500607_009334 | 3300053121 | Bacteria | 5907 |
| 568 | Ga0500608_158287 | 3300053122 | Bacteria | 984 |
| 569 | Ga0500655_001016 | 3300053133 | Bacteria | 5412 |
| 570 | Ga0500658_0018356 | 3300053134 | Bacteria | 2621 |
| 571 | Ga0500559_0041127 | 3300053136 | Bacteria | 2014 |
| 572 | Ga0500559_0044984 | 3300053136 | Bacteria | 1931 |
| 573 | Ga0500559_0086920 | 3300053136 | Bacteria | 1427 |
| 574 | Ga0500564_049607 | 3300053138 | Bacteria | 1922 |
| 575 | Ga0500564_150179 | 3300053138 | Bacteria | 994 |
| 576 | Ga0500568_0001792 | 3300053139 | Bacteria | 13230 |
| 577 | Ga0500574_000933 | 3300053141 | Bacteria | 4057 |
| 578 | Ga0500616_0043090 | 3300053153 | Bacteria | 2413 |
| 579 | Ga0500622_0146385 | 3300053156 | Bacteria | 1121 |
| 580 | Ga0500627_0001520 | 3300053158 | Bacteria | 6532 |
| 581 | Ga0500633_0086075 | 3300053160 | Bacteria | 1143 |
| 582 | Ga0500634_0002199 | 3300053161 | Bacteria | 8113 |
| 583 | Ga0500634_0077988 | 3300053161 | Bacteria | 1715 |
| 584 | Ga0500638_116713 | 3300053162 | Bacteria | 1226 |
| 585 | Ga0500636_0129632 | 3300053177 | Bacteria | 1406 |
| 586 | Ga0500645_001028 | 3300053730 | Bacteria | 15622 |
| 587 | Ga0500661_004013 | 3300055283 | Bacteria | 2755 |
| 588 | Ga0466962_0025893 | 3300061719 | Bacteria | 2815 |
| 589 | Ga0466962_0028646 | 3300061719 | Bacteria | 2667 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_1072873 | Ga0451577_1072873_43_654 | 202 |
| 2 | 3300002987 | JGI25159J45721_1020505 | JGI25159J45721_10205052 | 215 |
| 3 | 3300047445 | Ga0495677_0111153 | Ga0495677_0111153_382_1029 | 215 |
| 4 | 3300048924 | Ga0496121_0285992 | Ga0496121_0285992_19_666 | 215 |
| 5 | 3300042876 | Ga0451577_0274649 | Ga0451577_0274649_207_914 | 220 |
| 6 | 3300044712 | Ga0453684_0000163 | Ga0453684_0000163_270235_270942 | 220 |
| 7 | 3300045051 | Ga0451576_0040360 | Ga0451576_0040360_567_1274 | 220 |
| 8 | 3300045051 | Ga0451576_0161122 | Ga0451576_0161122_1527_2237 | 220 |
| 9 | 3300044673 | Ga0453683_0116928 | Ga0453683_0116928_809_1516 | 232 |
| 10 | 3300045051 | Ga0451576_0100037 | Ga0451576_0100037_1049_1756 | 232 |
| 11 | 3300006195 | Ga0075366_10027848 | Ga0075366_100278484 | 233 |
| 12 | 3300009176 | Ga0105242_10343592 | Ga0105242_103435922 | 233 |
| 13 | 3300011119 | Ga0105246_10048846 | Ga0105246_100488462 | 233 |
| 14 | 3300031241 | Ga0265325_10017191 | Ga0265325_100171912 | 233 |
| 15 | 3300035691 | Ga0373931_0136387 | Ga0373931_0136387_17_778 | 233 |
| 16 | 3300042876 | Ga0451577_0121556 | Ga0451577_0121556_475_1185 | 233 |
| 17 | 3300042876 | Ga0451577_0347000 | Ga0451577_0347000_503_1213 | 233 |
| 18 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_880577_881287 | 233 |
| 19 | 3300044712 | Ga0453684_0000341 | Ga0453684_0000341_83886_84596 | 233 |
| 20 | 3300044712 | Ga0453684_0000511 | Ga0453684_0000511_139_849 | 233 |
| 21 | 3300044712 | Ga0453684_0076534 | Ga0453684_0076534_1160_1870 | 233 |
| 22 | 3300045051 | Ga0451576_0000266 | Ga0451576_0000266_46070_46780 | 233 |
| 23 | 3300050493 | nmdc:mga0k408_13299_c1 | nmdc:mga0k408_13299_c1_3045_3824 | 233 |
| 24 | 3300005330 | Ga0070690_100050185 | Ga0070690_1000501852 | 234 |
| 25 | 3300005334 | Ga0068869_100392877 | Ga0068869_1003928771 | 234 |
| 26 | 3300005455 | Ga0070663_100367993 | Ga0070663_1003679931 | 234 |
| 27 | 3300005719 | Ga0068861_100127322 | Ga0068861_1001273222 | 234 |
| 28 | 3300006237 | Ga0097621_100587714 | Ga0097621_1005877142 | 234 |
| 29 | 3300013297 | Ga0157378_10292403 | Ga0157378_102924032 | 234 |
| 30 | 3300014968 | Ga0157379_10206476 | Ga0157379_102064762 | 234 |
| 31 | 3300025942 | Ga0207689_10263201 | Ga0207689_102632012 | 234 |
| 32 | 3300005327 | Ga0070658_10122976 | Ga0070658_101229762 | 235 |
| 33 | 3300005339 | Ga0070660_100284005 | Ga0070660_1002840052 | 235 |
| 34 | 3300005466 | Ga0070685_10060194 | Ga0070685_100601942 | 235 |
| 35 | 3300005548 | Ga0070665_100198795 | Ga0070665_1001987953 | 240 |
| 36 | 3300028379 | Ga0268266_10056764 | Ga0268266_100567646 | 240 |
| 37 | 3300025907 | Ga0207645_10246467 | Ga0207645_102464672 | 242 |
| 38 | 3300028794 | Ga0307515_10342685 | Ga0307515_103426851 | 243 |
| 39 | 3300046515 | Ga0495620_0008764 | Ga0495620_0008764_4243_5025 | 243 |
| 40 | 3300046520 | Ga0495637_0072024 | Ga0495637_0072024_514_1296 | 243 |
| 41 | 3300046530 | Ga0495654_0066438 | Ga0495654_0066438_182_964 | 243 |
| 42 | 3300046664 | Ga0495659_0081908 | Ga0495659_0081908_160_942 | 243 |
| 43 | 3300046691 | Ga0495670_0093600 | Ga0495670_0093600_682_1464 | 243 |
| 44 | 3300046692 | Ga0495671_0052500 | Ga0495671_0052500_148_930 | 243 |
| 45 | 3300053079 | Ga0500610_0030293 | Ga0500610_0030293_1099_1881 | 243 |
| 46 | 3300053109 | Ga0500569_068011 | Ga0500569_068011_268_1050 | 243 |
| 47 | 3300053117 | Ga0500593_000312 | Ga0500593_000312_4939_5721 | 243 |
| 48 | 3300053158 | Ga0500627_0001520 | Ga0500627_0001520_4391_5173 | 243 |
| 49 | 3300053161 | Ga0500634_0077988 | Ga0500634_0077988_85_867 | 243 |
| 50 | 3300009148 | Ga0105243_10162587 | Ga0105243_101625872 | 244 |
| 51 | 3300038443 | Ga0395901_0453258 | Ga0395901_0453258_278_1030 | 244 |
| 52 | 3300037471 | Ga0395905_0000728 | Ga0395905_0000728_5607_6374 | 245 |
| 53 | 3300035691 | Ga0373931_0039317 | Ga0373931_0039317_1043_1816 | 246 |
| 54 | 3300046492 | Ga0495585_0008753 | Ga0495585_0008753_4092_4865 | 246 |
| 55 | 3300048908 | Ga0496105_0336379 | Ga0496105_0336379_285_1046 | 246 |
| 56 | 3300032002 | Ga0307416_100791813 | Ga0307416_1007918131 | 247 |
| 57 | iso_pu_bacteria | 2511231002 | 2511244641 | 247 |
| 58 | iso_pu_bacteria | 2643221609 | 2644062224 | 247 |
| 59 | iso_pu_bacteria | 2643221611 | 2644071412 | 247 |
| 60 | iso_pu_bacteria | 2738543012 | 2739245835 | 247 |
| 61 | iso_pu_bacteria | 2738543013 | 2739250105 | 247 |
| 62 | iso_pu_bacteria | 2816332133 | 2816470529 | 247 |
| 63 | iso_pu_bacteria | 2842733646 | 2842736389 | 247 |
| 64 | iso_pu_bacteria | 2842747753 | 2842748897 | 247 |
| 65 | iso_pu_bacteria | 2885192300 | 2885196965 | 247 |
