F470381

General Info

Members Datasets Scaffolds Average Seq Length
625 361 589 253

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0008057|Ga0466969_0008057_330_1124
Length 264
Sequence MQKKETSLMKRFIASVLVAVAALAGAAPAVAQEGGPAWDRFPAERVTDLAALQNGARLFVNYCLNCHQASYMRYNRLHDIGLSDDQIKSNLLFTGEKVGDLMKTPLDPKDAKAFFGTVPPDLSVIARSRSGPNGSGADYLYTYLRSFYRDETRPTGWNNRVFPNVGMPHVLWELQGTQRPVYEDEKGEGGEVEHVFKGFRLETPGTLSAADYNADVADLVAYLQWMSEPAQNFRVKLGVWVLIFLGVFWVICWRLNASYWKDVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2643221609 Acidovorax sp. Root217 Isolate Unclassified
5 2643221611 Acidovorax sp. Root219 Isolate Unclassified
6 2643221658 Variovorax sp. Root411 Isolate Unclassified
7 2643221672 Variovorax sp. Root434 Isolate Unclassified
8 2738541277 Variovorax sp. GV051 Isolate Unclassified
9 2738541307 Variovorax sp. GV008 Isolate Unclassified
10 2738543012 Acidovorax sp. CF301 Isolate Unclassified
11 2738543013 Variovorax sp. BT01 Isolate Unclassified
12 2738543019 Variovorax sp. GV040 Isolate Unclassified
13 2816332133 Acidovorax radicis 2721A Isolate Unclassified
14 2818991446 Variovorax sp. 1180 Isolate Unclassified
15 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
16 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
17 2842677519 Variovorax sp. R-72495 Isolate Unclassified
18 2842733646 Variovorax sp. R-72446 Isolate Unclassified
19 2842747753 Variovorax sp. R-72060 Isolate Unclassified
20 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
21 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
22 2899924645 Variovorax sp. 369 Isolate Unclassified
23 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
24 2904456579 Variovorax sp. 2002 Isolate Unclassified
25 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
26 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
27 2928037797 Variovorax sp. 1126 Isolate Unclassified
28 2928044640 Variovorax sp. 1128 Isolate Unclassified
29 2928051484 Variovorax sp. 1133 Isolate Unclassified
30 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
31 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
32 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
33 2929520902 Variovorax beijingensis 502 Isolate Unclassified
34 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
35 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
36 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
37 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
40 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
41 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
42 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
43 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
44 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
45 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
49 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
50 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
51 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
52 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
53 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
54 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
70 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
71 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
72 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
73 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
74 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
75 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
76 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
77 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
80 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
83 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
84 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
85 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
86 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
87 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
88 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
105 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
109 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
122 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
123 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
148 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
149 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
150 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
153 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
154 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
158 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
163 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
166 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
199 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
205 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
206 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
207 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
208 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
209 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
210 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
211 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
212 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
213 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
214 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
228 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
229 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
233 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
234 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
235 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
236 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
237 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
238 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
239 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
240 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
241 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
242 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
243 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
244 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
245 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
246 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
247 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
248 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
249 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
250 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
251 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
252 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
253 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
254 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
271 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
282 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
283 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
284 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
287 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
293 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
294 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
295 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
296 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
311 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
312 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
318 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
319 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
320 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
321 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
324 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
325 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
326 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
327 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
328 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
329 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
332 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
333 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
336 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
337 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
340 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
341 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
342 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
343 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
344 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
345 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
346 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
347 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
348 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
349 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
350 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
351 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
352 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
353 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
354 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
355 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
356 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
357 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
358 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.76
Metatranscriptomes 0.48
Isolates 5.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 32.48
Nodule 0.64
Rhizoplane 2.88
Rhizosphere 52.64
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_12867 2162886007 Bacteria 1973
2 SwRhRL2b_contig_3103763 2162886007 Bacteria 1880
3 JGI24740J21852_10011180 3300001979 Bacteria 3426
4 JGI25155J39150_1000022 3300002704 Bacteria 142950
5 JGI25156J39149_1000005 3300002705 Bacteria 263980
6 JGI25156J39149_1004039 3300002705 Bacteria 4603
7 JGI25154J39366_1000017 3300002738 Bacteria 252448
8 JGI25154J39366_1001087 3300002738 Bacteria 10661
9 JGI25157J39369_1000003 3300002741 Bacteria 274935
10 JGI25157J39369_1000245 3300002741 Bacteria 41331
11 JGI25152J39213_1013354 3300002773 Bacteria 1715
12 JGI25159J45721_1001343 3300002987 Bacteria 10319
13 JGI25159J45721_1020505 3300002987 Bacteria 1271
14 JGI25151J46595_10000864 3300003187 Bacteria 24005
15 JGI25151J46595_10023979 3300003187 Bacteria 2503
16 JGI25151J46595_10026761 3300003187 Bacteria 2322
17 JGI25151J46595_10037206 3300003187 Bacteria 1827
18 JGI25153J46596_10038610 3300003215 Bacteria 1502
19 rootL2_10001954 3300003322 Bacteria 1426
20 rootL2_10001955 3300003322 Bacteria 1498
21 rootH1_10028675 3300003323 Bacteria 1826
22 rootH1_10059193 3300003323 Bacteria 1509
23 rootH1_10063216 3300003323 Bacteria 1293
24 rootH1_10152291 3300003323 Bacteria 1074
25 JGI25160J50197_1000273 3300003354 Bacteria 38119
26 JGI25161J50226_1000095 3300003374 Bacteria 72343
27 JGI25161J50226_1006851 3300003374 Bacteria 1997
28 Ga0006562J51391_1143153 3300003578 Bacteria 1579
29 Ga0055539_1004233 3300003752 Bacteria 1922
30 Ga0055533_1000045 3300003756 Bacteria 223637
31 Ga0055525_1000681 3300003759 Bacteria 12795
32 Ga0055535_1000047 3300003761 Bacteria 139836
33 Ga0055535_1001458 3300003761 Bacteria 11925
34 Ga0055535_1008828 3300003761 Bacteria 1783
35 Ga0055542_1000080 3300003762 Bacteria 129634
36 Ga0055529_1000148 3300003763 Bacteria 100809
37 Ga0055526_1035680 3300003771 Bacteria 1334
38 Ga0055526_1040515 3300003771 Bacteria 1173
39 Ga0055526_1054393 3300003771 Bacteria 890
40 Ga0055537_1000150 3300003773 Bacteria 52097
41 Ga0055537_1000205 3300003773 Bacteria 44266
42 Ga0055537_1012545 3300003773 Bacteria 1645
43 Ga0055537_1016229 3300003773 Bacteria 1271
44 Ga0055524_1000073 3300003775 Bacteria 123033
45 Ga0055524_1037856 3300003775 Bacteria 1271
46 Ga0055536_1017554 3300003781 Bacteria 2337
47 Ga0055536_1020774 3300003781 Bacteria 2015
48 Ga0055536_1041960 3300003781 Bacteria 1074
49 Ga0055534_1000016 3300003784 Bacteria 144444
50 Ga0055534_1000363 3300003784 Bacteria 28579
51 Ga0055534_1002375 3300003784 Bacteria 6557
52 Ga0055528_1000289 3300003790 Bacteria 42964
53 Ga0055528_1018942 3300003790 Bacteria 2309
54 Ga0055528_1034095 3300003790 Bacteria 1262
55 Ga0055530_10001804 3300003791 Bacteria 14848
56 Ga0055530_10013917 3300003791 Bacteria 2714
57 Ga0055530_10020135 3300003791 Bacteria 2002
58 Ga0055540_1000037 3300003792 Bacteria 162957
59 Ga0055540_1013552 3300003792 Bacteria 2484
60 Ga0055540_1016696 3300003792 Bacteria 2077
61 Ga0055540_1017448 3300003792 Bacteria 2003
62 Ga0055531_10013523 3300003794 Bacteria 3754
63 Ga0055531_10027364 3300003794 Bacteria 2003
64 Ga0055543_1000218 3300004625 Bacteria 46120