| 66 | iso_pu_bacteria | 2919704043 | 2919707111 | 247 |
| 67 | iso_pu_bacteria | 2928115317 | 2928118006 | 247 |
| 68 | iso_pu_bacteria | 2932422444 | 2932424017 | 247 |
| 69 | 3300037312 | Ga0395899_0008661 | Ga0395899_0008661_661_1413 | 249 |
| 70 | 3300003792 | Ga0055540_1013552 | Ga0055540_10135523 | 250 |
| 71 | 3300025303 | Ga0209051_1000904 | Ga0209051_100090423 | 250 |
| 72 | 3300031456 | Ga0307513_10000008 | Ga0307513_1000000810 | 250 |
| 73 | 3300037312 | Ga0395899_0086072 | Ga0395899_0086072_170_925 | 250 |
| 74 | 3300037418 | Ga0395900_0015874 | Ga0395900_0015874_1156_1911 | 250 |
| 75 | 3300037471 | Ga0395905_0044151 | Ga0395905_0044151_974_1729 | 250 |
| 76 | 3300038443 | Ga0395901_0023253 | Ga0395901_0023253_2537_3292 | 250 |
| 77 | 3300044712 | Ga0453684_0324572 | Ga0453684_0324572_610_1362 | 250 |
| 78 | 3300045049 | Ga0466959_0115012 | Ga0466959_0115012_859_1614 | 250 |
| 79 | 3300061719 | Ga0466962_0028646 | Ga0466962_0028646_763_1518 | 250 |
| 80 | 3300002704 | JGI25155J39150_1000022 | JGI25155J39150_1000022109 | 251 |
| 81 | 3300002705 | JGI25156J39149_1000005 | JGI25156J39149_1000005101 | 251 |
| 82 | 3300002705 | JGI25156J39149_1004039 | JGI25156J39149_10040392 | 251 |
| 83 | 3300002738 | JGI25154J39366_1000017 | JGI25154J39366_100001793 | 251 |
| 84 | 3300002738 | JGI25154J39366_1001087 | JGI25154J39366_10010876 | 251 |
| 85 | 3300002741 | JGI25157J39369_1000003 | JGI25157J39369_1000003109 | 251 |
| 86 | 3300002741 | JGI25157J39369_1000245 | JGI25157J39369_10002457 | 251 |
| 87 | 3300002987 | JGI25159J45721_1001343 | JGI25159J45721_10013432 | 251 |
| 88 | 3300003187 | JGI25151J46595_10026761 | JGI25151J46595_100267611 | 251 |
| 89 | 3300003187 | JGI25151J46595_10037206 | JGI25151J46595_100372062 | 251 |
| 90 | 3300003322 | rootL2_10001954 | rootL2_100019541 | 251 |
| 91 | 3300003322 | rootL2_10001955 | rootL2_100019552 | 251 |
| 92 | 3300003323 | rootH1_10059193 | rootH1_100591932 | 251 |
| 93 | 3300003323 | rootH1_10063216 | rootH1_100632161 | 251 |
| 94 | 3300003323 | rootH1_10152291 | rootH1_101522911 | 251 |
| 95 | 3300003354 | JGI25160J50197_1000273 | JGI25160J50197_100027338 | 251 |
| 96 | 3300003374 | JGI25161J50226_1000095 | JGI25161J50226_100009548 | 251 |
| 97 | 3300003752 | Ga0055539_1004233 | Ga0055539_10042332 | 251 |
| 98 | 3300003756 | Ga0055533_1000045 | Ga0055533_100004581 | 251 |
| 99 | 3300003759 | Ga0055525_1000681 | Ga0055525_10006819 | 251 |
| 100 | 3300003761 | Ga0055535_1000047 | Ga0055535_100004737 | 251 |
| 101 | 3300003761 | Ga0055535_1008828 | Ga0055535_10088282 | 251 |
| 102 | 3300003763 | Ga0055529_1000148 | Ga0055529_100014847 | 251 |
| 103 | 3300003771 | Ga0055526_1040515 | Ga0055526_10405151 | 251 |
| 104 | 3300003771 | Ga0055526_1054393 | Ga0055526_10543931 | 251 |
| 105 | 3300003773 | Ga0055537_1000205 | Ga0055537_100020513 | 251 |
| 106 | 3300003773 | Ga0055537_1012545 | Ga0055537_10125452 | 251 |
| 107 | 3300003775 | Ga0055524_1000073 | Ga0055524_100007361 | 251 |
| 108 | 3300003781 | Ga0055536_1041960 | Ga0055536_10419601 | 251 |
| 109 | 3300003784 | Ga0055534_1000363 | Ga0055534_10003638 | 251 |
| 110 | 3300003790 | Ga0055528_1000289 | Ga0055528_100028934 | 251 |
| 111 | 3300003791 | Ga0055530_10001804 | Ga0055530_1000180412 | 251 |
| 112 | 3300003792 | Ga0055540_1000037 | Ga0055540_100003773 | 251 |
| 113 | 3300004625 | Ga0055543_1000218 | Ga0055543_100021846 | 251 |
| 114 | 3300005262 | Ga0065165_1020502 | Ga0065165_10205021 | 251 |
| 115 | 3300005262 | Ga0065165_1028953 | Ga0065165_10289532 | 251 |
| 116 | 3300005327 | Ga0070658_10185759 | Ga0070658_101857592 | 251 |
| 117 | 3300005327 | Ga0070658_10233536 | Ga0070658_102335362 | 251 |
| 118 | 3300005336 | Ga0070680_100199107 | Ga0070680_1001991071 | 251 |
| 119 | 3300005338 | Ga0068868_100408899 | Ga0068868_1004088991 | 251 |
| 120 | 3300005339 | Ga0070660_100672394 | Ga0070660_1006723941 | 251 |
| 121 | 3300005347 | Ga0070668_100315975 | Ga0070668_1003159752 | 251 |
| 122 | 3300005353 | Ga0070669_100074138 | Ga0070669_1000741382 | 251 |
| 123 | 3300005356 | Ga0070674_100387459 | Ga0070674_1003874591 | 251 |
| 124 | 3300005367 | Ga0070667_100024333 | Ga0070667_1000243333 | 251 |
| 125 | 3300005435 | Ga0070714_100083618 | Ga0070714_1000836182 | 251 |
| 126 | 3300005456 | Ga0070678_100144392 | Ga0070678_1001443922 | 251 |
| 127 | 3300005456 | Ga0070678_100161283 | Ga0070678_1001612832 | 251 |
| 128 | 3300005456 | Ga0070678_100391141 | Ga0070678_1003911411 | 251 |
| 129 | 3300005459 | Ga0068867_100330050 | Ga0068867_1003300502 | 251 |
| 130 | 3300005530 | Ga0070679_100018152 | Ga0070679_1000181525 | 251 |
| 131 | 3300005535 | Ga0070684_100240023 | Ga0070684_1002400232 | 251 |
| 132 | 3300005539 | Ga0068853_100460639 | Ga0068853_1004606392 | 251 |
| 133 | 3300005543 | Ga0070672_100229911 | Ga0070672_1002299112 | 251 |
| 134 | 3300005548 | Ga0070665_100208694 | Ga0070665_1002086942 | 251 |
| 135 | 3300005548 | Ga0070665_100755340 | Ga0070665_1007553401 | 251 |
| 136 | 3300005563 | Ga0068855_100058788 | Ga0068855_1000587885 | 251 |
| 137 | 3300005563 | Ga0068855_100663926 | Ga0068855_1006639261 | 251 |
| 138 | 3300005577 | Ga0068857_100113459 | Ga0068857_1001134593 | 251 |
| 139 | 3300005578 | Ga0068854_100006652 | Ga0068854_1000066527 | 251 |
| 140 | 3300005614 | Ga0068856_100001716 | Ga0068856_10000171625 | 251 |
| 141 | 3300005616 | Ga0068852_100074653 | Ga0068852_1000746535 | 251 |
| 142 | 3300006038 | Ga0075365_10085442 | Ga0075365_100854423 | 251 |
| 143 | 3300006038 | Ga0075365_10335112 | Ga0075365_103351121 | 251 |
| 144 | 3300006038 | Ga0075365_10351819 | Ga0075365_103518191 | 251 |
| 145 | 3300006042 | Ga0075368_10021135 | Ga0075368_100211352 | 251 |
| 146 | 3300006048 | Ga0075363_100046512 | Ga0075363_1000465122 | 251 |
| 147 | 3300006048 | Ga0075363_100102574 | Ga0075363_1001025742 | 251 |
| 148 | 3300006048 | Ga0075363_100184856 | Ga0075363_1001848562 | 251 |
| 149 | 3300006051 | Ga0075364_10088058 | Ga0075364_100880582 | 251 |
| 150 | 3300006058 | Ga0075432_10002101 | Ga0075432_100021017 | 251 |
| 151 | 3300006177 | Ga0075362_10018885 | Ga0075362_100188853 | 251 |
| 152 | 3300006177 | Ga0075362_10030388 | Ga0075362_100303882 | 251 |
| 153 | 3300006177 | Ga0075362_10059452 | Ga0075362_100594521 | 251 |
| 154 | 3300006178 | Ga0075367_10173370 | Ga0075367_101733702 | 251 |
| 155 | 3300006195 | Ga0075366_10005340 | Ga0075366_100053404 | 251 |
| 156 | 3300006195 | Ga0075366_10040299 | Ga0075366_100402992 | 251 |
| 157 | 3300006195 | Ga0075366_10060547 | Ga0075366_100605472 | 251 |
| 158 | 3300006195 | Ga0075366_10068694 | Ga0075366_100686943 | 251 |
| 159 | 3300006195 | Ga0075366_10074728 | Ga0075366_100747281 | 251 |
| 160 | 3300006195 | Ga0075366_10076797 | Ga0075366_100767972 | 251 |
| 161 | 3300006195 | Ga0075366_10172023 | Ga0075366_101720232 | 251 |
| 162 | 3300006195 | Ga0075366_10335153 | Ga0075366_103351531 | 251 |
| 163 | 3300006353 | Ga0075370_10003632 | Ga0075370_100036323 | 251 |
| 164 | 3300006353 | Ga0075370_10050148 | Ga0075370_100501482 | 251 |
| 165 | 3300006353 | Ga0075370_10225733 | Ga0075370_102257332 | 251 |
| 166 | 3300006353 | Ga0075370_10261441 | Ga0075370_102614412 | 251 |
| 167 | 3300006846 | Ga0075430_100169916 | Ga0075430_1001699162 | 251 |
| 168 | 3300006946 | Ga0079104_1040443 | Ga0079104_10404432 | 251 |
| 169 | 3300009093 | Ga0105240_10008945 | Ga0105240_1000894519 | 251 |
| 170 | 3300009093 | Ga0105240_10271816 | Ga0105240_102718162 | 251 |
| 171 | 3300009093 | Ga0105240_10283589 | Ga0105240_102835892 | 251 |
| 172 | 3300009174 | Ga0105241_10220982 | Ga0105241_102209822 | 251 |
| 173 | 3300009176 | Ga0105242_10004226 | Ga0105242_100042268 | 251 |
| 174 | 3300009176 | Ga0105242_10631114 | Ga0105242_106311141 | 251 |
| 175 | 3300009545 | Ga0105237_10306461 | Ga0105237_103064612 | 251 |
| 176 | 3300009551 | Ga0105238_10025724 | Ga0105238_100257242 | 251 |
| 177 | 3300009551 | Ga0105238_10163019 | Ga0105238_101630193 | 251 |
| 178 | 3300009551 | Ga0105238_10167037 | Ga0105238_101670372 | 251 |
| 179 | 3300010375 | Ga0105239_10160843 | Ga0105239_101608432 | 251 |
| 180 | 3300011119 | Ga0105246_10310789 | Ga0105246_103107891 | 251 |
| 181 | 3300013105 | Ga0157369_10024224 | Ga0157369_100242246 | 251 |
| 182 | 3300013296 | Ga0157374_10919092 | Ga0157374_109190921 | 251 |
| 183 | 3300013306 | Ga0163162_10083970 | Ga0163162_100839702 | 251 |
| 184 | 3300013306 | Ga0163162_10458657 | Ga0163162_104586572 | 251 |
| 185 | 3300013307 | Ga0157372_10197385 | Ga0157372_101973853 | 251 |
| 186 | 3300013308 | Ga0157375_10246811 | Ga0157375_102468112 | 251 |
| 187 | 3300013308 | Ga0157375_10966913 | Ga0157375_109669131 | 251 |
| 188 | 3300014326 | Ga0157380_10330018 | Ga0157380_103300182 | 251 |
| 189 | 3300014497 | Ga0182008_10058182 | Ga0182008_100581822 | 251 |
| 190 | 3300014497 | Ga0182008_10076765 | Ga0182008_100767652 | 251 |
| 191 | 3300014497 | Ga0182008_10161869 | Ga0182008_101618692 | 251 |
| 192 | 3300014969 | Ga0157376_10188012 | Ga0157376_101880122 | 251 |
| 193 | 3300014969 | Ga0157376_10441386 | Ga0157376_104413862 | 251 |
| 194 | 3300015261 | Ga0182006_1039095 | Ga0182006_10390952 | 251 |
| 195 | 3300015262 | Ga0182007_10002638 | Ga0182007_100026389 | 251 |
| 196 | 3300015683 | Ga0183362_10003 | Ga0183362_10003611 | 251 |
| 197 | 3300017792 | Ga0163161_10217858 | Ga0163161_102178582 | 251 |
| 198 | 3300017792 | Ga0163161_10316030 | Ga0163161_103160302 | 251 |
| 199 | 3300021361 | Ga0213872_10038199 | Ga0213872_100381992 | 251 |
| 200 | 3300025206 | Ga0209435_100002 | Ga0209435_100002217 | 251 |
| 201 | 3300025208 | Ga0209436_109303 | Ga0209436_1093032 | 251 |
| 202 | 3300025226 | Ga0209674_100073 | Ga0209674_10007381 | 251 |
| 203 | 3300025230 | Ga0209563_100061 | Ga0209563_100061149 | 251 |
| 204 | 3300025231 | Ga0207427_101392 | Ga0207427_1013925 | 251 |
| 205 | 3300025242 | Ga0209258_100072 | Ga0209258_100072230 | 251 |
| 206 | 3300025242 | Ga0209258_104057 | Ga0209258_1040572 | 251 |
| 207 | 3300025245 | Ga0207425_1002688 | Ga0207425_10026882 | 251 |
| 208 | 3300025245 | Ga0207425_1003670 | Ga0207425_10036702 | 251 |
| 209 | 3300025246 | Ga0209646_1000001 | Ga0209646_10000012360 | 251 |
| 210 | 3300025246 | Ga0209646_1000076 | Ga0209646_1000076153 | 251 |
| 211 | 3300025250 | Ga0209026_1000001 | Ga0209026_10000011017 | 251 |
| 212 | 3300025250 | Ga0209026_1000011 | Ga0209026_1000011337 | 251 |
| 213 | 3300025253 | Ga0209677_100070 | Ga0209677_10007064 | 251 |
| 214 | 3300025253 | Ga0209677_102967 | Ga0209677_1029675 | 251 |
| 215 | 3300025254 | Ga0209148_1003914 | Ga0209148_10039143 | 251 |
| 216 | 3300025256 | Ga0209759_1000001 | Ga0209759_10000011991 | 251 |
| 217 | 3300025256 | Ga0209759_1000034 | Ga0209759_1000034139 | 251 |
| 218 | 3300025256 | Ga0209759_1010366 | Ga0209759_10103663 | 251 |
| 219 | 3300025256 | Ga0209759_1019829 | Ga0209759_10198292 | 251 |
| 220 | 3300025258 | Ga0209129_1029630 | Ga0209129_10296301 | 251 |
| 221 | 3300025263 | Ga0209565_1000128 | Ga0209565_100012871 | 251 |
| 222 | 3300025263 | Ga0209565_1000574 | Ga0209565_10005741 | 251 |
| 223 | 3300025272 | Ga0209455_1000053 | Ga0209455_1000053310 | 251 |
| 224 | 3300025273 | Ga0209673_1000008 | Ga0209673_100000894 | 251 |
| 225 | 3300025284 | Ga0209130_1000072 | Ga0209130_100007254 | 251 |
| 226 | 3300025284 | Ga0209130_1001611 | Ga0209130_100161113 | 251 |
| 227 | 3300025291 | Ga0209675_1000099 | Ga0209675_10000992 | 251 |
| 228 | 3300025291 | Ga0209675_1009484 | Ga0209675_10094842 | 251 |
| 229 | 3300025292 | Ga0209676_1000023 | Ga0209676_1000023340 | 251 |
| 230 | 3300025292 | Ga0209676_1003664 | Ga0209676_10036642 | 251 |
| 231 | 3300025294 | Ga0209025_1006053 | Ga0209025_100605311 | 251 |
| 232 | 3300025294 | Ga0209025_1014674 | Ga0209025_10146743 | 251 |
| 233 | 3300025294 | Ga0209025_1017536 | Ga0209025_10175365 | 251 |
| 234 | 3300025294 | Ga0209025_1033673 | Ga0209025_10336732 | 251 |
| 235 | 3300025294 | Ga0209025_1042659 | Ga0209025_10426591 | 251 |
| 236 | 3300025295 | Ga0209564_1007849 | Ga0209564_10078497 | 251 |