65 Ga0055543_1009440 3300004625 Bacteria 2095
66 Ga0065165_1020502 3300005262 Bacteria 2323
67 Ga0065165_1028953 3300005262 Bacteria 1780
68 Ga0065704_10003100 3300005289 Bacteria 4362
69 Ga0070658_10122976 3300005327 Bacteria 2157
70 Ga0070658_10185759 3300005327 Bacteria 1750
71 Ga0070658_10233536 3300005327 Bacteria 1558
72 Ga0070690_100050185 3300005330 Bacteria 2661
73 Ga0068869_100392877 3300005334 Bacteria 1139
74 Ga0070680_100199107 3300005336 Bacteria 1689
75 Ga0068868_100408899 3300005338 Bacteria 1172
76 Ga0070660_100284005 3300005339 Bacteria 1354
77 Ga0070660_100672394 3300005339 Bacteria 867
78 Ga0070668_100315975 3300005347 Bacteria 1314
79 Ga0070669_100074138 3300005353 Bacteria 2522
80 Ga0070674_100387459 3300005356 Bacteria 1138
81 Ga0070659_100120453 3300005366 Bacteria 2125
82 Ga0070667_100024333 3300005367 Bacteria 5029
83 Ga0070714_100083618 3300005435 Bacteria 2784
84 Ga0070663_100367993 3300005455 Bacteria 1167
85 Ga0070678_100144392 3300005456 Bacteria 1908
86 Ga0070678_100161283 3300005456 Bacteria 1817
87 Ga0070678_100391141 3300005456 Bacteria 1205
88 Ga0070662_100120239 3300005457 Bacteria 2012
89 Ga0068867_100330050 3300005459 Bacteria 1266
90 Ga0070685_10060194 3300005466 Bacteria 2219
91 Ga0070679_100018152 3300005530 Bacteria 6822
92 Ga0070684_100240023 3300005535 Bacteria 1656
93 Ga0068853_100093937 3300005539 Bacteria 2641
94 Ga0068853_100460639 3300005539 Bacteria 1197
95 Ga0070672_100229911 3300005543 Bacteria 1558
96 Ga0070665_100198795 3300005548 Bacteria 2005
97 Ga0070665_100208694 3300005548 Bacteria 1954
98 Ga0070665_100755340 3300005548 Bacteria 985
99 Ga0068855_100058788 3300005563 Bacteria 4500
100 Ga0068855_100314650 3300005563 Bacteria 1731
101 Ga0068855_100663926 3300005563 Bacteria 1119
102 Ga0068857_100113459 3300005577 Bacteria 2437
103 Ga0068854_100006652 3300005578 Bacteria 7365
104 Ga0068856_100001716 3300005614 Bacteria 22915
105 Ga0068856_100103103 3300005614 Bacteria 2847
106 Ga0068852_100074653 3300005616 Bacteria 2987
107 Ga0068861_100127322 3300005719 Bacteria 2062
108 Ga0070717_10155290 3300006028 Bacteria 1982
109 Ga0075365_10085442 3300006038 Bacteria 2143
110 Ga0075365_10335112 3300006038 Bacteria 1066
111 Ga0075365_10351819 3300006038 Bacteria 1038
112 Ga0075368_10021135 3300006042 Bacteria 2470
113 Ga0075363_100046512 3300006048 Bacteria 2302
114 Ga0075363_100102574 3300006048 Bacteria 1584
115 Ga0075363_100184856 3300006048 Bacteria 1187
116 Ga0075364_10088058 3300006051 Bacteria 2058
117 Ga0075432_10002101 3300006058 Bacteria 6636
118 Ga0075362_10018885 3300006177 Bacteria 2860
119 Ga0075362_10030388 3300006177 Bacteria 2333
120 Ga0075362_10059452 3300006177 Bacteria 1726
121 Ga0075362_10166112 3300006177 Bacteria 1064
122 Ga0075367_10173370 3300006178 Bacteria 1344
123 Ga0075366_10005340 3300006195 Bacteria 6964
124 Ga0075366_10027848 3300006195 Bacteria 3316
125 Ga0075366_10040299 3300006195 Bacteria 2762
126 Ga0075366_10060547 3300006195 Bacteria 2249
127 Ga0075366_10068694 3300006195 Bacteria 2108
128 Ga0075366_10074728 3300006195 Bacteria 2021
129 Ga0075366_10076797 3300006195 Bacteria 1993
130 Ga0075366_10105788 3300006195 Bacteria 1691
131 Ga0075366_10172023 3300006195 Bacteria 1314
132 Ga0075366_10335153 3300006195 Bacteria 927
133 Ga0097621_100587714 3300006237 Bacteria 1017
134 Ga0075370_10002013 3300006353 Bacteria 9212
135 Ga0075370_10003632 3300006353 Bacteria 7383
136 Ga0075370_10050148 3300006353 Bacteria 2367
137 Ga0075370_10063133 3300006353 Bacteria 2111
138 Ga0075370_10102025 3300006353 Bacteria 1661
139 Ga0075370_10225733 3300006353 Bacteria 1107
140 Ga0075370_10261441 3300006353 Bacteria 1026
141 Ga0068871_100102473 3300006358 Bacteria 2399
142 Ga0075430_100169916 3300006846 Bacteria 1814
143 Ga0079104_1040443 3300006946 Bacteria 1092
144 Ga0099826_10079164 3300006948 Bacteria 2055
145 Ga0105244_10003719 3300009036 Bacteria 10768
146 Ga0105240_10008945 3300009093 Bacteria 14239
147 Ga0105240_10271816 3300009093 Bacteria 1951
148 Ga0105240_10283589 3300009093 Bacteria 1902
149 Ga0105240_10719343 3300009093 Bacteria 1088
150 Ga0105245_10188958 3300009098 Bacteria 1972
151 Ga0105243_10047127 3300009148 Bacteria 3392
152 Ga0105243_10162587 3300009148 Bacteria 1926
153 Ga0105243_10460871 3300009148 Bacteria 1195
154 Ga0105241_10220982 3300009174 Bacteria 1592
155 Ga0105242_10004226 3300009176 Bacteria 11196
156 Ga0105242_10343592 3300009176 Bacteria 1376
157 Ga0105242_10631114 3300009176 Bacteria 1039
158 Ga0105237_10027197 3300009545 Bacteria 5841
159 Ga0105237_10306461 3300009545 Bacteria 1591
160 Ga0105238_10025724 3300009551 Bacteria 6002
161 Ga0105238_10163019 3300009551 Bacteria 2205
162 Ga0105238_10167037 3300009551 Bacteria 2176
163 Ga0105239_10160843 3300010375 Bacteria 2508
164 Ga0105239_10919566 3300010375 Bacteria 1004
165 Ga0105246_10048846 3300011119 Bacteria 2894
166 Ga0105246_10310789 3300011119 Bacteria 1277
167 Ga0157371_10198264 3300013102 Bacteria 1439
168 Ga0157369_10022693 3300013105 Bacteria 6999
169 Ga0157369_10024224 3300013105 Bacteria 6755
170 Ga0157374_10919092 3300013296 Bacteria 893
171 Ga0157378_10292403 3300013297 Bacteria 1574
172 Ga0163162_10083970 3300013306 Bacteria 3259
173 Ga0163162_10458657 3300013306 Bacteria 1406
174 Ga0157372_10197385 3300013307 Bacteria 2331
175 Ga0157372_10268779 3300013307 Bacteria 1981
176 Ga0157375_10246811 3300013308 Bacteria 1946
177 Ga0157375_10966913 3300013308 Bacteria 993
178 Ga0157380_10330018 3300014326 Bacteria 1418
179 Ga0182008_10058182 3300014497 Bacteria 1909
180 Ga0182008_10060953 3300014497 Bacteria 1860
181 Ga0182008_10061799 3300014497 Bacteria 1846
182 Ga0182008_10076765 3300014497 Bacteria 1643
183 Ga0182008_10161869 3300014497 Bacteria 1126
184 Ga0157379_10206476 3300014968 Bacteria 1777
185 Ga0157376_10188012 3300014969 Bacteria 1892
186 Ga0157376_10441386 3300014969 Bacteria 1267
187 Ga0182006_1027212 3300015261 Bacteria 2335
188 Ga0182006_1039095 3300015261 Bacteria 1874
189 Ga0182006_1107396 3300015261 Bacteria 983
190 Ga0182007_10002638 3300015262 Bacteria 8809
191 Ga0182007_10028387 3300015262 Bacteria 1923
192 Ga0182007_10062422 3300015262 Bacteria 1221
193 Ga0183362_10003 3300015683 Bacteria 977584
194 Ga0163161_10145246 3300017792 Bacteria 1799
195 Ga0163161_10153856 3300017792 Bacteria 1749
196 Ga0163161_10217858 3300017792 Bacteria 1477
197 Ga0163161_10316030 3300017792 Bacteria 1233
198 Ga0213872_10038199 3300021361 Bacteria 2192
199 Ga0209435_100002 3300025206 Bacteria 794178
200 Ga0209436_109303 3300025208 Bacteria 1883
201 Ga0209674_100073 3300025226 Bacteria 223689
202 Ga0209672_102374 3300025228 Bacteria 4710
203 Ga0209147_101277 3300025229 Bacteria 9822
204 Ga0209563_100061 3300025230 Bacteria 274295
205 Ga0207427_101392 3300025231 Bacteria 8858
206 Ga0209258_100009 3300025242 Bacteria 996276
207 Ga0209258_100072 3300025242 Bacteria 274355
208 Ga0209258_104057 3300025242 Bacteria 2902
209 Ga0207425_1002688 3300025245 Bacteria 6089
210 Ga0207425_1003670 3300025245 Bacteria 4832
211 Ga0207425_1008972 3300025245 Bacteria 2519
212 Ga0209646_1000001 3300025246 Bacteria 3092932
213 Ga0209646_1000076 3300025246 Bacteria 212891
214 Ga0209026_1000001 3300025250 Bacteria 1228671
215 Ga0209026_1000011 3300025250 Bacteria 507291
216 Ga0209677_100070 3300025253 Bacteria 143311
217 Ga0209677_102967 3300025253 Bacteria 5903
218 Ga0209148_1000007 3300025254 Bacteria 1592273
219 Ga0209148_1003914 3300025254 Bacteria 3856
220 Ga0209759_1000001 3300025256 Bacteria 2799452
221 Ga0209759_1000034 3300025256 Bacteria 271209
222 Ga0209759_1010366 3300025256 Bacteria 2736
223 Ga0209759_1019829 3300025256 Bacteria 1582
224 Ga0209129_1000404 3300025258 Bacteria 34228
225 Ga0209129_1012367 3300025258 Bacteria 1964
226 Ga0209129_1029630 3300025258 Bacteria 921
227 Ga0209565_1000098 3300025263 Bacteria 132021
228 Ga0209565_1000128 3300025263 Bacteria 108959
229 Ga0209565_1000574 3300025263 Bacteria 24961
230 Ga0209565_1001099 3300025263 Bacteria 13330
231 Ga0209565_1002417 3300025263 Bacteria 6760
232 Ga0209455_1000053 3300025272 Bacteria 365949
233 Ga0209673_1000008 3300025273 Bacteria 626013
234 Ga0209673_1000058 3300025273 Bacteria 269028
235 Ga0209673_1000410 3300025273 Bacteria 75829
236 Ga0209673_1000705 3300025273 Bacteria 47171
237 Ga0209130_1000072 3300025284 Bacteria 175726
238 Ga0209130_1000295 3300025284 Bacteria 60748
239 Ga0209130_1001611 3300025284 Bacteria 14009
240 Ga0209675_1000010 3300025291 Bacteria 541927
241 Ga0209675_1000099 3300025291 Bacteria 128911
242 Ga0209675_1000151 3300025291 Bacteria 91172
243 Ga0209675_1000381 3300025291 Bacteria 36963
244 Ga0209675_1009484 3300025291 Bacteria 3434
245 Ga0209676_1000023 3300025292 Bacteria 589732
246 Ga0209676_1000028 3300025292 Bacteria 559745
247 Ga0209676_1003664 3300025292 Bacteria 9208
248 Ga0209025_1000289 3300025294 Bacteria 113555
249 Ga0209025_1006053 3300025294 Bacteria 9568
250 Ga0209025_1011304 3300025294 Bacteria 5901
251 Ga0209025_1014674 3300025294 Bacteria 4795
252 Ga0209025_1017536 3300025294 Bacteria 4123
253 Ga0209025_1033673 3300025294 Bacteria 2361
254 Ga0209025_1042659 3300025294 Bacteria 1924
255 Ga0209025_1054201 3300025294 Bacteria 1564
256 Ga0209564_1000724 3300025295 Bacteria 47354
257 Ga0209564_1007849 3300025295 Bacteria 5410
258 Ga0209564_1049592 3300025295 Bacteria 1037
259 Ga0209758_1028519 3300025297 Bacteria 2357
260 Ga0209050_1000022 3300025298 Bacteria 565239
261 Ga0209050_1011134 3300025298 Bacteria 4312
262 Ga0209050_1022890 3300025298 Bacteria 2221
263 Ga0209050_1024981 3300025298 Bacteria 2047
264 Ga0209050_1053999 3300025298 Bacteria 994
265 Ga0209256_1000001 3300025299 Bacteria 2166974
266 Ga0209256_1000088 3300025299 Bacteria 217236
267 Ga0207426_1000038 3300025302 Bacteria 441522
268 Ga0207426_1000319 3300025302 Bacteria 92696
269 Ga0207426_1013921 3300025302 Bacteria 2965
270 Ga0209051_1000013 3300025303 Bacteria 565239
271 Ga0209051_1000015 3300025303 Bacteria 546798
272 Ga0209051_1000056 3300025303 Bacteria 271616
273 Ga0209051_1000509 3300025303 Bacteria 49288
274 Ga0209051_1000904 3300025303 Bacteria 29543
275 Ga0209051_1031226 3300025303 Bacteria 2053
276 Ga0209257_1000042 3300025304 Bacteria 537149
277 Ga0209257_1017914 3300025304 Bacteria 2758
278 Ga0207655_1004477 3300025728 Bacteria 9895
279 Ga0207645_10246467 3300025907 Bacteria 1181
280 Ga0207705_10254625 3300025909 Bacteria 1339
281 Ga0207654_10057855 3300025911 Bacteria 2255
282 Ga0207654_10166896 3300025911 Bacteria 1426
283 Ga0207695_10005493 3300025913 Bacteria 16778
284 Ga0207695_10123790 3300025913 Bacteria 2551
285 Ga0207671_10119636 3300025914 Bacteria 2012
286 Ga0207660_10228767 3300025917 Bacteria 1462
287 Ga0207657_10062642 3300025919 Bacteria 3183
288 Ga0207681_10055268 3300025923 Bacteria 2703
289 Ga0207694_10130298 3300025924 Bacteria 2015
290 Ga0207694_10154125 3300025924 Bacteria 1852
291 Ga0207694_10304733 3300025924 Bacteria 1312
292 Ga0207690_10106426 3300025932 Bacteria 2013
293 Ga0207706_10451288 3300025933 Bacteria 1112
294 Ga0207686_10000954 3300025934 Bacteria 17260
295 Ga0207709_10008426 3300025935 Bacteria 5703
296 Ga0207709_10159034 3300025935 Bacteria 1573
297 Ga0207669_10020071 3300025937 Bacteria 3495
298 Ga0207691_10387692 3300025940 Bacteria 1192
299 Ga0207689_10074760 3300025942 Bacteria 2784
300 Ga0207689_10263201 3300025942 Bacteria 1427
301 Ga0207661_10472575 3300025944 Bacteria 1144
302 Ga0207679_10132187 3300025945 Bacteria 2004
303 Ga0207667_10186192 3300025949 Bacteria 2131
304 Ga0207667_10228580 3300025949 Bacteria 1905
305 Ga0207668_10393799 3300025972 Bacteria 1169
306 Ga0207658_10039090 3300025986 Bacteria 3422
307 Ga0207677_10238017 3300026023 Bacteria 1471
308 Ga0207677_10239766 3300026023 Bacteria 1466
309 Ga0207677_10362980 3300026023 Bacteria 1217
310 Ga0207639_10016347 3300026041 Bacteria 5248
311 Ga0207702_10001565 3300026078 Bacteria 22647
312 Ga0207641_10064069 3300026088 Bacteria 3141
313 Ga0207648_10173845 3300026089 Bacteria 1904
314 Ga0207648_10463245 3300026089 Bacteria 1156
315 Ga0207674_10005653 3300026116 Bacteria 14825
316 Ga0207674_10147041 3300026116 Bacteria 2315
317 Ga0207674_10171110 3300026116 Bacteria 2126
318 Ga0207683_10068293 3300026121 Bacteria 3137
319 Ga0207683_10278496 3300026121 Bacteria 1528
320 Ga0207698_10133560 3300026142 Bacteria 2125
321 Ga0209282_1006082 3300027666 Bacteria 7471
322 Ga0209813_10035939 3300027866 Bacteria 1485
323 Ga0207428_10150538 3300027907 Bacteria 1771
324 Ga0268266_10056764 3300028379 Bacteria 3368
325 Ga0268266_10076416 3300028379 Bacteria 2911
326 Ga0268266_10109427 3300028379 Bacteria 2447