| 237 | 3300025295 | Ga0209564_1049592 | Ga0209564_10495922 | 251 |
| 238 | 3300025297 | Ga0209758_1028519 | Ga0209758_10285192 | 251 |
| 239 | 3300025298 | Ga0209050_1000022 | Ga0209050_1000022322 | 251 |
| 240 | 3300025298 | Ga0209050_1011134 | Ga0209050_10111346 | 251 |
| 241 | 3300025299 | Ga0209256_1000001 | Ga0209256_10000011808 | 251 |
| 242 | 3300025302 | Ga0207426_1000319 | Ga0207426_100031948 | 251 |
| 243 | 3300025302 | Ga0207426_1013921 | Ga0207426_10139211 | 251 |
| 244 | 3300025303 | Ga0209051_1000013 | Ga0209051_1000013322 | 251 |
| 245 | 3300025304 | Ga0209257_1000042 | Ga0209257_1000042165 | 251 |
| 246 | 3300025909 | Ga0207705_10254625 | Ga0207705_102546252 | 251 |
| 247 | 3300025911 | Ga0207654_10057855 | Ga0207654_100578551 | 251 |
| 248 | 3300025911 | Ga0207654_10166896 | Ga0207654_101668962 | 251 |
| 249 | 3300025913 | Ga0207695_10005493 | Ga0207695_100054936 | 251 |
| 250 | 3300025913 | Ga0207695_10123790 | Ga0207695_101237904 | 251 |
| 251 | 3300025914 | Ga0207671_10119636 | Ga0207671_101196362 | 251 |
| 252 | 3300025917 | Ga0207660_10228767 | Ga0207660_102287672 | 251 |
| 253 | 3300025919 | Ga0207657_10062642 | Ga0207657_100626422 | 251 |
| 254 | 3300025923 | Ga0207681_10055268 | Ga0207681_100552682 | 251 |
| 255 | 3300025924 | Ga0207694_10130298 | Ga0207694_101302982 | 251 |
| 256 | 3300025924 | Ga0207694_10304733 | Ga0207694_103047332 | 251 |
| 257 | 3300025933 | Ga0207706_10451288 | Ga0207706_104512882 | 251 |
| 258 | 3300025934 | Ga0207686_10000954 | Ga0207686_100009548 | 251 |
| 259 | 3300025937 | Ga0207669_10020071 | Ga0207669_100200716 | 251 |
| 260 | 3300025940 | Ga0207691_10387692 | Ga0207691_103876922 | 251 |
| 261 | 3300025942 | Ga0207689_10074760 | Ga0207689_100747602 | 251 |
| 262 | 3300025944 | Ga0207661_10472575 | Ga0207661_104725751 | 251 |
| 263 | 3300025949 | Ga0207667_10228580 | Ga0207667_102285802 | 251 |
| 264 | 3300025972 | Ga0207668_10393799 | Ga0207668_103937991 | 251 |
| 265 | 3300025986 | Ga0207658_10039090 | Ga0207658_100390902 | 251 |
| 266 | 3300026023 | Ga0207677_10238017 | Ga0207677_102380171 | 251 |
| 267 | 3300026023 | Ga0207677_10239766 | Ga0207677_102397662 | 251 |
| 268 | 3300026023 | Ga0207677_10362980 | Ga0207677_103629802 | 251 |
| 269 | 3300026078 | Ga0207702_10001565 | Ga0207702_100015654 | 251 |
| 270 | 3300026088 | Ga0207641_10064069 | Ga0207641_100640692 | 251 |
| 271 | 3300026089 | Ga0207648_10173845 | Ga0207648_101738451 | 251 |
| 272 | 3300026089 | Ga0207648_10463245 | Ga0207648_104632452 | 251 |
| 273 | 3300026116 | Ga0207674_10005653 | Ga0207674_1000565314 | 251 |
| 274 | 3300026116 | Ga0207674_10147041 | Ga0207674_101470412 | 251 |
| 275 | 3300026121 | Ga0207683_10068293 | Ga0207683_100682932 | 251 |
| 276 | 3300026121 | Ga0207683_10278496 | Ga0207683_102784962 | 251 |
| 277 | 3300027866 | Ga0209813_10035939 | Ga0209813_100359392 | 251 |
| 278 | 3300027907 | Ga0207428_10150538 | Ga0207428_101505382 | 251 |
| 279 | 3300028379 | Ga0268266_10076416 | Ga0268266_100764162 | 251 |
| 280 | 3300028379 | Ga0268266_10109427 | Ga0268266_101094274 | 251 |
| 281 | 3300028666 | Ga0265336_10000036 | Ga0265336_1000003655 | 251 |
| 282 | 3300028794 | Ga0307515_10000084 | Ga0307515_10000084153 | 251 |
| 283 | 3300028794 | Ga0307515_10004716 | Ga0307515_1000471617 | 251 |
| 284 | 3300028794 | Ga0307515_10134564 | Ga0307515_101345642 | 251 |
| 285 | 3300029957 | Ga0265324_10000136 | Ga0265324_1000013626 | 251 |
| 286 | 3300030522 | Ga0307512_10175081 | Ga0307512_101750812 | 251 |
| 287 | 3300031239 | Ga0265328_10055880 | Ga0265328_100558802 | 251 |
| 288 | 3300031251 | Ga0265327_10008835 | Ga0265327_100088352 | 251 |
| 289 | 3300031251 | Ga0265327_10169866 | Ga0265327_101698661 | 251 |
| 290 | 3300031456 | Ga0307513_10000038 | Ga0307513_10000038148 | 251 |
| 291 | 3300031548 | Ga0307408_100017442 | Ga0307408_1000174426 | 251 |
| 292 | 3300031548 | Ga0307408_100035804 | Ga0307408_1000358042 | 251 |
| 293 | 3300031649 | Ga0307514_10000319 | Ga0307514_100003199 | 251 |
| 294 | 3300031730 | Ga0307516_10004973 | Ga0307516_1000497318 | 251 |
| 295 | 3300031730 | Ga0307516_10029845 | Ga0307516_100298452 | 251 |
| 296 | 3300031731 | Ga0307405_10066088 | Ga0307405_100660882 | 251 |
| 297 | 3300031731 | Ga0307405_10085066 | Ga0307405_100850662 | 251 |
| 298 | 3300031901 | Ga0307406_10015826 | Ga0307406_100158263 | 251 |
| 299 | 3300031911 | Ga0307412_10461958 | Ga0307412_104619582 | 251 |
| 300 | 3300032002 | Ga0307416_100275069 | Ga0307416_1002750692 | 251 |
| 301 | 3300037418 | Ga0395900_0026531 | Ga0395900_0026531_3492_4253 | 251 |
| 302 | 3300037418 | Ga0395900_0188545 | Ga0395900_0188545_1133_1888 | 251 |
| 303 | 3300037466 | Ga0395898_0004158 | Ga0395898_0004158_12178_12939 | 251 |
| 304 | 3300037466 | Ga0395898_0044157 | Ga0395898_0044157_97_876 | 251 |
| 305 | 3300037471 | Ga0395905_0025949 | Ga0395905_0025949_664_1425 | 251 |
| 306 | 3300037471 | Ga0395905_0029854 | Ga0395905_0029854_4307_5068 | 251 |
| 307 | 3300038443 | Ga0395901_0003179 | Ga0395901_0003179_4366_5145 | 251 |
| 308 | 3300038443 | Ga0395901_0090939 | Ga0395901_0090939_2094_2855 | 251 |
| 309 | 3300038443 | Ga0395901_0241545 | Ga0395901_0241545_233_988 | 251 |
| 310 | 3300039447 | Ga0436361_0567754 | Ga0436361_0567754_1366_2148 | 251 |
| 311 | 3300039447 | Ga0436361_0711422 | Ga0436361_0711422_421_1185 | 251 |
| 312 | 3300041404 | Ga0439436_0000668 | Ga0439436_0000668_564_1319 | 251 |
| 313 | 3300041404 | Ga0439436_0034512 | Ga0439436_0034512_157_912 | 251 |
| 314 | 3300041406 | Ga0439439_0019710 | Ga0439439_0019710_759_1514 | 251 |
| 315 | 3300041407 | Ga0439447_039433 | Ga0439447_039433_137_892 | 251 |
| 316 | 3300041410 | Ga0439461_0017351 | Ga0439461_0017351_241_996 | 251 |
| 317 | 3300041411 | Ga0439466_0008629 | Ga0439466_0008629_2665_3420 | 251 |
| 318 | 3300041411 | Ga0439466_0016919 | Ga0439466_0016919_721_1476 | 251 |
| 319 | 3300041413 | Ga0439465_0004974 | Ga0439465_0004974_3309_4064 | 251 |
| 320 | 3300041451 | Ga0451791_1208931 | Ga0451791_1208931_181_936 | 251 |
| 321 | 3300041459 | Ga0451800_1061636 | Ga0451800_1061636_53_808 | 251 |
| 322 | 3300041459 | Ga0451800_1566960 | Ga0451800_1566960_78_836 | 251 |
| 323 | 3300041486 | Ga0451807_0755093 | Ga0451807_0755093_123_878 | 251 |
| 324 | 3300041997 | Ga0439431_0013193 | Ga0439431_0013193_269_1024 | 251 |
| 325 | 3300041997 | Ga0439431_0040539 | Ga0439431_0040539_294_1049 | 251 |
| 326 | 3300041999 | Ga0439433_0009473 | Ga0439433_0009473_492_1247 | 251 |
| 327 | 3300042002 | Ga0439442_033853 | Ga0439442_033853_74_829 | 251 |
| 328 | 3300042004 | Ga0439445_0000200 | Ga0439445_0000200_1663_2418 | 251 |
| 329 | 3300042004 | Ga0439445_0023535 | Ga0439445_0023535_335_1105 | 251 |
| 330 | 3300042006 | Ga0439432_012869 | Ga0439432_012869_1894_2649 | 251 |
| 331 | 3300042006 | Ga0439432_043463 | Ga0439432_043463_325_1080 | 251 |
| 332 | 3300042007 | Ga0439449_0001627 | Ga0439449_0001627_5153_5908 | 251 |
| 333 | 3300042007 | Ga0439449_0043017 | Ga0439449_0043017_341_1096 | 251 |
| 334 | 3300042010 | Ga0439452_013026 | Ga0439452_013026_1444_2199 | 251 |
| 335 | 3300042010 | Ga0439452_019885 | Ga0439452_019885_712_1467 | 251 |
| 336 | 3300042014 | Ga0439457_007541 | Ga0439457_007541_885_1640 | 251 |
| 337 | 3300042015 | Ga0439462_0018109 | Ga0439462_0018109_781_1536 | 251 |
| 338 | 3300042115 | Ga0450911_000822 | Ga0450911_000822_7117_7887 | 251 |
| 339 | 3300042115 | Ga0450911_019713 | Ga0450911_019713_101_859 | 251 |
| 340 | 3300042134 | Ga0450898_005473 | Ga0450898_005473_723_1478 | 251 |
| 341 | 3300042156 | Ga0439446_0024648 | Ga0439446_0024648_280_1035 | 251 |
| 342 | 3300042156 | Ga0439446_0065110 | Ga0439446_0065110_156_914 | 251 |
| 343 | 3300042435 | Ga0439434_0005498 | Ga0439434_0005498_2519_3274 | 251 |
| 344 | 3300044656 | Ga0466969_0008057 | Ga0466969_0008057_330_1124 | 251 |
| 345 | 3300044656 | Ga0466969_0020418 | Ga0466969_0020418_1246_2013 | 251 |
| 346 | 3300044673 | Ga0453683_0002261 | Ga0453683_0002261_678_1436 | 251 |
| 347 | 3300044683 | Ga0466965_0011708 | Ga0466965_0011708_1205_1999 | 251 |
| 348 | 3300044683 | Ga0466965_0085773 | Ga0466965_0085773_422_1177 | 251 |
| 349 | 3300044684 | Ga0466966_0018169 | Ga0466966_0018169_3202_3969 | 251 |
| 350 | 3300044684 | Ga0466966_0026697 | Ga0466966_0026697_942_1736 | 251 |
| 351 | 3300044693 | Ga0466961_0002913 | Ga0466961_0002913_596_1363 | 251 |
| 352 | 3300044693 | Ga0466961_0045949 | Ga0466961_0045949_1448_2242 | 251 |
| 353 | 3300044694 | Ga0466963_0004061 | Ga0466963_0004061_6473_7240 | 251 |
| 354 | 3300044694 | Ga0466963_0092730 | Ga0466963_0092730_885_1679 | 251 |
| 355 | 3300044706 | Ga0466964_0004782 | Ga0466964_0004782_410_1177 | 251 |
| 356 | 3300044706 | Ga0466964_0033527 | Ga0466964_0033527_39_833 | 251 |
| 357 | 3300044719 | Ga0466971_0009165 | Ga0466971_0009165_3202_3969 | 251 |
| 358 | 3300044719 | Ga0466971_0019879 | Ga0466971_0019879_948_1742 | 251 |
| 359 | 3300044842 | Ga0466957_0038059 | Ga0466957_0038059_564_1358 | 251 |
| 360 | 3300045049 | Ga0466959_0000027 | Ga0466959_0000027_27044_27811 | 251 |
| 361 | 3300045049 | Ga0466959_0032585 | Ga0466959_0032585_965_1759 | 251 |
| 362 | 3300045051 | Ga0451576_0311637 | Ga0451576_0311637_302_1060 | 251 |
| 363 | 3300045051 | Ga0451576_0524088 | Ga0451576_0524088_396_1154 | 251 |
| 364 | 3300045051 | Ga0451576_0746238 | Ga0451576_0746238_59_814 | 251 |
| 365 | 3300045836 | Ga0466958_0009465 | Ga0466958_0009465_1225_2019 | 251 |
| 366 | 3300045976 | Ga0466967_0013629 | Ga0466967_0013629_736_1503 | 251 |
| 367 | 3300045976 | Ga0466967_0120891 | Ga0466967_0120891_645_1439 | 251 |
| 368 | 3300046459 | Ga0495629_0201584 | Ga0495629_0201584_271_1026 | 251 |
| 369 | 3300046471 | Ga0495650_0057591 | Ga0495650_0057591_449_1228 | 251 |
| 370 | 3300046475 | Ga0495639_0002158 | Ga0495639_0002158_6438_7217 | 251 |
| 371 | 3300046475 | Ga0495639_0039662 | Ga0495639_0039662_944_1699 | 251 |
| 372 | 3300046492 | Ga0495585_0138317 | Ga0495585_0138317_258_1037 | 251 |
| 373 | 3300046506 | Ga0495583_0000418 | Ga0495583_0000418_1000_1779 | 251 |
| 374 | 3300046507 | Ga0495606_0009174 | Ga0495606_0009174_2002_2781 | 251 |
| 375 | 3300046517 | Ga0495630_0415275 | Ga0495630_0415275_239_994 | 251 |
| 376 | 3300046530 | Ga0495654_0003583 | Ga0495654_0003583_828_1592 | 251 |
| 377 | 3300046539 | Ga0495621_0051475 | Ga0495621_0051475_285_1040 | 251 |
| 378 | 3300046615 | Ga0495656_0000757 | Ga0495656_0000757_367_1122 | 251 |
| 379 | 3300046660 | Ga0495625_0010094 | Ga0495625_0010094_1190_1969 | 251 |
| 380 | 3300046663 | Ga0495635_0243226 | Ga0495635_0243226_303_1058 | 251 |
| 381 | 3300046674 | Ga0495588_0134207 | Ga0495588_0134207_415_1170 | 251 |
| 382 | 3300046679 | Ga0495623_0206178 | Ga0495623_0206178_295_1074 | 251 |
| 383 | 3300046684 | Ga0495669_0024291 | Ga0495669_0024291_1274_2053 | 251 |
| 384 | 3300046794 | Ga0495589_0021916 | Ga0495589_0021916_894_1673 | 251 |
| 385 | 3300047315 | Ga0495581_0163543 | Ga0495581_0163543_214_969 | 251 |
| 386 | 3300047472 | Ga0495686_0010557 | Ga0495686_0010557_2169_2957 | 251 |
| 387 | 3300048090 | Ga0495615_0014509 | Ga0495615_0014509_832_1596 | 251 |
| 388 | 3300048903 | Ga0496100_0102783 | Ga0496100_0102783_532_1287 | 251 |
| 389 | 3300048903 | Ga0496100_0263640 | Ga0496100_0263640_135_914 | 251 |
| 390 | 3300048904 | Ga0496101_0090785 | Ga0496101_0090785_1168_1923 | 251 |
| 391 | 3300048905 | Ga0496102_0199998 | Ga0496102_0199998_1107_1862 | 251 |
| 392 | 3300048906 | Ga0496103_0132834 | Ga0496103_0132834_555_1310 | 251 |
| 393 | 3300048907 | Ga0496104_0251383 | Ga0496104_0251383_447_1202 | 251 |
| 394 | 3300048907 | Ga0496104_0298285 | Ga0496104_0298285_448_1215 | 251 |
| 395 | 3300048908 | Ga0496105_0011369 | Ga0496105_0011369_3650_4405 | 251 |
| 396 | 3300048909 | Ga0496106_0270485 | Ga0496106_0270485_355_1110 | 251 |
| 397 | 3300048910 | Ga0496107_0134858 | Ga0496107_0134858_508_1263 | 251 |
| 398 | 3300048912 | Ga0496109_0251001 | Ga0496109_0251001_522_1277 | 251 |