327 Ga0268266_10277308 3300028379 Bacteria 1558
328 Ga0265336_10000036 3300028666 Bacteria 154609
329 Ga0307515_10000084 3300028794 Bacteria 221434
330 Ga0307515_10004716 3300028794 Bacteria 27939
331 Ga0307515_10134564 3300028794 Bacteria 2697
332 Ga0307515_10342685 3300028794 Bacteria 1146
333 Ga0265324_10000136 3300029957 Bacteria 57490
334 Ga0307512_10175081 3300030522 Bacteria 1220
335 Ga0316177_1143531 3300030731 Bacteria 6959
336 Ga0314311_1250141 3300030733 Bacteria 5028
337 Ga0316179_1098234 3300030734 Bacteria 1187
338 Ga0316178_1108036 3300030735 Bacteria 3060
339 Ga0316180_1017895 3300030736 Bacteria 4023
340 Ga0316183_1000995 3300030742 Bacteria 989
341 Ga0316182_1303292 3300030745 Bacteria 2312
342 Ga0265328_10055880 3300031239 Bacteria 1449
343 Ga0265325_10017191 3300031241 Bacteria 4022
344 Ga0265327_10008835 3300031251 Bacteria 7417
345 Ga0265327_10169866 3300031251 Bacteria 1003
346 Ga0307513_10000008 3300031456 Bacteria 442128
347 Ga0307513_10000038 3300031456 Bacteria 174780
348 Ga0307408_100017442 3300031548 Bacteria 4804
349 Ga0307408_100035804 3300031548 Bacteria 3485
350 Ga0307408_100058354 3300031548 Bacteria 2805
351 Ga0307514_10000319 3300031649 Bacteria 115327
352 Ga0307514_10029570 3300031649 Bacteria 4404
353 Ga0307516_10004973 3300031730 Bacteria 16142
354 Ga0307516_10029845 3300031730 Bacteria 5509
355 Ga0307405_10066088 3300031731 Bacteria 2304
356 Ga0307405_10085066 3300031731 Bacteria 2078
357 Ga0307405_10094181 3300031731 Bacteria 1991
358 Ga0307406_10015826 3300031901 Bacteria 4372
359 Ga0307406_10063505 3300031901 Bacteria 2392
360 Ga0307412_10379092 3300031911 Bacteria 1144
361 Ga0307412_10461958 3300031911 Bacteria 1048
362 Ga0307416_100275069 3300032002 Bacteria 1656
363 Ga0307416_100791813 3300032002 Bacteria 1043
364 Ga0307414_10038184 3300032004 Bacteria 3222
365 Ga0307414_10251099 3300032004 Bacteria 1470
366 Ga0307411_10348329 3300032005 Bacteria 1206
367 Ga0373931_0039317 3300035691 Bacteria 2478
368 Ga0373931_0136387 3300035691 Bacteria 1417
369 Ga0395899_0008661 3300037312 Bacteria 7828
370 Ga0395899_0086072 3300037312 Bacteria 2283
371 Ga0395900_0015874 3300037418 Bacteria 7671
372 Ga0395900_0026531 3300037418 Bacteria 5931
373 Ga0395900_0188545 3300037418 Bacteria 2093
374 Ga0395898_0004158 3300037466 Bacteria 15877
375 Ga0395898_0044157 3300037466 Bacteria 4390
376 Ga0395905_0000728 3300037471 Bacteria 43400
377 Ga0395905_0025949 3300037471 Bacteria 5524
378 Ga0395905_0029854 3300037471 Bacteria 5138
379 Ga0395905_0044151 3300037471 Bacteria 4182
380 Ga0395901_0003179 3300038443 Bacteria 16526
381 Ga0395901_0023253 3300038443 Bacteria 6353
382 Ga0395901_0090939 3300038443 Bacteria 3194
383 Ga0395901_0241545 3300038443 Bacteria 1884
384 Ga0395901_0453258 3300038443 Bacteria 1312
385 Ga0436361_0567754 3300039447 Bacteria 3243
386 Ga0436361_0711422 3300039447 Bacteria 4175
387 Ga0439436_0000668 3300041404 Bacteria 9183
388 Ga0439436_0034512 3300041404 Bacteria 1462
389 Ga0439439_0019710 3300041406 Bacteria 1675
390 Ga0439447_039433 3300041407 Bacteria 1156
391 Ga0439461_0017351 3300041410 Bacteria 1398
392 Ga0439466_0008629 3300041411 Bacteria 3841
393 Ga0439466_0016919 3300041411 Bacteria 2631
394 Ga0439465_0004974 3300041413 Bacteria 4269
395 Ga0451791_1208931 3300041451 Bacteria 996
396 Ga0451800_1061636 3300041459 Bacteria 921
397 Ga0451800_1566960 3300041459 Bacteria 1208
398 Ga0451807_0755093 3300041486 Bacteria 1216
399 Ga0439431_0013193 3300041997 Bacteria 1904
400 Ga0439431_0040539 3300041997 Bacteria 1184
401 Ga0439433_0009473 3300041999 Bacteria 2122
402 Ga0439442_033853 3300042002 Bacteria 1068
403 Ga0439445_0000200 3300042004 Bacteria 10930
404 Ga0439445_0023535 3300042004 Bacteria 1560
405 Ga0439432_012869 3300042006 Bacteria 2851
406 Ga0439432_043463 3300042006 Bacteria 1417
407 Ga0439449_0001627 3300042007 Bacteria 8807
408 Ga0439449_0037578 3300042007 Bacteria 1801
409 Ga0439449_0043017 3300042007 Bacteria 1677
410 Ga0439452_013026 3300042010 Bacteria 2345
411 Ga0439452_019885 3300042010 Bacteria 1768
412 Ga0439457_007541 3300042014 Bacteria 2607
413 Ga0439462_0018109 3300042015 Bacteria 1828
414 Ga0450911_000822 3300042115 Bacteria 8529
415 Ga0450911_019713 3300042115 Bacteria 883
416 Ga0450898_005473 3300042134 Bacteria 1919
417 Ga0439446_0024648 3300042156 Bacteria 1717
418 Ga0439446_0065110 3300042156 Bacteria 1107
419 Ga0439434_0005498 3300042435 Bacteria 3702
420 Ga0451577_0121556 3300042876 Bacteria 2339
421 Ga0451577_0274649 3300042876 Bacteria 1526
422 Ga0451577_0347000 3300042876 Bacteria 1346
423 Ga0451577_1072873 3300042876 Bacteria 721
424 Ga0466969_0008057 3300044656 Bacteria 5596
425 Ga0466969_0020418 3300044656 Bacteria 3431
426 Ga0453683_0002261 3300044673 Bacteria 15209
427 Ga0453683_0116928 3300044673 Bacteria 1678
428 Ga0466965_0011708 3300044683 Bacteria 4115
429 Ga0466965_0085773 3300044683 Bacteria 1596
430 Ga0466966_0018169 3300044684 Bacteria 4639
431 Ga0466966_0026697 3300044684 Bacteria 3769
432 Ga0466961_0002913 3300044693 Bacteria 10623
433 Ga0466961_0045949 3300044693 Bacteria 2793
434 Ga0466963_0004061 3300044694 Bacteria 8468
435 Ga0466963_0092730 3300044694 Bacteria 2058
436 Ga0466964_0004782 3300044706 Bacteria 5008
437 Ga0466964_0033527 3300044706 Bacteria 2046
438 Ga0453684_0000005 3300044712 Bacteria 1431632
439 Ga0453684_0000163 3300044712 Bacteria 296196
440 Ga0453684_0000341 3300044712 Bacteria 194228
441 Ga0453684_0000511 3300044712 Bacteria 150804
442 Ga0453684_0076534 3300044712 Bacteria 4200
443 Ga0453684_0324572 3300044712 Bacteria 1742
444 Ga0466971_0009165 3300044719 Bacteria 4327
445 Ga0466971_0019879 3300044719 Bacteria 2983
446 Ga0466957_0038059 3300044842 Bacteria 2897
447 Ga0466959_0000027 3300045049 Bacteria 114262
448 Ga0466959_0032585 3300045049 Bacteria 3857
449 Ga0466959_0115012 3300045049 Bacteria 1917
450 Ga0451576_0000266 3300045051 Bacteria 127813
451 Ga0451576_0040360 3300045051 Bacteria 4941
452 Ga0451576_0100037 3300045051 Bacteria 3016
453 Ga0451576_0161122 3300045051 Bacteria 2341
454 Ga0451576_0311637 3300045051 Bacteria 1646
455 Ga0451576_0524088 3300045051 Bacteria 1245
456 Ga0451576_0746238 3300045051 Bacteria 1028
457 Ga0466958_0009465 3300045836 Bacteria 5430
458 Ga0466967_0013629 3300045976 Bacteria 6292
459 Ga0466967_0120891 3300045976 Bacteria 2419
460 Ga0495627_024060 3300046453 Bacteria 1989
461 Ga0495629_0201584 3300046459 Bacteria 1376
462 Ga0495638_0119328 3300046460 Bacteria 1560
463 Ga0495650_0057591 3300046471 Bacteria 1572
464 Ga0495639_0002158 3300046475 Bacteria 8677
465 Ga0495639_0039662 3300046475 Bacteria 2117
466 Ga0495585_0008753 3300046492 Bacteria 6118
467 Ga0495585_0138317 3300046492 Bacteria 1277
468 Ga0495583_0000418 3300046506 Bacteria 64708
469 Ga0495606_0009174 3300046507 Bacteria 8412
470 Ga0495606_0091840 3300046507 Bacteria 1866
471 Ga0495610_0017794 3300046512 Bacteria 4041
472 Ga0495616_0031740 3300046513 Bacteria 2764
473 Ga0495620_0008764 3300046515 Bacteria 5413
474 Ga0495630_0415275 3300046517 Bacteria 1031
475 Ga0495631_0006138 3300046518 Bacteria 6228
476 Ga0495637_0072024 3300046520 Bacteria 1392
477 Ga0495654_0003583 3300046530 Bacteria 9454
478 Ga0495654_0013618 3300046530 Bacteria 4349
479 Ga0495654_0066438 3300046530 Bacteria 1719
480 Ga0495621_0051475 3300046539 Bacteria 1474
481 Ga0495656_0000757 3300046615 Bacteria 10411
482 Ga0495668_0177201 3300046616 Bacteria 1168
483 Ga0495625_0010094 3300046660 Bacteria 7844
484 Ga0495635_0089763 3300046663 Bacteria 2103
485 Ga0495635_0243226 3300046663 Bacteria 1214
486 Ga0495659_0081908 3300046664 Bacteria 1226
487 Ga0495588_0134207 3300046674 Bacteria 1306
488 Ga0495623_0206178 3300046679 Bacteria 1128
489 Ga0495669_0024291 3300046684 Bacteria 2640
490 Ga0495670_0093600 3300046691 Bacteria 1540
491 Ga0495671_0052500 3300046692 Bacteria 2026
492 Ga0495589_0021916 3300046794 Bacteria 3264
493 Ga0495581_0163543 3300047315 Bacteria 1301
494 Ga0495676_0066313 3300047321 Bacteria 2798
495 Ga0495677_0111153 3300047445 Bacteria 1042
496 Ga0495686_0010557 3300047472 Bacteria 6561
497 Ga0495593_0130545 3300047673 Bacteria 1275
498 Ga0495602_0190336 3300048088 Bacteria 1574
499 Ga0495614_0049079 3300048089 Bacteria 1809
500 Ga0495615_0014509 3300048090 Bacteria 1667
501 Ga0496100_0102783 3300048903 Bacteria 1972
502 Ga0496100_0263640 3300048903 Bacteria 1279
503 Ga0496101_0090785 3300048904 Bacteria 2272
504 Ga0496101_0132709 3300048904 Bacteria 1892
505 Ga0496102_0199998 3300048905 Bacteria 1883
506 Ga0496103_0132834 3300048906 Bacteria 1590
507 Ga0496103_0140032 3300048906 Bacteria 1547
508 Ga0496104_0251383 3300048907 Bacteria 1680
509 Ga0496104_0298285 3300048907 Bacteria 1524
510 Ga0496105_0011369 3300048908 Bacteria 7031
511 Ga0496105_0336379 3300048908 Bacteria 1208
512 Ga0496106_0270485 3300048909 Bacteria 1360
513 Ga0496107_0134858 3300048910 Bacteria 1824
514 Ga0496109_0251001 3300048912 Bacteria 1666
515 Ga0496116_0028608 3300048919 Bacteria 4033
516 Ga0496116_0067609 3300048919 Bacteria 2281
517 Ga0496117_0004519 3300048920 Bacteria 15279
518 Ga0496117_0089738 3300048920 Bacteria 1983
519 Ga0496118_0077444 3300048921 Bacteria 2358
520 Ga0496118_0112549 3300048921 Bacteria 1801
521 Ga0496121_0041134 3300048924 Bacteria 4044
522 Ga0496121_0107715 3300048924 Bacteria 2133
523 Ga0496121_0248710 3300048924 Bacteria 1234
524 Ga0496121_0285992 3300048924 Bacteria 1125
525 Ga0496122_0000612 3300048925 Bacteria 73307
526 Ga0496123_0000274 3300048926 Bacteria 101783
527 Ga0496123_0101262 3300048926 Bacteria 1675
528 Ga0496123_0112237 3300048926 Bacteria 1555
529 Ga0496125_0119390 3300048928 Bacteria 1885
530 Ga0501306_001383 3300049127 Bacteria 2269
531 Ga0501310_001724 3300049130 Bacteria 2013
532 Ga0501223_030423 3300049663 Bacteria 1050
533 Ga0501249_006688 3300049679 Bacteria 2375
534 Ga0501225_0005272 3300049705 Bacteria 3803
535 Ga0501266_000597 3300049763 Bacteria 4731
536 nmdc:mga03683_129285_c1 3300050489 Bacteria 1129
537 nmdc:mga03683_58481_c1 3300050489 Bacteria 1625
538 nmdc:mga03n38_174022_c1 3300050490 Bacteria 1098
539 nmdc:mga03n38_84859_c1 3300050490 Bacteria 1496
540 nmdc:mga00v17_143258_c1 3300050491 Bacteria 1533
541 nmdc:mga0yw44_55092_c1 3300050492 Bacteria 2419
542 nmdc:mga0k408_12109_c1 3300050493 Bacteria 4710
543 nmdc:mga0k408_13299_c1 3300050493 Bacteria 4510
544 nmdc:mga0k408_62654_c1 3300050493 Bacteria 2163
545 nmdc:mga0k408_738_c2 3300050493 Bacteria 8845
546 nmdc:mga0k408_91852_c1 3300050493 Bacteria 1784
547 nmdc:mga06z11_33845_c1 3300050494 Bacteria 2503
548 nmdc:mga07m45_118507_c1 3300050496 Bacteria 1528
549 nmdc:mga07m45_171580_c1 3300050496 Bacteria 1261
550 nmdc:mga07m45_22608_c1 3300050496 Bacteria 3434
551 nmdc:mga07m45_3314_c1 3300050496 Bacteria 7759
552 nmdc:mga07m45_3823_c1 3300050496 Bacteria 7291
553 nmdc:mga07m45_49622_c1 3300050496 Bacteria 2363
554 nmdc:mga07m45_522_c2 3300050496 Bacteria 2792
555 nmdc:mga07m45_58596_c1 3300050496 Bacteria 2179
556 nmdc:mga0sz30_68296_c1 3300050516 Bacteria 1056
557 Ga0500610_0030293 3300053079 Bacteria 2741
558 Ga0500635_0000030 3300053080 Bacteria 99936
559 Ga0500643_018296 3300053087 Bacteria 2328
560 Ga0500651_0011180 3300053093 Bacteria 5404
561 Ga0500569_068011 3300053109 Bacteria 1115
562 Ga0500571_047777 3300053110 Bacteria 2263
563 Ga0500593_000312 3300053117 Bacteria 19544
564 Ga0500593_060071 3300053117 Bacteria 1671
565 Ga0500594_0001013 3300053118 Bacteria 6025
566 Ga0500597_092004 3300053120 Bacteria 1318
567 Ga0500607_009334 3300053121 Bacteria 5907
568 Ga0500608_158287 3300053122 Bacteria 984
569 Ga0500655_001016 3300053133 Bacteria 5412
570 Ga0500658_0018356 3300053134 Bacteria 2621
571 Ga0500559_0041127 3300053136 Bacteria 2014
572 Ga0500559_0044984 3300053136 Bacteria 1931
573 Ga0500559_0086920 3300053136 Bacteria 1427
574 Ga0500564_049607 3300053138 Bacteria 1922
575 Ga0500564_150179 3300053138 Bacteria 994
576 Ga0500568_0001792 3300053139 Bacteria 13230
577 Ga0500574_000933 3300053141 Bacteria 4057
578 Ga0500616_0043090 3300053153 Bacteria 2413
579 Ga0500622_0146385 3300053156 Bacteria 1121
580 Ga0500627_0001520 3300053158 Bacteria 6532
581 Ga0500633_0086075 3300053160 Bacteria 1143
582 Ga0500634_0002199 3300053161 Bacteria 8113
583 Ga0500634_0077988 3300053161 Bacteria 1715
584 Ga0500638_116713 3300053162 Bacteria 1226
585 Ga0500636_0129632 3300053177 Bacteria 1406
586 Ga0500645_001028 3300053730 Bacteria 15622
587 Ga0500661_004013 3300055283 Bacteria 2755
588 Ga0466962_0025893 3300061719 Bacteria 2815
589 Ga0466962_0028646 3300061719 Bacteria 2667

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_1072873 Ga0451577_1072873_43_654 202
2 3300002987 JGI25159J45721_1020505 JGI25159J45721_10205052 215
3 3300047445 Ga0495677_0111153 Ga0495677_0111153_382_1029 215
4 3300048924 Ga0496121_0285992 Ga0496121_0285992_19_666 215
5 3300042876 Ga0451577_0274649 Ga0451577_0274649_207_914 220
6 3300044712 Ga0453684_0000163 Ga0453684_0000163_270235_270942 220
7 3300045051 Ga0451576_0040360 Ga0451576_0040360_567_1274 220
8 3300045051 Ga0451576_0161122 Ga0451576_0161122_1527_2237 220
9 3300044673 Ga0453683_0116928 Ga0453683_0116928_809_1516 232
10 3300045051 Ga0451576_0100037 Ga0451576_0100037_1049_1756 232
11 3300006195 Ga0075366_10027848 Ga0075366_100278484 233
12 3300009176 Ga0105242_10343592 Ga0105242_103435922 233
13 3300011119 Ga0105246_10048846 Ga0105246_100488462 233
14 3300031241 Ga0265325_10017191 Ga0265325_100171912 233
15 3300035691 Ga0373931_0136387 Ga0373931_0136387_17_778 233
16 3300042876 Ga0451577_0121556 Ga0451577_0121556_475_1185 233
17 3300042876 Ga0451577_0347000 Ga0451577_0347000_503_1213 233
18 3300044712 Ga0453684_0000005 Ga0453684_0000005_880577_881287 233
19 3300044712 Ga0453684_0000341 Ga0453684_0000341_83886_84596 233
20 3300044712 Ga0453684_0000511 Ga0453684_0000511_139_849 233
21 3300044712 Ga0453684_0076534 Ga0453684_0076534_1160_1870 233
22 3300045051 Ga0451576_0000266 Ga0451576_0000266_46070_46780 233
23 3300050493 nmdc:mga0k408_13299_c1 nmdc:mga0k408_13299_c1_3045_3824 233
24 3300005330 Ga0070690_100050185 Ga0070690_1000501852 234
25 3300005334 Ga0068869_100392877 Ga0068869_1003928771 234
26 3300005455 Ga0070663_100367993 Ga0070663_1003679931 234
27 3300005719 Ga0068861_100127322 Ga0068861_1001273222 234
28 3300006237 Ga0097621_100587714 Ga0097621_1005877142 234
29 3300013297 Ga0157378_10292403 Ga0157378_102924032 234
30 3300014968 Ga0157379_10206476 Ga0157379_102064762 234
31 3300025942 Ga0207689_10263201 Ga0207689_102632012 234
32 3300005327 Ga0070658_10122976 Ga0070658_101229762 235
33 3300005339 Ga0070660_100284005 Ga0070660_1002840052 235
34 3300005466 Ga0070685_10060194 Ga0070685_100601942 235
35 3300005548 Ga0070665_100198795 Ga0070665_1001987953 240
36 3300028379 Ga0268266_10056764 Ga0268266_100567646 240
37 3300025907 Ga0207645_10246467 Ga0207645_102464672 242
38 3300028794 Ga0307515_10342685 Ga0307515_103426851 243
39 3300046515 Ga0495620_0008764 Ga0495620_0008764_4243_5025 243
40 3300046520 Ga0495637_0072024 Ga0495637_0072024_514_1296 243
41 3300046530 Ga0495654_0066438 Ga0495654_0066438_182_964 243
42 3300046664 Ga0495659_0081908 Ga0495659_0081908_160_942 243
43 3300046691 Ga0495670_0093600 Ga0495670_0093600_682_1464 243
44 3300046692 Ga0495671_0052500 Ga0495671_0052500_148_930 243
45 3300053079 Ga0500610_0030293 Ga0500610_0030293_1099_1881 243
46 3300053109 Ga0500569_068011 Ga0500569_068011_268_1050 243
47 3300053117 Ga0500593_000312 Ga0500593_000312_4939_5721 243
48 3300053158 Ga0500627_0001520 Ga0500627_0001520_4391_5173 243
49 3300053161 Ga0500634_0077988 Ga0500634_0077988_85_867 243
50 3300009148 Ga0105243_10162587 Ga0105243_101625872 244
51 3300038443 Ga0395901_0453258 Ga0395901_0453258_278_1030 244
52 3300037471 Ga0395905_0000728 Ga0395905_0000728_5607_6374 245
53 3300035691 Ga0373931_0039317 Ga0373931_0039317_1043_1816 246
54 3300046492 Ga0495585_0008753 Ga0495585_0008753_4092_4865 246
55 3300048908 Ga0496105_0336379 Ga0496105_0336379_285_1046 246
56 3300032002 Ga0307416_100791813 Ga0307416_1007918131 247
57 iso_pu_bacteria 2511231002 2511244641 247
58 iso_pu_bacteria 2643221609 2644062224 247
59 iso_pu_bacteria 2643221611 2644071412 247
60 iso_pu_bacteria 2738543012 2739245835 247
61 iso_pu_bacteria 2738543013 2739250105 247
62 iso_pu_bacteria 2816332133 2816470529 247
63 iso_pu_bacteria 2842733646 2842736389 247
64 iso_pu_bacteria 2842747753 2842748897 247
65 iso_pu_bacteria 2885192300 2885196965 247
66 iso_pu_bacteria 2919704043 2919707111 247
67 iso_pu_bacteria 2928115317 2928118006 247
68 iso_pu_bacteria 2932422444 2932424017 247
69 3300037312 Ga0395899_0008661 Ga0395899_0008661_661_1413 249
70 3300003792 Ga0055540_1013552 Ga0055540_10135523 250
71 3300025303 Ga0209051_1000904 Ga0209051_100090423 250
72 3300031456 Ga0307513_10000008 Ga0307513_1000000810 250
73 3300037312 Ga0395899_0086072 Ga0395899_0086072_170_925 250
74 3300037418 Ga0395900_0015874 Ga0395900_0015874_1156_1911 250
75 3300037471 Ga0395905_0044151 Ga0395905_0044151_974_1729 250
76 3300038443 Ga0395901_0023253 Ga0395901_0023253_2537_3292 250
77 3300044712 Ga0453684_0324572 Ga0453684_0324572_610_1362 250
78 3300045049 Ga0466959_0115012 Ga0466959_0115012_859_1614 250
79 3300061719 Ga0466962_0028646 Ga0466962_0028646_763_1518 250
80 3300002704 JGI25155J39150_1000022 JGI25155J39150_1000022109 251
81 3300002705 JGI25156J39149_1000005 JGI25156J39149_1000005101 251
82 3300002705 JGI25156J39149_1004039 JGI25156J39149_10040392 251
83 3300002738 JGI25154J39366_1000017 JGI25154J39366_100001793 251
84 3300002738 JGI25154J39366_1001087 JGI25154J39366_10010876 251
85 3300002741 JGI25157J39369_1000003 JGI25157J39369_1000003109 251
86 3300002741 JGI25157J39369_1000245 JGI25157J39369_10002457 251
87 3300002987 JGI25159J45721_1001343 JGI25159J45721_10013432 251
88 3300003187 JGI25151J46595_10026761 JGI25151J46595_100267611 251
89 3300003187 JGI25151J46595_10037206 JGI25151J46595_100372062 251
90 3300003322 rootL2_10001954 rootL2_100019541 251
91 3300003322 rootL2_10001955 rootL2_100019552 251
92 3300003323 rootH1_10059193 rootH1_100591932 251
93 3300003323 rootH1_10063216 rootH1_100632161 251
94 3300003323 rootH1_10152291 rootH1_101522911 251
95 3300003354 JGI25160J50197_1000273 JGI25160J50197_100027338 251
96 3300003374 JGI25161J50226_1000095 JGI25161J50226_100009548 251
97 3300003752 Ga0055539_1004233 Ga0055539_10042332 251
98 3300003756 Ga0055533_1000045 Ga0055533_100004581 251
99 3300003759 Ga0055525_1000681 Ga0055525_10006819 251
100 3300003761 Ga0055535_1000047 Ga0055535_100004737 251
101 3300003761 Ga0055535_1008828 Ga0055535_10088282 251
102 3300003763 Ga0055529_1000148 Ga0055529_100014847 251
103 3300003771 Ga0055526_1040515 Ga0055526_10405151 251
104 3300003771 Ga0055526_1054393 Ga0055526_10543931 251
105 3300003773 Ga0055537_1000205 Ga0055537_100020513 251
106 3300003773 Ga0055537_1012545 Ga0055537_10125452 251
107 3300003775 Ga0055524_1000073 Ga0055524_100007361 251
108 3300003781 Ga0055536_1041960 Ga0055536_10419601 251
109 3300003784 Ga0055534_1000363 Ga0055534_10003638 251
110 3300003790 Ga0055528_1000289 Ga0055528_100028934 251
111 3300003791 Ga0055530_10001804 Ga0055530_1000180412 251
112 3300003792 Ga0055540_1000037 Ga0055540_100003773 251
113 3300004625 Ga0055543_1000218 Ga0055543_100021846 251
114 3300005262 Ga0065165_1020502 Ga0065165_10205021 251
115 3300005262 Ga0065165_1028953 Ga0065165_10289532 251
116 3300005327 Ga0070658_10185759 Ga0070658_101857592 251
117 3300005327 Ga0070658_10233536 Ga0070658_102335362 251
118 3300005336 Ga0070680_100199107 Ga0070680_1001991071 251
119 3300005338 Ga0068868_100408899 Ga0068868_1004088991 251
120 3300005339 Ga0070660_100672394 Ga0070660_1006723941 251
121 3300005347 Ga0070668_100315975 Ga0070668_1003159752 251
122 3300005353 Ga0070669_100074138 Ga0070669_1000741382 251
123 3300005356 Ga0070674_100387459 Ga0070674_1003874591 251
124 3300005367 Ga0070667_100024333 Ga0070667_1000243333 251
125 3300005435 Ga0070714_100083618 Ga0070714_1000836182 251
126 3300005456 Ga0070678_100144392 Ga0070678_1001443922 251
127 3300005456 Ga0070678_100161283 Ga0070678_1001612832 251
128 3300005456 Ga0070678_100391141 Ga0070678_1003911411 251
129 3300005459 Ga0068867_100330050 Ga0068867_1003300502 251
130 3300005530 Ga0070679_100018152 Ga0070679_1000181525 251
131 3300005535 Ga0070684_100240023 Ga0070684_1002400232 251
132 3300005539 Ga0068853_100460639 Ga0068853_1004606392 251
133 3300005543 Ga0070672_100229911 Ga0070672_1002299112 251
134 3300005548 Ga0070665_100208694 Ga0070665_1002086942 251
135 3300005548 Ga0070665_100755340 Ga0070665_1007553401 251
136 3300005563 Ga0068855_100058788 Ga0068855_1000587885 251
137 3300005563 Ga0068855_100663926 Ga0068855_1006639261 251
138 3300005577 Ga0068857_100113459 Ga0068857_1001134593 251
139 3300005578 Ga0068854_100006652 Ga0068854_1000066527 251
140 3300005614 Ga0068856_100001716 Ga0068856_10000171625 251
141 3300005616 Ga0068852_100074653 Ga0068852_1000746535 251
142 3300006038 Ga0075365_10085442 Ga0075365_100854423 251
143 3300006038 Ga0075365_10335112 Ga0075365_103351121 251
144 3300006038 Ga0075365_10351819 Ga0075365_103518191 251
145 3300006042 Ga0075368_10021135 Ga0075368_100211352 251
146 3300006048 Ga0075363_100046512 Ga0075363_1000465122 251
147 3300006048 Ga0075363_100102574 Ga0075363_1001025742 251
148 3300006048 Ga0075363_100184856 Ga0075363_1001848562 251
149 3300006051 Ga0075364_10088058 Ga0075364_100880582 251
150 3300006058 Ga0075432_10002101 Ga0075432_100021017 251
151 3300006177 Ga0075362_10018885 Ga0075362_100188853 251
152 3300006177 Ga0075362_10030388 Ga0075362_100303882 251
153 3300006177 Ga0075362_10059452 Ga0075362_100594521 251
154 3300006178 Ga0075367_10173370 Ga0075367_101733702 251
155 3300006195 Ga0075366_10005340 Ga0075366_100053404 251
156 3300006195 Ga0075366_10040299 Ga0075366_100402992 251
157 3300006195 Ga0075366_10060547 Ga0075366_100605472 251
158 3300006195 Ga0075366_10068694 Ga0075366_100686943 251