| 399 | 3300048925 | Ga0496122_0000612 | Ga0496122_0000612_72125_72880 | 251 |
| 400 | 3300048926 | Ga0496123_0000274 | Ga0496123_0000274_28916_29671 | 251 |
| 401 | 3300048928 | Ga0496125_0119390 | Ga0496125_0119390_885_1655 | 251 |
| 402 | 3300049763 | Ga0501266_000597 | Ga0501266_000597_250_1008 | 251 |
| 403 | 3300050489 | nmdc:mga03683_129285_c1 | nmdc:mga03683_129285_c1_278_1033 | 251 |
| 404 | 3300050490 | nmdc:mga03n38_174022_c1 | nmdc:mga03n38_174022_c1_124_879 | 251 |
| 405 | 3300050490 | nmdc:mga03n38_84859_c1 | nmdc:mga03n38_84859_c1_50_805 | 251 |
| 406 | 3300050492 | nmdc:mga0yw44_55092_c1 | nmdc:mga0yw44_55092_c1_782_1537 | 251 |
| 407 | 3300050493 | nmdc:mga0k408_12109_c1 | nmdc:mga0k408_12109_c1_2711_3466 | 251 |
| 408 | 3300050493 | nmdc:mga0k408_62654_c1 | nmdc:mga0k408_62654_c1_1112_1867 | 251 |
| 409 | 3300050493 | nmdc:mga0k408_738_c2 | nmdc:mga0k408_738_c2_4847_5605 | 251 |
| 410 | 3300050494 | nmdc:mga06z11_33845_c1 | nmdc:mga06z11_33845_c1_750_1505 | 251 |
| 411 | 3300050496 | nmdc:mga07m45_118507_c1 | nmdc:mga07m45_118507_c1_272_1027 | 251 |
| 412 | 3300050496 | nmdc:mga07m45_3314_c1 | nmdc:mga07m45_3314_c1_3224_3979 | 251 |
| 413 | 3300050496 | nmdc:mga07m45_522_c2 | nmdc:mga07m45_522_c2_733_1512 | 251 |
| 414 | 3300050496 | nmdc:mga07m45_58596_c1 | nmdc:mga07m45_58596_c1_1249_2004 | 251 |
| 415 | 3300053080 | Ga0500635_0000030 | Ga0500635_0000030_35455_36234 | 251 |
| 416 | 3300053117 | Ga0500593_060071 | Ga0500593_060071_249_1004 | 251 |
| 417 | 3300053136 | Ga0500559_0044984 | Ga0500559_0044984_720_1475 | 251 |
| 418 | 3300053136 | Ga0500559_0086920 | Ga0500559_0086920_105_884 | 251 |
| 419 | 3300053138 | Ga0500564_150179 | Ga0500564_150179_89_868 | 251 |
| 420 | 3300053156 | Ga0500622_0146385 | Ga0500622_0146385_283_1038 | 251 |
| 421 | 3300053160 | Ga0500633_0086075 | Ga0500633_0086075_179_934 | 251 |
| 422 | 3300053177 | Ga0500636_0129632 | Ga0500636_0129632_424_1203 | 251 |
| 423 | 3300053730 | Ga0500645_001028 | Ga0500645_001028_14832_15587 | 251 |
| 424 | 3300055283 | Ga0500661_004013 | Ga0500661_004013_612_1391 | 251 |
| 425 | 3300061719 | Ga0466962_0025893 | Ga0466962_0025893_1356_2150 | 251 |
| 426 | iso_pu_bacteria | 2881101125 | 2881103423 | 251 |
| 427 | 3300046453 | Ga0495627_024060 | Ga0495627_024060_429_1190 | 253 |
| 428 | iso_pu_bacteria | 2738541277 | 2738720440 | 253 |
| 429 | iso_pu_bacteria | 2738541307 | 2738880373 | 253 |
| 430 | iso_pu_bacteria | 2738543019 | 2739279639 | 253 |
| 431 | iso_pu_bacteria | 2818991446 | 2819601122 | 253 |
| 432 | iso_pu_bacteria | 2831265667 | 2831271565 | 253 |
| 433 | iso_pu_bacteria | 2838054893 | 2838055467 | 253 |
| 434 | iso_pu_bacteria | 2842677519 | 2842682107 | 253 |
| 435 | iso_pu_bacteria | 2899924645 | 2899927532 | 253 |
| 436 | iso_pu_bacteria | 2904449895 | 2904450732 | 253 |
| 437 | iso_pu_bacteria | 2904456579 | 2904459768 | 253 |
| 438 | iso_pu_bacteria | 2919462493 | 2919462738 | 253 |
| 439 | iso_pu_bacteria | 2928037797 | 2928042556 | 253 |
| 440 | iso_pu_bacteria | 2928044640 | 2928049017 | 253 |
| 441 | iso_pu_bacteria | 2928051484 | 2928051567 | 253 |
| 442 | iso_pu_bacteria | 2928064002 | 2928070753 | 253 |
| 443 | iso_pu_bacteria | 2928084124 | 2928086985 | 253 |
| 444 | iso_pu_bacteria | 2929520902 | 2929521450 | 253 |
| 445 | iso_pu_bacteria | 2945945610 | 2945949462 | 253 |
| 446 | iso_pu_bacteria | 2945972063 | 2945973509 | 253 |
| 447 | iso_pu_bacteria | 2954767861 | 2954770878 | 253 |
| 448 | 3300006028 | Ga0070717_10155290 | Ga0070717_101552902 | 254 |
| 449 | iso_pu_bacteria | 2513020051 | 2513230125 | 254 |
| 450 | iso_pu_bacteria | 2643221658 | 2644324332 | 254 |
| 451 | iso_pu_bacteria | 2643221672 | 2644396176 | 254 |
| 452 | 2162886007 | SwRhRL2b_contig_12867 | SwRhRL2b_0430.00003270 | 257 |
| 453 | 2162886007 | SwRhRL2b_contig_3103763 | SwRhRL2b_0654.00004730 | 257 |
| 454 | 3300001979 | JGI24740J21852_10011180 | JGI24740J21852_100111803 | 257 |
| 455 | 3300002773 | JGI25152J39213_1013354 | JGI25152J39213_10133542 | 257 |
| 456 | 3300003187 | JGI25151J46595_10000864 | JGI25151J46595_100008644 | 257 |
| 457 | 3300003187 | JGI25151J46595_10023979 | JGI25151J46595_100239792 | 257 |
| 458 | 3300003215 | JGI25153J46596_10038610 | JGI25153J46596_100386102 | 257 |
| 459 | 3300003323 | rootH1_10028675 | rootH1_100286751 | 257 |
| 460 | 3300003374 | JGI25161J50226_1006851 | JGI25161J50226_10068512 | 257 |
| 461 | 3300003578 | Ga0006562J51391_1143153 | Ga0006562J51391_11431532 | 257 |
| 462 | 3300003761 | Ga0055535_1001458 | Ga0055535_10014587 | 257 |
| 463 | 3300003762 | Ga0055542_1000080 | Ga0055542_1000080114 | 257 |
| 464 | 3300003771 | Ga0055526_1035680 | Ga0055526_10356802 | 257 |
| 465 | 3300003773 | Ga0055537_1000150 | Ga0055537_100015041 | 257 |
| 466 | 3300003773 | Ga0055537_1016229 | Ga0055537_10162291 | 257 |
| 467 | 3300003775 | Ga0055524_1037856 | Ga0055524_10378561 | 257 |
| 468 | 3300003781 | Ga0055536_1017554 | Ga0055536_10175542 | 257 |
| 469 | 3300003781 | Ga0055536_1020774 | Ga0055536_10207741 | 257 |
| 470 | 3300003784 | Ga0055534_1000016 | Ga0055534_100001669 | 257 |
| 471 | 3300003784 | Ga0055534_1002375 | Ga0055534_10023752 | 257 |
| 472 | 3300003790 | Ga0055528_1018942 | Ga0055528_10189421 | 257 |
| 473 | 3300003790 | Ga0055528_1034095 | Ga0055528_10340951 | 257 |
| 474 | 3300003791 | Ga0055530_10013917 | Ga0055530_100139172 | 257 |
| 475 | 3300003791 | Ga0055530_10020135 | Ga0055530_100201351 | 257 |
| 476 | 3300003792 | Ga0055540_1016696 | Ga0055540_10166961 | 257 |
| 477 | 3300003792 | Ga0055540_1017448 | Ga0055540_10174481 | 257 |
| 478 | 3300003794 | Ga0055531_10013523 | Ga0055531_100135231 | 257 |
| 479 | 3300003794 | Ga0055531_10027364 | Ga0055531_100273641 | 257 |
| 480 | 3300004625 | Ga0055543_1009440 | Ga0055543_10094401 | 257 |
| 481 | 3300005289 | Ga0065704_10003100 | Ga0065704_100031003 | 257 |
| 482 | 3300005366 | Ga0070659_100120453 | Ga0070659_1001204532 | 257 |
| 483 | 3300005457 | Ga0070662_100120239 | Ga0070662_1001202392 | 257 |