159 3300006195 Ga0075366_10074728 Ga0075366_100747281 251
160 3300006195 Ga0075366_10076797 Ga0075366_100767972 251
161 3300006195 Ga0075366_10172023 Ga0075366_101720232 251
162 3300006195 Ga0075366_10335153 Ga0075366_103351531 251
163 3300006353 Ga0075370_10003632 Ga0075370_100036323 251
164 3300006353 Ga0075370_10050148 Ga0075370_100501482 251
165 3300006353 Ga0075370_10225733 Ga0075370_102257332 251
166 3300006353 Ga0075370_10261441 Ga0075370_102614412 251
167 3300006846 Ga0075430_100169916 Ga0075430_1001699162 251
168 3300006946 Ga0079104_1040443 Ga0079104_10404432 251
169 3300009093 Ga0105240_10008945 Ga0105240_1000894519 251
170 3300009093 Ga0105240_10271816 Ga0105240_102718162 251
171 3300009093 Ga0105240_10283589 Ga0105240_102835892 251
172 3300009174 Ga0105241_10220982 Ga0105241_102209822 251
173 3300009176 Ga0105242_10004226 Ga0105242_100042268 251
174 3300009176 Ga0105242_10631114 Ga0105242_106311141 251
175 3300009545 Ga0105237_10306461 Ga0105237_103064612 251
176 3300009551 Ga0105238_10025724 Ga0105238_100257242 251
177 3300009551 Ga0105238_10163019 Ga0105238_101630193 251
178 3300009551 Ga0105238_10167037 Ga0105238_101670372 251
179 3300010375 Ga0105239_10160843 Ga0105239_101608432 251
180 3300011119 Ga0105246_10310789 Ga0105246_103107891 251
181 3300013105 Ga0157369_10024224 Ga0157369_100242246 251
182 3300013296 Ga0157374_10919092 Ga0157374_109190921 251
183 3300013306 Ga0163162_10083970 Ga0163162_100839702 251
184 3300013306 Ga0163162_10458657 Ga0163162_104586572 251
185 3300013307 Ga0157372_10197385 Ga0157372_101973853 251
186 3300013308 Ga0157375_10246811 Ga0157375_102468112 251
187 3300013308 Ga0157375_10966913 Ga0157375_109669131 251
188 3300014326 Ga0157380_10330018 Ga0157380_103300182 251
189 3300014497 Ga0182008_10058182 Ga0182008_100581822 251
190 3300014497 Ga0182008_10076765 Ga0182008_100767652 251
191 3300014497 Ga0182008_10161869 Ga0182008_101618692 251
192 3300014969 Ga0157376_10188012 Ga0157376_101880122 251
193 3300014969 Ga0157376_10441386 Ga0157376_104413862 251
194 3300015261 Ga0182006_1039095 Ga0182006_10390952 251
195 3300015262 Ga0182007_10002638 Ga0182007_100026389 251
196 3300015683 Ga0183362_10003 Ga0183362_10003611 251
197 3300017792 Ga0163161_10217858 Ga0163161_102178582 251
198 3300017792 Ga0163161_10316030 Ga0163161_103160302 251
199 3300021361 Ga0213872_10038199 Ga0213872_100381992 251
200 3300025206 Ga0209435_100002 Ga0209435_100002217 251
201 3300025208 Ga0209436_109303 Ga0209436_1093032 251
202 3300025226 Ga0209674_100073 Ga0209674_10007381 251
203 3300025230 Ga0209563_100061 Ga0209563_100061149 251
204 3300025231 Ga0207427_101392 Ga0207427_1013925 251
205 3300025242 Ga0209258_100072 Ga0209258_100072230 251
206 3300025242 Ga0209258_104057 Ga0209258_1040572 251
207 3300025245 Ga0207425_1002688 Ga0207425_10026882 251
208 3300025245 Ga0207425_1003670 Ga0207425_10036702 251
209 3300025246 Ga0209646_1000001 Ga0209646_10000012360 251
210 3300025246 Ga0209646_1000076 Ga0209646_1000076153 251
211 3300025250 Ga0209026_1000001 Ga0209026_10000011017 251
212 3300025250 Ga0209026_1000011 Ga0209026_1000011337 251
213 3300025253 Ga0209677_100070 Ga0209677_10007064 251
214 3300025253 Ga0209677_102967 Ga0209677_1029675 251
215 3300025254 Ga0209148_1003914 Ga0209148_10039143 251
216 3300025256 Ga0209759_1000001 Ga0209759_10000011991 251
217 3300025256 Ga0209759_1000034 Ga0209759_1000034139 251
218 3300025256 Ga0209759_1010366 Ga0209759_10103663 251
219 3300025256 Ga0209759_1019829 Ga0209759_10198292 251
220 3300025258 Ga0209129_1029630 Ga0209129_10296301 251
221 3300025263 Ga0209565_1000128 Ga0209565_100012871 251
222 3300025263 Ga0209565_1000574 Ga0209565_10005741 251
223 3300025272 Ga0209455_1000053 Ga0209455_1000053310 251
224 3300025273 Ga0209673_1000008 Ga0209673_100000894 251
225 3300025284 Ga0209130_1000072 Ga0209130_100007254 251
226 3300025284 Ga0209130_1001611 Ga0209130_100161113 251
227 3300025291 Ga0209675_1000099 Ga0209675_10000992 251
228 3300025291 Ga0209675_1009484 Ga0209675_10094842 251
229 3300025292 Ga0209676_1000023 Ga0209676_1000023340 251
230 3300025292 Ga0209676_1003664 Ga0209676_10036642 251
231 3300025294 Ga0209025_1006053 Ga0209025_100605311 251
232 3300025294 Ga0209025_1014674 Ga0209025_10146743 251
233 3300025294 Ga0209025_1017536 Ga0209025_10175365 251
234 3300025294 Ga0209025_1033673 Ga0209025_10336732 251
235 3300025294 Ga0209025_1042659 Ga0209025_10426591 251
236 3300025295 Ga0209564_1007849 Ga0209564_10078497 251
237 3300025295 Ga0209564_1049592 Ga0209564_10495922 251
238 3300025297 Ga0209758_1028519 Ga0209758_10285192 251
239 3300025298 Ga0209050_1000022 Ga0209050_1000022322 251
240 3300025298 Ga0209050_1011134 Ga0209050_10111346 251
241 3300025299 Ga0209256_1000001 Ga0209256_10000011808 251
242 3300025302 Ga0207426_1000319 Ga0207426_100031948 251
243 3300025302 Ga0207426_1013921 Ga0207426_10139211 251
244 3300025303 Ga0209051_1000013 Ga0209051_1000013322 251
245 3300025304 Ga0209257_1000042 Ga0209257_1000042165 251
246 3300025909 Ga0207705_10254625 Ga0207705_102546252 251
247 3300025911 Ga0207654_10057855 Ga0207654_100578551 251
248 3300025911 Ga0207654_10166896 Ga0207654_101668962 251
249 3300025913 Ga0207695_10005493 Ga0207695_100054936 251
250 3300025913 Ga0207695_10123790 Ga0207695_101237904 251
251 3300025914 Ga0207671_10119636 Ga0207671_101196362 251
252 3300025917 Ga0207660_10228767 Ga0207660_102287672 251
253 3300025919 Ga0207657_10062642 Ga0207657_100626422 251
254 3300025923 Ga0207681_10055268 Ga0207681_100552682 251
255 3300025924 Ga0207694_10130298 Ga0207694_101302982 251
256 3300025924 Ga0207694_10304733 Ga0207694_103047332 251
257 3300025933 Ga0207706_10451288 Ga0207706_104512882 251
258 3300025934 Ga0207686_10000954 Ga0207686_100009548 251
259 3300025937 Ga0207669_10020071 Ga0207669_100200716 251
260 3300025940 Ga0207691_10387692 Ga0207691_103876922 251
261 3300025942 Ga0207689_10074760 Ga0207689_100747602 251
262 3300025944 Ga0207661_10472575 Ga0207661_104725751 251
263 3300025949 Ga0207667_10228580 Ga0207667_102285802 251
264 3300025972 Ga0207668_10393799 Ga0207668_103937991 251
265 3300025986 Ga0207658_10039090 Ga0207658_100390902 251
266 3300026023 Ga0207677_10238017 Ga0207677_102380171 251
267 3300026023 Ga0207677_10239766 Ga0207677_102397662 251
268 3300026023 Ga0207677_10362980 Ga0207677_103629802 251
269 3300026078 Ga0207702_10001565 Ga0207702_100015654 251
270 3300026088 Ga0207641_10064069 Ga0207641_100640692 251
271 3300026089 Ga0207648_10173845 Ga0207648_101738451 251
272 3300026089 Ga0207648_10463245 Ga0207648_104632452 251
273 3300026116 Ga0207674_10005653 Ga0207674_1000565314 251
274 3300026116 Ga0207674_10147041 Ga0207674_101470412 251
275 3300026121 Ga0207683_10068293 Ga0207683_100682932 251
276 3300026121 Ga0207683_10278496 Ga0207683_102784962 251
277 3300027866 Ga0209813_10035939 Ga0209813_100359392 251
278 3300027907 Ga0207428_10150538 Ga0207428_101505382 251
279 3300028379 Ga0268266_10076416 Ga0268266_100764162 251
280 3300028379 Ga0268266_10109427 Ga0268266_101094274 251
281 3300028666 Ga0265336_10000036 Ga0265336_1000003655 251
282 3300028794 Ga0307515_10000084 Ga0307515_10000084153 251
283 3300028794 Ga0307515_10004716 Ga0307515_1000471617 251
284 3300028794 Ga0307515_10134564 Ga0307515_101345642 251
285 3300029957 Ga0265324_10000136 Ga0265324_1000013626 251
286 3300030522 Ga0307512_10175081 Ga0307512_101750812 251
287 3300031239 Ga0265328_10055880 Ga0265328_100558802 251
288 3300031251 Ga0265327_10008835 Ga0265327_100088352 251
289 3300031251 Ga0265327_10169866 Ga0265327_101698661 251
290 3300031456 Ga0307513_10000038 Ga0307513_10000038148 251
291 3300031548 Ga0307408_100017442 Ga0307408_1000174426 251
292 3300031548 Ga0307408_100035804 Ga0307408_1000358042 251
293 3300031649 Ga0307514_10000319 Ga0307514_100003199 251
294 3300031730 Ga0307516_10004973 Ga0307516_1000497318 251
295 3300031730 Ga0307516_10029845 Ga0307516_100298452 251
296 3300031731 Ga0307405_10066088 Ga0307405_100660882 251
297 3300031731 Ga0307405_10085066 Ga0307405_100850662 251
298 3300031901 Ga0307406_10015826 Ga0307406_100158263 251
299 3300031911 Ga0307412_10461958 Ga0307412_104619582 251
300 3300032002 Ga0307416_100275069 Ga0307416_1002750692 251
301 3300037418 Ga0395900_0026531 Ga0395900_0026531_3492_4253 251
302 3300037418 Ga0395900_0188545 Ga0395900_0188545_1133_1888 251
303 3300037466 Ga0395898_0004158 Ga0395898_0004158_12178_12939 251
304 3300037466 Ga0395898_0044157 Ga0395898_0044157_97_876 251
305 3300037471 Ga0395905_0025949 Ga0395905_0025949_664_1425 251
306 3300037471 Ga0395905_0029854 Ga0395905_0029854_4307_5068 251
307 3300038443 Ga0395901_0003179 Ga0395901_0003179_4366_5145 251
308 3300038443 Ga0395901_0090939 Ga0395901_0090939_2094_2855 251
309 3300038443 Ga0395901_0241545 Ga0395901_0241545_233_988 251
310 3300039447 Ga0436361_0567754 Ga0436361_0567754_1366_2148 251
311 3300039447 Ga0436361_0711422 Ga0436361_0711422_421_1185 251
312 3300041404 Ga0439436_0000668 Ga0439436_0000668_564_1319 251
313 3300041404 Ga0439436_0034512 Ga0439436_0034512_157_912 251
314 3300041406 Ga0439439_0019710 Ga0439439_0019710_759_1514 251
315 3300041407 Ga0439447_039433 Ga0439447_039433_137_892 251
316 3300041410 Ga0439461_0017351 Ga0439461_0017351_241_996 251
317 3300041411 Ga0439466_0008629 Ga0439466_0008629_2665_3420 251
318 3300041411 Ga0439466_0016919 Ga0439466_0016919_721_1476 251
319 3300041413 Ga0439465_0004974 Ga0439465_0004974_3309_4064 251
320 3300041451 Ga0451791_1208931 Ga0451791_1208931_181_936 251
321 3300041459 Ga0451800_1061636 Ga0451800_1061636_53_808 251
322 3300041459 Ga0451800_1566960 Ga0451800_1566960_78_836 251
323 3300041486 Ga0451807_0755093 Ga0451807_0755093_123_878 251
324 3300041997 Ga0439431_0013193 Ga0439431_0013193_269_1024 251
325 3300041997 Ga0439431_0040539 Ga0439431_0040539_294_1049 251
326 3300041999 Ga0439433_0009473 Ga0439433_0009473_492_1247 251
327 3300042002 Ga0439442_033853 Ga0439442_033853_74_829 251
328 3300042004 Ga0439445_0000200 Ga0439445_0000200_1663_2418 251
329 3300042004 Ga0439445_0023535 Ga0439445_0023535_335_1105 251
330 3300042006 Ga0439432_012869 Ga0439432_012869_1894_2649 251
331 3300042006 Ga0439432_043463 Ga0439432_043463_325_1080 251
332 3300042007 Ga0439449_0001627 Ga0439449_0001627_5153_5908 251
333 3300042007 Ga0439449_0043017 Ga0439449_0043017_341_1096 251
334 3300042010 Ga0439452_013026 Ga0439452_013026_1444_2199 251
335 3300042010 Ga0439452_019885 Ga0439452_019885_712_1467 251
336 3300042014 Ga0439457_007541 Ga0439457_007541_885_1640 251
337 3300042015 Ga0439462_0018109 Ga0439462_0018109_781_1536 251
338 3300042115 Ga0450911_000822 Ga0450911_000822_7117_7887 251
339 3300042115 Ga0450911_019713 Ga0450911_019713_101_859 251
340 3300042134 Ga0450898_005473 Ga0450898_005473_723_1478 251
341 3300042156 Ga0439446_0024648 Ga0439446_0024648_280_1035 251
342 3300042156 Ga0439446_0065110 Ga0439446_0065110_156_914 251
343 3300042435 Ga0439434_0005498 Ga0439434_0005498_2519_3274 251
344 3300044656 Ga0466969_0008057 Ga0466969_0008057_330_1124 251
345 3300044656 Ga0466969_0020418 Ga0466969_0020418_1246_2013 251
346 3300044673 Ga0453683_0002261 Ga0453683_0002261_678_1436 251
347 3300044683 Ga0466965_0011708 Ga0466965_0011708_1205_1999 251
348 3300044683 Ga0466965_0085773 Ga0466965_0085773_422_1177 251
349 3300044684 Ga0466966_0018169 Ga0466966_0018169_3202_3969 251
350 3300044684 Ga0466966_0026697 Ga0466966_0026697_942_1736 251
351 3300044693 Ga0466961_0002913 Ga0466961_0002913_596_1363 251
352 3300044693 Ga0466961_0045949 Ga0466961_0045949_1448_2242 251
353 3300044694 Ga0466963_0004061 Ga0466963_0004061_6473_7240 251
354 3300044694 Ga0466963_0092730 Ga0466963_0092730_885_1679 251
355 3300044706 Ga0466964_0004782 Ga0466964_0004782_410_1177 251
356 3300044706 Ga0466964_0033527 Ga0466964_0033527_39_833 251
357 3300044719 Ga0466971_0009165 Ga0466971_0009165_3202_3969 251
358 3300044719 Ga0466971_0019879 Ga0466971_0019879_948_1742 251
359 3300044842 Ga0466957_0038059 Ga0466957_0038059_564_1358 251
360 3300045049 Ga0466959_0000027 Ga0466959_0000027_27044_27811 251
361 3300045049 Ga0466959_0032585 Ga0466959_0032585_965_1759 251
362 3300045051 Ga0451576_0311637 Ga0451576_0311637_302_1060 251
363 3300045051 Ga0451576_0524088 Ga0451576_0524088_396_1154 251
364 3300045051 Ga0451576_0746238 Ga0451576_0746238_59_814 251
365 3300045836 Ga0466958_0009465 Ga0466958_0009465_1225_2019 251
366 3300045976 Ga0466967_0013629 Ga0466967_0013629_736_1503 251
367 3300045976 Ga0466967_0120891 Ga0466967_0120891_645_1439 251
368 3300046459 Ga0495629_0201584 Ga0495629_0201584_271_1026 251
369 3300046471 Ga0495650_0057591 Ga0495650_0057591_449_1228 251
370 3300046475 Ga0495639_0002158 Ga0495639_0002158_6438_7217 251
371 3300046475 Ga0495639_0039662 Ga0495639_0039662_944_1699 251
372 3300046492 Ga0495585_0138317 Ga0495585_0138317_258_1037 251
373 3300046506 Ga0495583_0000418 Ga0495583_0000418_1000_1779 251
374 3300046507 Ga0495606_0009174 Ga0495606_0009174_2002_2781 251
375 3300046517 Ga0495630_0415275 Ga0495630_0415275_239_994 251
376 3300046530 Ga0495654_0003583 Ga0495654_0003583_828_1592 251
377 3300046539 Ga0495621_0051475 Ga0495621_0051475_285_1040 251
378 3300046615 Ga0495656_0000757 Ga0495656_0000757_367_1122 251
379 3300046660 Ga0495625_0010094 Ga0495625_0010094_1190_1969 251
380 3300046663 Ga0495635_0243226 Ga0495635_0243226_303_1058 251
381 3300046674 Ga0495588_0134207 Ga0495588_0134207_415_1170 251
382 3300046679 Ga0495623_0206178 Ga0495623_0206178_295_1074 251
383 3300046684 Ga0495669_0024291 Ga0495669_0024291_1274_2053 251
384 3300046794 Ga0495589_0021916 Ga0495589_0021916_894_1673 251
385 3300047315 Ga0495581_0163543 Ga0495581_0163543_214_969 251
386 3300047472 Ga0495686_0010557 Ga0495686_0010557_2169_2957 251
387 3300048090 Ga0495615_0014509 Ga0495615_0014509_832_1596 251
388 3300048903 Ga0496100_0102783 Ga0496100_0102783_532_1287 251
389 3300048903 Ga0496100_0263640 Ga0496100_0263640_135_914 251
390 3300048904 Ga0496101_0090785 Ga0496101_0090785_1168_1923 251
391 3300048905 Ga0496102_0199998 Ga0496102_0199998_1107_1862 251
392 3300048906 Ga0496103_0132834 Ga0496103_0132834_555_1310 251
393 3300048907 Ga0496104_0251383 Ga0496104_0251383_447_1202 251
394 3300048907 Ga0496104_0298285 Ga0496104_0298285_448_1215 251
395 3300048908 Ga0496105_0011369 Ga0496105_0011369_3650_4405 251
396 3300048909 Ga0496106_0270485 Ga0496106_0270485_355_1110 251
397 3300048910 Ga0496107_0134858 Ga0496107_0134858_508_1263 251
398 3300048912 Ga0496109_0251001 Ga0496109_0251001_522_1277 251
399 3300048925 Ga0496122_0000612 Ga0496122_0000612_72125_72880 251
400 3300048926 Ga0496123_0000274 Ga0496123_0000274_28916_29671 251
401 3300048928 Ga0496125_0119390 Ga0496125_0119390_885_1655 251
402 3300049763 Ga0501266_000597 Ga0501266_000597_250_1008 251
403 3300050489 nmdc:mga03683_129285_c1 nmdc:mga03683_129285_c1_278_1033 251
404 3300050490 nmdc:mga03n38_174022_c1 nmdc:mga03n38_174022_c1_124_879 251
405 3300050490 nmdc:mga03n38_84859_c1 nmdc:mga03n38_84859_c1_50_805 251
406 3300050492 nmdc:mga0yw44_55092_c1 nmdc:mga0yw44_55092_c1_782_1537 251
407 3300050493 nmdc:mga0k408_12109_c1 nmdc:mga0k408_12109_c1_2711_3466 251
408 3300050493 nmdc:mga0k408_62654_c1 nmdc:mga0k408_62654_c1_1112_1867 251
409 3300050493 nmdc:mga0k408_738_c2 nmdc:mga0k408_738_c2_4847_5605 251
410 3300050494 nmdc:mga06z11_33845_c1 nmdc:mga06z11_33845_c1_750_1505 251
411 3300050496 nmdc:mga07m45_118507_c1 nmdc:mga07m45_118507_c1_272_1027 251
412 3300050496 nmdc:mga07m45_3314_c1 nmdc:mga07m45_3314_c1_3224_3979 251
413 3300050496 nmdc:mga07m45_522_c2 nmdc:mga07m45_522_c2_733_1512 251
414 3300050496 nmdc:mga07m45_58596_c1 nmdc:mga07m45_58596_c1_1249_2004 251
415 3300053080 Ga0500635_0000030 Ga0500635_0000030_35455_36234 251
416 3300053117 Ga0500593_060071 Ga0500593_060071_249_1004 251
417 3300053136 Ga0500559_0044984 Ga0500559_0044984_720_1475 251
418 3300053136 Ga0500559_0086920 Ga0500559_0086920_105_884 251
419 3300053138 Ga0500564_150179 Ga0500564_150179_89_868 251
420 3300053156 Ga0500622_0146385 Ga0500622_0146385_283_1038 251
421 3300053160 Ga0500633_0086075 Ga0500633_0086075_179_934 251
422 3300053177 Ga0500636_0129632 Ga0500636_0129632_424_1203 251
423 3300053730 Ga0500645_001028 Ga0500645_001028_14832_15587 251
424 3300055283 Ga0500661_004013 Ga0500661_004013_612_1391 251
425 3300061719 Ga0466962_0025893 Ga0466962_0025893_1356_2150 251
426 iso_pu_bacteria 2881101125 2881103423 251
427 3300046453 Ga0495627_024060 Ga0495627_024060_429_1190 253
428 iso_pu_bacteria 2738541277 2738720440 253
429 iso_pu_bacteria 2738541307 2738880373 253
430 iso_pu_bacteria 2738543019 2739279639 253
431 iso_pu_bacteria 2818991446 2819601122 253
432 iso_pu_bacteria 2831265667 2831271565 253
433 iso_pu_bacteria 2838054893 2838055467 253
434 iso_pu_bacteria 2842677519 2842682107 253
435 iso_pu_bacteria 2899924645 2899927532 253
436 iso_pu_bacteria 2904449895 2904450732 253
437 iso_pu_bacteria 2904456579 2904459768 253
438 iso_pu_bacteria 2919462493 2919462738 253
439 iso_pu_bacteria 2928037797 2928042556 253
440 iso_pu_bacteria 2928044640 2928049017 253
441 iso_pu_bacteria 2928051484 2928051567 253
442 iso_pu_bacteria 2928064002 2928070753 253
443 iso_pu_bacteria 2928084124 2928086985 253
444 iso_pu_bacteria 2929520902 2929521450 253
445 iso_pu_bacteria 2945945610 2945949462 253
446 iso_pu_bacteria 2945972063 2945973509 253
447 iso_pu_bacteria 2954767861 2954770878 253
448 3300006028 Ga0070717_10155290 Ga0070717_101552902 254
449 iso_pu_bacteria 2513020051 2513230125 254
450 iso_pu_bacteria 2643221658 2644324332 254
451 iso_pu_bacteria 2643221672 2644396176 254
452 2162886007 SwRhRL2b_contig_12867 SwRhRL2b_0430.00003270 257
453 2162886007 SwRhRL2b_contig_3103763 SwRhRL2b_0654.00004730 257
454 3300001979 JGI24740J21852_10011180 JGI24740J21852_100111803 257
455 3300002773 JGI25152J39213_1013354 JGI25152J39213_10133542 257
456 3300003187 JGI25151J46595_10000864 JGI25151J46595_100008644 257
457 3300003187 JGI25151J46595_10023979 JGI25151J46595_100239792 257
458 3300003215 JGI25153J46596_10038610 JGI25153J46596_100386102 257
459 3300003323 rootH1_10028675 rootH1_100286751 257
460 3300003374 JGI25161J50226_1006851 JGI25161J50226_10068512 257
461 3300003578 Ga0006562J51391_1143153 Ga0006562J51391_11431532 257
462 3300003761 Ga0055535_1001458 Ga0055535_10014587 257
463 3300003762 Ga0055542_1000080 Ga0055542_1000080114 257
464 3300003771 Ga0055526_1035680 Ga0055526_10356802 257
465 3300003773 Ga0055537_1000150 Ga0055537_100015041 257
466 3300003773 Ga0055537_1016229 Ga0055537_10162291 257
467 3300003775 Ga0055524_1037856 Ga0055524_10378561 257
468 3300003781 Ga0055536_1017554 Ga0055536_10175542 257
469 3300003781 Ga0055536_1020774 Ga0055536_10207741 257
470 3300003784 Ga0055534_1000016 Ga0055534_100001669 257