| 484 | 3300005539 | Ga0068853_100093937 | Ga0068853_1000939371 | 257 |
| 485 | 3300005563 | Ga0068855_100314650 | Ga0068855_1003146502 | 257 |
| 486 | 3300005614 | Ga0068856_100103103 | Ga0068856_1001031035 | 257 |
| 487 | 3300006177 | Ga0075362_10166112 | Ga0075362_101661121 | 257 |
| 488 | 3300006195 | Ga0075366_10105788 | Ga0075366_101057882 | 257 |
| 489 | 3300006353 | Ga0075370_10002013 | Ga0075370_100020132 | 257 |
| 490 | 3300006353 | Ga0075370_10063133 | Ga0075370_100631332 | 257 |
| 491 | 3300006353 | Ga0075370_10102025 | Ga0075370_101020251 | 257 |
| 492 | 3300006358 | Ga0068871_100102473 | Ga0068871_1001024732 | 257 |
| 493 | 3300006948 | Ga0099826_10079164 | Ga0099826_100791642 | 257 |
| 494 | 3300009036 | Ga0105244_10003719 | Ga0105244_100037198 | 257 |
| 495 | 3300009093 | Ga0105240_10719343 | Ga0105240_107193432 | 257 |
| 496 | 3300009098 | Ga0105245_10188958 | Ga0105245_101889582 | 257 |
| 497 | 3300009148 | Ga0105243_10047127 | Ga0105243_100471272 | 257 |
| 498 | 3300009148 | Ga0105243_10460871 | Ga0105243_104608711 | 257 |
| 499 | 3300009545 | Ga0105237_10027197 | Ga0105237_100271976 | 257 |
| 500 | 3300010375 | Ga0105239_10919566 | Ga0105239_109195661 | 257 |
| 501 | 3300013102 | Ga0157371_10198264 | Ga0157371_101982641 | 257 |
| 502 | 3300013105 | Ga0157369_10022693 | Ga0157369_100226935 | 257 |
| 503 | 3300013307 | Ga0157372_10268779 | Ga0157372_102687792 | 257 |
| 504 | 3300014497 | Ga0182008_10060953 | Ga0182008_100609532 | 257 |
| 505 | 3300014497 | Ga0182008_10061799 | Ga0182008_100617992 | 257 |
| 506 | 3300015261 | Ga0182006_1027212 | Ga0182006_10272122 | 257 |
| 507 | 3300015261 | Ga0182006_1107396 | Ga0182006_11073962 | 257 |
| 508 | 3300015262 | Ga0182007_10028387 | Ga0182007_100283872 | 257 |
| 509 | 3300015262 | Ga0182007_10062422 | Ga0182007_100624222 | 257 |
| 510 | 3300017792 | Ga0163161_10145246 | Ga0163161_101452462 | 257 |
| 511 | 3300017792 | Ga0163161_10153856 | Ga0163161_101538561 | 257 |
| 512 | 3300025228 | Ga0209672_102374 | Ga0209672_1023743 | 257 |
| 513 | 3300025229 | Ga0209147_101277 | Ga0209147_1012775 | 257 |
| 514 | 3300025242 | Ga0209258_100009 | Ga0209258_100009964 | 257 |
| 515 | 3300025245 | Ga0207425_1008972 | Ga0207425_10089721 | 257 |
| 516 | 3300025254 | Ga0209148_1000007 | Ga0209148_1000007964 | 257 |
| 517 | 3300025258 | Ga0209129_1000404 | Ga0209129_100040436 | 257 |
| 518 | 3300025258 | Ga0209129_1012367 | Ga0209129_10123672 | 257 |
| 519 | 3300025263 | Ga0209565_1000098 | Ga0209565_1000098109 | 257 |
| 520 | 3300025263 | Ga0209565_1001099 | Ga0209565_10010996 | 257 |
| 521 | 3300025263 | Ga0209565_1002417 | Ga0209565_10024172 | 257 |
| 522 | 3300025273 | Ga0209673_1000058 | Ga0209673_1000058142 | 257 |
| 523 | 3300025273 | Ga0209673_1000410 | Ga0209673_100041053 | 257 |
| 524 | 3300025273 | Ga0209673_1000705 | Ga0209673_100070536 | 257 |
| 525 | 3300025284 | Ga0209130_1000295 | Ga0209130_100029545 | 257 |
| 526 | 3300025291 | Ga0209675_1000010 | Ga0209675_1000010123 | 257 |
| 527 | 3300025291 | Ga0209675_1000151 | Ga0209675_100015134 | 257 |
| 528 | 3300025291 | Ga0209675_1000381 | Ga0209675_10003815 | 257 |
| 529 | 3300025292 | Ga0209676_1000028 | Ga0209676_1000028243 | 257 |
| 530 | 3300025294 | Ga0209025_1000289 | Ga0209025_100028992 | 257 |
| 531 | 3300025294 | Ga0209025_1011304 | Ga0209025_10113043 | 257 |
| 532 | 3300025294 | Ga0209025_1054201 | Ga0209025_10542012 | 257 |
| 533 | 3300025295 | Ga0209564_1000724 | Ga0209564_100072413 | 257 |
| 534 | 3300025298 | Ga0209050_1022890 | Ga0209050_10228902 | 257 |
| 535 | 3300025298 | Ga0209050_1024981 | Ga0209050_10249811 | 257 |
| 536 | 3300025298 | Ga0209050_1053999 | Ga0209050_10539991 | 257 |
| 537 | 3300025299 | Ga0209256_1000088 | Ga0209256_1000088152 | 257 |
| 538 | 3300025302 | Ga0207426_1000038 | Ga0207426_1000038346 | 257 |
| 539 | 3300025303 | Ga0209051_1000015 | Ga0209051_1000015172 | 257 |
| 540 | 3300025303 | Ga0209051_1000056 | Ga0209051_1000056228 | 257 |
| 541 | 3300025303 | Ga0209051_1000509 | Ga0209051_10005092 | 257 |
| 542 | 3300025303 | Ga0209051_1031226 | Ga0209051_10312261 | 257 |
| 543 | 3300025304 | Ga0209257_1017914 | Ga0209257_10179142 | 257 |
| 544 | 3300025728 | Ga0207655_1004477 | Ga0207655_10044777 | 257 |
| 545 | 3300025924 | Ga0207694_10154125 | Ga0207694_101541252 | 257 |
| 546 | 3300025932 | Ga0207690_10106426 | Ga0207690_101064262 | 257 |
| 547 | 3300025935 | Ga0207709_10008426 | Ga0207709_100084264 | 257 |
| 548 | 3300025935 | Ga0207709_10159034 | Ga0207709_101590342 | 257 |
| 549 | 3300025945 | Ga0207679_10132187 | Ga0207679_101321872 | 257 |
| 550 | 3300025949 | Ga0207667_10186192 | Ga0207667_101861922 | 257 |
| 551 | 3300026041 | Ga0207639_10016347 | Ga0207639_100163472 | 257 |
| 552 | 3300026116 | Ga0207674_10171110 | Ga0207674_101711102 | 257 |
| 553 | 3300026142 | Ga0207698_10133560 | Ga0207698_101335602 | 257 |
| 554 | 3300027666 | Ga0209282_1006082 | Ga0209282_10060829 | 257 |
| 555 | 3300028379 | Ga0268266_10277308 | Ga0268266_102773082 | 257 |
| 556 | 3300030731 | Ga0316177_1143531 | Ga0316177_11435316 | 257 |
| 557 | 3300030733 | Ga0314311_1250141 | Ga0314311_12501417 | 257 |
| 558 | 3300030734 | Ga0316179_1098234 | Ga0316179_10982341 | 257 |
| 559 | 3300030735 | Ga0316178_1108036 | Ga0316178_11080362 | 257 |
| 560 | 3300030736 | Ga0316180_1017895 | Ga0316180_10178952 | 257 |
| 561 | 3300030742 | Ga0316183_1000995 | Ga0316183_10009951 | 257 |
| 562 | 3300030745 | Ga0316182_1303292 | Ga0316182_13032923 | 257 |
| 563 | 3300031548 | Ga0307408_100058354 | Ga0307408_1000583543 | 257 |
| 564 | 3300031649 | Ga0307514_10029570 | Ga0307514_100295702 | 257 |
| 565 | 3300031731 | Ga0307405_10094181 | Ga0307405_100941812 | 257 |
| 566 | 3300031901 | Ga0307406_10063505 | Ga0307406_100635052 | 257 |
| 567 | 3300031911 | Ga0307412_10379092 | Ga0307412_103790921 | 257 |
| 568 | 3300032004 | Ga0307414_10038184 | Ga0307414_100381842 | 257 |
| 569 | 3300032004 | Ga0307414_10251099 | Ga0307414_102510991 | 257 |