471 3300003784 Ga0055534_1002375 Ga0055534_10023752 257
472 3300003790 Ga0055528_1018942 Ga0055528_10189421 257
473 3300003790 Ga0055528_1034095 Ga0055528_10340951 257
474 3300003791 Ga0055530_10013917 Ga0055530_100139172 257
475 3300003791 Ga0055530_10020135 Ga0055530_100201351 257
476 3300003792 Ga0055540_1016696 Ga0055540_10166961 257
477 3300003792 Ga0055540_1017448 Ga0055540_10174481 257
478 3300003794 Ga0055531_10013523 Ga0055531_100135231 257
479 3300003794 Ga0055531_10027364 Ga0055531_100273641 257
480 3300004625 Ga0055543_1009440 Ga0055543_10094401 257
481 3300005289 Ga0065704_10003100 Ga0065704_100031003 257
482 3300005366 Ga0070659_100120453 Ga0070659_1001204532 257
483 3300005457 Ga0070662_100120239 Ga0070662_1001202392 257
484 3300005539 Ga0068853_100093937 Ga0068853_1000939371 257
485 3300005563 Ga0068855_100314650 Ga0068855_1003146502 257
486 3300005614 Ga0068856_100103103 Ga0068856_1001031035 257
487 3300006177 Ga0075362_10166112 Ga0075362_101661121 257
488 3300006195 Ga0075366_10105788 Ga0075366_101057882 257
489 3300006353 Ga0075370_10002013 Ga0075370_100020132 257
490 3300006353 Ga0075370_10063133 Ga0075370_100631332 257
491 3300006353 Ga0075370_10102025 Ga0075370_101020251 257
492 3300006358 Ga0068871_100102473 Ga0068871_1001024732 257
493 3300006948 Ga0099826_10079164 Ga0099826_100791642 257
494 3300009036 Ga0105244_10003719 Ga0105244_100037198 257
495 3300009093 Ga0105240_10719343 Ga0105240_107193432 257
496 3300009098 Ga0105245_10188958 Ga0105245_101889582 257
497 3300009148 Ga0105243_10047127 Ga0105243_100471272 257
498 3300009148 Ga0105243_10460871 Ga0105243_104608711 257
499 3300009545 Ga0105237_10027197 Ga0105237_100271976 257
500 3300010375 Ga0105239_10919566 Ga0105239_109195661 257
501 3300013102 Ga0157371_10198264 Ga0157371_101982641 257
502 3300013105 Ga0157369_10022693 Ga0157369_100226935 257
503 3300013307 Ga0157372_10268779 Ga0157372_102687792 257
504 3300014497 Ga0182008_10060953 Ga0182008_100609532 257
505 3300014497 Ga0182008_10061799 Ga0182008_100617992 257
506 3300015261 Ga0182006_1027212 Ga0182006_10272122 257
507 3300015261 Ga0182006_1107396 Ga0182006_11073962 257
508 3300015262 Ga0182007_10028387 Ga0182007_100283872 257
509 3300015262 Ga0182007_10062422 Ga0182007_100624222 257
510 3300017792 Ga0163161_10145246 Ga0163161_101452462 257
511 3300017792 Ga0163161_10153856 Ga0163161_101538561 257
512 3300025228 Ga0209672_102374 Ga0209672_1023743 257
513 3300025229 Ga0209147_101277 Ga0209147_1012775 257
514 3300025242 Ga0209258_100009 Ga0209258_100009964 257
515 3300025245 Ga0207425_1008972 Ga0207425_10089721 257
516 3300025254 Ga0209148_1000007 Ga0209148_1000007964 257
517 3300025258 Ga0209129_1000404 Ga0209129_100040436 257
518 3300025258 Ga0209129_1012367 Ga0209129_10123672 257
519 3300025263 Ga0209565_1000098 Ga0209565_1000098109 257
520 3300025263 Ga0209565_1001099 Ga0209565_10010996 257
521 3300025263 Ga0209565_1002417 Ga0209565_10024172 257
522 3300025273 Ga0209673_1000058 Ga0209673_1000058142 257
523 3300025273 Ga0209673_1000410 Ga0209673_100041053 257
524 3300025273 Ga0209673_1000705 Ga0209673_100070536 257
525 3300025284 Ga0209130_1000295 Ga0209130_100029545 257
526 3300025291 Ga0209675_1000010 Ga0209675_1000010123 257
527 3300025291 Ga0209675_1000151 Ga0209675_100015134 257
528 3300025291 Ga0209675_1000381 Ga0209675_10003815 257
529 3300025292 Ga0209676_1000028 Ga0209676_1000028243 257
530 3300025294 Ga0209025_1000289 Ga0209025_100028992 257
531 3300025294 Ga0209025_1011304 Ga0209025_10113043 257
532 3300025294 Ga0209025_1054201 Ga0209025_10542012 257
533 3300025295 Ga0209564_1000724 Ga0209564_100072413 257
534 3300025298 Ga0209050_1022890 Ga0209050_10228902 257
535 3300025298 Ga0209050_1024981 Ga0209050_10249811 257
536 3300025298 Ga0209050_1053999 Ga0209050_10539991 257
537 3300025299 Ga0209256_1000088 Ga0209256_1000088152 257
538 3300025302 Ga0207426_1000038 Ga0207426_1000038346 257
539 3300025303 Ga0209051_1000015 Ga0209051_1000015172 257
540 3300025303 Ga0209051_1000056 Ga0209051_1000056228 257
541 3300025303 Ga0209051_1000509 Ga0209051_10005092 257
542 3300025303 Ga0209051_1031226 Ga0209051_10312261 257
543 3300025304 Ga0209257_1017914 Ga0209257_10179142 257
544 3300025728 Ga0207655_1004477 Ga0207655_10044777 257
545 3300025924 Ga0207694_10154125 Ga0207694_101541252 257
546 3300025932 Ga0207690_10106426 Ga0207690_101064262 257
547 3300025935 Ga0207709_10008426 Ga0207709_100084264 257
548 3300025935 Ga0207709_10159034 Ga0207709_101590342 257
549 3300025945 Ga0207679_10132187 Ga0207679_101321872 257
550 3300025949 Ga0207667_10186192 Ga0207667_101861922 257
551 3300026041 Ga0207639_10016347 Ga0207639_100163472 257
552 3300026116 Ga0207674_10171110 Ga0207674_101711102 257
553 3300026142 Ga0207698_10133560 Ga0207698_101335602 257
554 3300027666 Ga0209282_1006082 Ga0209282_10060829 257
555 3300028379 Ga0268266_10277308 Ga0268266_102773082 257
556 3300030731 Ga0316177_1143531 Ga0316177_11435316 257
557 3300030733 Ga0314311_1250141 Ga0314311_12501417 257
558 3300030734 Ga0316179_1098234 Ga0316179_10982341 257
559 3300030735 Ga0316178_1108036 Ga0316178_11080362 257
560 3300030736 Ga0316180_1017895 Ga0316180_10178952 257
561 3300030742 Ga0316183_1000995 Ga0316183_10009951 257
562 3300030745 Ga0316182_1303292 Ga0316182_13032923 257
563 3300031548 Ga0307408_100058354 Ga0307408_1000583543 257
564 3300031649 Ga0307514_10029570 Ga0307514_100295702 257
565 3300031731 Ga0307405_10094181 Ga0307405_100941812 257
566 3300031901 Ga0307406_10063505 Ga0307406_100635052 257
567 3300031911 Ga0307412_10379092 Ga0307412_103790921 257
568 3300032004 Ga0307414_10038184 Ga0307414_100381842 257
569 3300032004 Ga0307414_10251099 Ga0307414_102510991 257
570 3300032005 Ga0307411_10348329 Ga0307411_103483292 257
571 3300042007 Ga0439449_0037578 Ga0439449_0037578_192_965 257
572 3300046460 Ga0495638_0119328 Ga0495638_0119328_194_967 257
573 3300046507 Ga0495606_0091840 Ga0495606_0091840_746_1519 257
574 3300046512 Ga0495610_0017794 Ga0495610_0017794_2927_3700 257
575 3300046513 Ga0495616_0031740 Ga0495616_0031740_191_964 257
576 3300046518 Ga0495631_0006138 Ga0495631_0006138_5106_5879 257
577 3300046530 Ga0495654_0013618 Ga0495654_0013618_2390_3163 257
578 3300046616 Ga0495668_0177201 Ga0495668_0177201_35_808 257
579 3300046663 Ga0495635_0089763 Ga0495635_0089763_305_1081 257
580 3300047321 Ga0495676_0066313 Ga0495676_0066313_199_975 257
581 3300047673 Ga0495593_0130545 Ga0495593_0130545_271_1044 257
582 3300048088 Ga0495602_0190336 Ga0495602_0190336_258_1031 257
583 3300048089 Ga0495614_0049079 Ga0495614_0049079_879_1655 257
584 3300048904 Ga0496101_0132709 Ga0496101_0132709_967_1740 257
585 3300048906 Ga0496103_0140032 Ga0496103_0140032_743_1516 257
586 3300048919 Ga0496116_0028608 Ga0496116_0028608_174_950 257
587 3300048919 Ga0496116_0067609 Ga0496116_0067609_895_1668 257
588 3300048920 Ga0496117_0004519 Ga0496117_0004519_13600_14376 257
589 3300048920 Ga0496117_0089738 Ga0496117_0089738_1055_1828 257
590 3300048921 Ga0496118_0077444 Ga0496118_0077444_333_1109 257
591 3300048921 Ga0496118_0112549 Ga0496118_0112549_64_837 257
592 3300048924 Ga0496121_0041134 Ga0496121_0041134_1938_2711 257
593 3300048924 Ga0496121_0107715 Ga0496121_0107715_316_1089 257
594 3300048924 Ga0496121_0248710 Ga0496121_0248710_402_1178 257
595 3300048926 Ga0496123_0101262 Ga0496123_0101262_242_1015 257
596 3300048926 Ga0496123_0112237 Ga0496123_0112237_192_965 257
597 3300049127 Ga0501306_001383 Ga0501306_001383_1149_1922 257
598 3300049130 Ga0501310_001724 Ga0501310_001724_464_1237 257
599 3300049663 Ga0501223_030423 Ga0501223_030423_104_877 257
600 3300049679 Ga0501249_006688 Ga0501249_006688_1071_1844 257
601 3300049705 Ga0501225_0005272 Ga0501225_0005272_1228_2001 257
602 3300050489 nmdc:mga03683_58481_c1 nmdc:mga03683_58481_c1_312_1085 257
603 3300050491 nmdc:mga00v17_143258_c1 nmdc:mga00v17_143258_c1_111_884 257
604 3300050493 nmdc:mga0k408_91852_c1 nmdc:mga0k408_91852_c1_568_1341 257
605 3300050496 nmdc:mga07m45_171580_c1 nmdc:mga07m45_171580_c1_107_880 257
606 3300050496 nmdc:mga07m45_22608_c1 nmdc:mga07m45_22608_c1_161_934 257
607 3300050496 nmdc:mga07m45_3823_c1 nmdc:mga07m45_3823_c1_3083_3856 257
608 3300050496 nmdc:mga07m45_49622_c1 nmdc:mga07m45_49622_c1_661_1434 257
609 3300050516 nmdc:mga0sz30_68296_c1 nmdc:mga0sz30_68296_c1_219_992 257
610 3300053087 Ga0500643_018296 Ga0500643_018296_738_1514 257
611 3300053093 Ga0500651_0011180 Ga0500651_0011180_3148_3921 257
612 3300053110 Ga0500571_047777 Ga0500571_047777_1140_1916 257
613 3300053118 Ga0500594_0001013 Ga0500594_0001013_275_1048 257
614 3300053120 Ga0500597_092004 Ga0500597_092004_119_892 257
615 3300053121 Ga0500607_009334 Ga0500607_009334_685_1467 257
616 3300053122 Ga0500608_158287 Ga0500608_158287_168_944 257
617 3300053133 Ga0500655_001016 Ga0500655_001016_4299_5075 257
618 3300053134 Ga0500658_0018356 Ga0500658_0018356_255_1028 257
619 3300053136 Ga0500559_0041127 Ga0500559_0041127_243_1016 257
620 3300053138 Ga0500564_049607 Ga0500564_049607_277_1053 257
621 3300053139 Ga0500568_0001792 Ga0500568_0001792_279_1052 257
622 3300053141 Ga0500574_000933 Ga0500574_000933_1445_2218 257
623 3300053153 Ga0500616_0043090 Ga0500616_0043090_1143_1916 257
624 3300053161 Ga0500634_0002199 Ga0500634_0002199_1083_1859 257
625 3300053162 Ga0500638_116713 Ga0500638_116713_405_1181 257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02167

Cytochrom_C1

Cytochrome C1 family

202

263

0.89

PF02167

Cytochrom_C1

Cytochrome C1 family

38

189

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8snh-assembly1.cif.gz_M cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.8605 33 253
8snh-assembly1.cif.gz_M cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.8451 33 253
8snh-assembly1.cif.gz_J cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.8091 33 253
8snh-assembly1.cif.gz_J cytochrome bc1-cbb3 supercomplex from pseudomonas aeruginosa 0.7709 33 253
1bcc-assembly1.cif.gz_D cytochrome bc1 complex from chicken 0.6703 27 256
ID Description Score Start End Superfamily
1m0wB02 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.6652 172 196 3.30.470.20
af_Q9M1G8_208_399_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6589 168 199 3.40.50.880
af_E7FD67_10_179_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6479 172 199 2.130.10.10
af_A0A0R0ISK6_154_264_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6323 169 198 2.130.10.10
af_Q15334_1_278_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6309 171 196 2.130.10.10
ID Description Score Start End GO Terms
AF-C9Y883-F1-model_v4 Cytochrome c1 (EC 1.10.2.2) 0.8927 31 257 GO:0009055
GO:0016020
GO:0016491
GO:0020037
GO:0046872
AF-C9Y883-F1-model_v4 Cytochrome c1 (EC 1.10.2.2) 0.889 31 257 GO:0009055
GO:0016020
GO:0016491
GO:0020037
GO:0046872
AF-A0A432U1E8-F1-model_v4 Cytochrome c1 0.8788 28 256 GO:0009055
GO:0016020
GO:0020037
GO:0046872
AF-A0A7Y4N3I0-F1-model_v4 deleted 0.8741 69 257
AF-A0A7Y4N3I0-F1-model_v4 deleted 0.8699 69 257

Feature Viewer

pLDDT pTM Quality
73.53 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map