| 570 | 3300032005 | Ga0307411_10348329 | Ga0307411_103483292 | 257 |
| 571 | 3300042007 | Ga0439449_0037578 | Ga0439449_0037578_192_965 | 257 |
| 572 | 3300046460 | Ga0495638_0119328 | Ga0495638_0119328_194_967 | 257 |
| 573 | 3300046507 | Ga0495606_0091840 | Ga0495606_0091840_746_1519 | 257 |
| 574 | 3300046512 | Ga0495610_0017794 | Ga0495610_0017794_2927_3700 | 257 |
| 575 | 3300046513 | Ga0495616_0031740 | Ga0495616_0031740_191_964 | 257 |
| 576 | 3300046518 | Ga0495631_0006138 | Ga0495631_0006138_5106_5879 | 257 |
| 577 | 3300046530 | Ga0495654_0013618 | Ga0495654_0013618_2390_3163 | 257 |
| 578 | 3300046616 | Ga0495668_0177201 | Ga0495668_0177201_35_808 | 257 |
| 579 | 3300046663 | Ga0495635_0089763 | Ga0495635_0089763_305_1081 | 257 |
| 580 | 3300047321 | Ga0495676_0066313 | Ga0495676_0066313_199_975 | 257 |
| 581 | 3300047673 | Ga0495593_0130545 | Ga0495593_0130545_271_1044 | 257 |
| 582 | 3300048088 | Ga0495602_0190336 | Ga0495602_0190336_258_1031 | 257 |
| 583 | 3300048089 | Ga0495614_0049079 | Ga0495614_0049079_879_1655 | 257 |
| 584 | 3300048904 | Ga0496101_0132709 | Ga0496101_0132709_967_1740 | 257 |
| 585 | 3300048906 | Ga0496103_0140032 | Ga0496103_0140032_743_1516 | 257 |
| 586 | 3300048919 | Ga0496116_0028608 | Ga0496116_0028608_174_950 | 257 |
| 587 | 3300048919 | Ga0496116_0067609 | Ga0496116_0067609_895_1668 | 257 |
| 588 | 3300048920 | Ga0496117_0004519 | Ga0496117_0004519_13600_14376 | 257 |
| 589 | 3300048920 | Ga0496117_0089738 | Ga0496117_0089738_1055_1828 | 257 |
| 590 | 3300048921 | Ga0496118_0077444 | Ga0496118_0077444_333_1109 | 257 |
| 591 | 3300048921 | Ga0496118_0112549 | Ga0496118_0112549_64_837 | 257 |
| 592 | 3300048924 | Ga0496121_0041134 | Ga0496121_0041134_1938_2711 | 257 |
| 593 | 3300048924 | Ga0496121_0107715 | Ga0496121_0107715_316_1089 | 257 |
| 594 | 3300048924 | Ga0496121_0248710 | Ga0496121_0248710_402_1178 | 257 |
| 595 | 3300048926 | Ga0496123_0101262 | Ga0496123_0101262_242_1015 | 257 |
| 596 | 3300048926 | Ga0496123_0112237 | Ga0496123_0112237_192_965 | 257 |
| 597 | 3300049127 | Ga0501306_001383 | Ga0501306_001383_1149_1922 | 257 |
| 598 | 3300049130 | Ga0501310_001724 | Ga0501310_001724_464_1237 | 257 |
| 599 | 3300049663 | Ga0501223_030423 | Ga0501223_030423_104_877 | 257 |
| 600 | 3300049679 | Ga0501249_006688 | Ga0501249_006688_1071_1844 | 257 |
| 601 | 3300049705 | Ga0501225_0005272 | Ga0501225_0005272_1228_2001 | 257 |
| 602 | 3300050489 | nmdc:mga03683_58481_c1 | nmdc:mga03683_58481_c1_312_1085 | 257 |
| 603 | 3300050491 | nmdc:mga00v17_143258_c1 | nmdc:mga00v17_143258_c1_111_884 | 257 |
| 604 | 3300050493 | nmdc:mga0k408_91852_c1 | nmdc:mga0k408_91852_c1_568_1341 | 257 |
| 605 | 3300050496 | nmdc:mga07m45_171580_c1 | nmdc:mga07m45_171580_c1_107_880 | 257 |
| 606 | 3300050496 | nmdc:mga07m45_22608_c1 | nmdc:mga07m45_22608_c1_161_934 | 257 |
| 607 | 3300050496 | nmdc:mga07m45_3823_c1 | nmdc:mga07m45_3823_c1_3083_3856 | 257 |
| 608 | 3300050496 | nmdc:mga07m45_49622_c1 | nmdc:mga07m45_49622_c1_661_1434 | 257 |
| 609 | 3300050516 | nmdc:mga0sz30_68296_c1 | nmdc:mga0sz30_68296_c1_219_992 | 257 |
| 610 | 3300053087 | Ga0500643_018296 | Ga0500643_018296_738_1514 | 257 |
| 611 | 3300053093 | Ga0500651_0011180 | Ga0500651_0011180_3148_3921 | 257 |
| 612 | 3300053110 | Ga0500571_047777 | Ga0500571_047777_1140_1916 | 257 |
| 613 | 3300053118 | Ga0500594_0001013 | Ga0500594_0001013_275_1048 | 257 |
| 614 | 3300053120 | Ga0500597_092004 | Ga0500597_092004_119_892 | 257 |
| 615 | 3300053121 | Ga0500607_009334 | Ga0500607_009334_685_1467 | 257 |
| 616 | 3300053122 | Ga0500608_158287 | Ga0500608_158287_168_944 | 257 |
| 617 | 3300053133 | Ga0500655_001016 | Ga0500655_001016_4299_5075 | 257 |
| 618 | 3300053134 | Ga0500658_0018356 | Ga0500658_0018356_255_1028 | 257 |
| 619 | 3300053136 | Ga0500559_0041127 | Ga0500559_0041127_243_1016 | 257 |
| 620 | 3300053138 | Ga0500564_049607 | Ga0500564_049607_277_1053 | 257 |
| 621 | 3300053139 | Ga0500568_0001792 | Ga0500568_0001792_279_1052 | 257 |
| 622 | 3300053141 | Ga0500574_000933 | Ga0500574_000933_1445_2218 | 257 |
| 623 | 3300053153 | Ga0500616_0043090 | Ga0500616_0043090_1143_1916 | 257 |
| 624 | 3300053161 | Ga0500634_0002199 | Ga0500634_0002199_1083_1859 | 257 |
| 625 | 3300053162 | Ga0500638_116713 | Ga0500638_116713_405_1181 | 257 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8snh-assembly1.cif.gz_M | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.8605 | 33 | 253 |
| 8snh-assembly1.cif.gz_M | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.8451 | 33 | 253 |
| 8snh-assembly1.cif.gz_J | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.8091 | 33 | 253 |
| 8snh-assembly1.cif.gz_J | cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa | 0.7709 | 33 | 253 |
| 1bcc-assembly1.cif.gz_D | cytochrome bc1 complex from chicken | 0.6703 | 27 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1m0wB02 | Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain | 0.6652 | 172 | 196 | 3.30.470.20 |
| af_Q9M1G8_208_399_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.6589 | 168 | 199 | 3.40.50.880 |
| af_E7FD67_10_179_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6479 | 172 | 199 | 2.130.10.10 |
| af_A0A0R0ISK6_154_264_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6323 | 169 | 198 | 2.130.10.10 |
| af_Q15334_1_278_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.6309 | 171 | 196 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C9Y883-F1-model_v4 | Cytochrome c1 (EC 1.10.2.2) | 0.8927 | 31 | 257 |
GO:0009055
GO:0016020 GO:0016491 GO:0020037 GO:0046872 |
| AF-C9Y883-F1-model_v4 | Cytochrome c1 (EC 1.10.2.2) | 0.889 | 31 | 257 |
GO:0009055
GO:0016020 GO:0016491 GO:0020037 GO:0046872 |
| AF-A0A432U1E8-F1-model_v4 | Cytochrome c1 | 0.8788 | 28 | 256 |
GO:0009055
GO:0016020 GO:0020037 GO:0046872 |
| AF-A0A7Y4N3I0-F1-model_v4 | deleted | 0.8741 | 69 | 257 |
|
| AF-A0A7Y4N3I0-F1-model_v4 | deleted | 0.8699 | 69 | 257 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar