F470174

General Info

Members Datasets Scaffolds Average Seq Length
623 328 1246 70

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10001869|Ga0081455_1000186923
Length 83
Sequence MRQGIHPDYVVATVTCSCGNTFQTRSTKGDLRVELCSNCHPFYTGKQKLVDTGGRVERFQRRYAKQQADQAVANQAPVEAEQA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
171 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
183 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
184 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
211 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
212 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
213 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
214 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
215 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
216 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
217 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
251 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
258 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
302 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
316 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
317 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
318 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
319 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
320 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
321 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
322 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
325 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
326 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
327 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.75
Metatranscriptomes 2.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.09
Nodule 0
Rhizoplane 7.22
Rhizosphere 89.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10001869 3300005937 Bacteria 25319
2 JGI24735J21928_10082237 3300002067 Bacteria 923
3 JGI25406J46586_10003092 3300003203 Bacteria 7827
4 Ga0070683_100261187 3300005329 Bacteria 1647
5 Ga0070683_100271140 3300005329 Bacteria 1614
6 Ga0070683_100763389 3300005329 Bacteria 926
7 Ga0070683_102108363 3300005329 Bacteria 541
8 Ga0068869_100525763 3300005334 Bacteria 991
9 Ga0068869_100937746 3300005334 Bacteria 751
10 Ga0068869_101555550 3300005334 Bacteria 588
11 Ga0070680_100005441 3300005336 Bacteria 9636
12 Ga0070680_100114766 3300005336 Bacteria 2244
13 Ga0070680_100450901 3300005336 Bacteria 1099
14 Ga0070680_100644080 3300005336 Bacteria 911
15 Ga0070682_100160270 3300005337 Bacteria 1553
16 Ga0070682_100260153 3300005337 Bacteria 1255
17 Ga0068868_100191255 3300005338 Bacteria 1702
18 Ga0068868_102331732 3300005338 Bacteria 511
19 Ga0070660_100027884 3300005339 Bacteria 4220
20 Ga0070660_100255961 3300005339 Bacteria 1429
21 Ga0070660_101297394 3300005339 Bacteria 618
22 Ga0070689_100158577 3300005340 Bacteria 1828
23 Ga0070689_100605934 3300005340 Bacteria 949
24 Ga0070691_10102956 3300005341 Bacteria 1420
25 Ga0070687_100322152 3300005343 Bacteria 988
26 Ga0070687_100773474 3300005343 Bacteria 678
27 Ga0070661_100154054 3300005344 Bacteria 1738
28 Ga0070692_10006341 3300005345 Bacteria 5134
29 Ga0070692_10092868 3300005345 Bacteria 1643
30 Ga0070669_100507611 3300005353 Bacteria 1001
31 Ga0070669_100520872 3300005353 Bacteria 988
32 Ga0070675_100410791 3300005354 Bacteria 1209
33 Ga0070675_100511582 3300005354 Bacteria 1083
34 Ga0070675_100847320 3300005354 Bacteria 836
35 Ga0070674_100324327 3300005356 Bacteria 1236
36 Ga0070659_100013220 3300005366 Bacteria 6138
37 Ga0070659_100568589 3300005366 Bacteria 972
38 Ga0070659_100739291 3300005366 Bacteria 853
39 Ga0070667_100352328 3300005367 Bacteria 1333
40 Ga0070667_100574146 3300005367 Bacteria 1038
41 Ga0070703_10566494 3300005406 Bacteria 520
42 Ga0070709_10183490 3300005434 Bacteria 1471
43 Ga0070709_10742360 3300005434 Bacteria 766
44 Ga0070714_100044953 3300005435 Bacteria 3740
45 Ga0070714_100073560 3300005435 Bacteria 2961
46 Ga0070713_100060811 3300005436 Bacteria 3159
47 Ga0070713_101546882 3300005436 Bacteria 644
48 Ga0070710_10447839 3300005437 Bacteria 875
49 Ga0070710_10534043 3300005437 Bacteria 808
50 Ga0070701_10916877 3300005438 Bacteria 606
51 Ga0070711_100037552 3300005439 Bacteria 3251
52 Ga0070711_100553732 3300005439 Bacteria 954
53 Ga0070700_100594854 3300005441 Bacteria 866
54 Ga0070700_100717341 3300005441 Bacteria 797
55 Ga0070694_100992168 3300005444 Bacteria 697
56 Ga0070708_100026292 3300005445 Bacteria 4980
57 Ga0070663_101527897 3300005455 Bacteria 594
58 Ga0070662_101724806 3300005457 Bacteria 541
59 Ga0070681_10004093 3300005458 Bacteria 13782
60 Ga0070681_10365233 3300005458 Bacteria 1354
61 Ga0070681_11513026 3300005458 Bacteria 596
62 Ga0068867_100123515 3300005459 Bacteria 2003
63 Ga0068867_101125920 3300005459 Bacteria 718
64 Ga0070685_10267846 3300005466 Bacteria 1139
65 Ga0070685_11416638 3300005466 Bacteria 534
66 Ga0070706_101198272 3300005467 Bacteria 698
67 Ga0074259_11654613 3300005507 Bacteria 514
68 Ga0070679_100007176 3300005530 Bacteria 10405
69 Ga0070679_100057794 3300005530 Bacteria 3866
70 Ga0070679_100278522 3300005530 Bacteria 1625
71 Ga0070684_100009236 3300005535 Bacteria 7761
72 Ga0070684_100215982 3300005535 Bacteria 1749
73 Ga0070684_101498802 3300005535 Bacteria 636
74 Ga0070697_101429151 3300005536 Bacteria 618
75 Ga0068853_100075657 3300005539 Bacteria 2938
76 Ga0068853_100564648 3300005539 Bacteria 1079
77 Ga0070672_101310381 3300005543 Bacteria 647
78 Ga0070672_101463035 3300005543 Bacteria 612
79 Ga0070686_100558069 3300005544 Bacteria 897
80 Ga0070695_100000042 3300005545 Bacteria 48840
81 Ga0070665_100149269 3300005548 Bacteria 2341
82 Ga0070704_101812864 3300005549 Bacteria 565
83 Ga0068855_100206314 3300005563 Bacteria 2211
84 Ga0068855_100354828 3300005563 Bacteria 1615
85 Ga0070664_100192056 3300005564 Bacteria 1819
86 Ga0070664_101149461 3300005564 Bacteria 732
87 Ga0070664_101616572 3300005564 Bacteria 614
88 Ga0070664_102339153 3300005564 Bacteria 507
89 Ga0068857_100032686 3300005577 Bacteria 4600
90 Ga0068854_100025256 3300005578 Bacteria 4076
91 Ga0068854_101283541 3300005578 Bacteria 659
92 Ga0068856_100163831 3300005614 Bacteria 2234
93 Ga0068856_100820307 3300005614 Bacteria 950
94 Ga0068856_102476257 3300005614 Bacteria 526
95 Ga0070702_100368130 3300005615 Bacteria 1018
96 Ga0070702_101073677 3300005615 Bacteria 642
97 Ga0068852_100002400 3300005616 Bacteria 12907
98 Ga0068852_100397068 3300005616 Bacteria 1356
99 Ga0068859_100571874 3300005617 Bacteria 1224
100 Ga0068864_100400786 3300005618 Bacteria 1304
101 Ga0068864_100970494 3300005618 Bacteria 842
102 Ga0068861_100382685 3300005719 Bacteria 1244
103 Ga0068851_10046587 3300005834 Bacteria 2193
104 Ga0068851_10210802 3300005834 Bacteria 1088
105 Ga0068870_10247467 3300005840 Bacteria 1104
106 Ga0068870_10702279 3300005840 Bacteria 698
107 Ga0068863_101598906 3300005841 Bacteria 661
108 Ga0068858_101478778 3300005842 Bacteria 670
109 Ga0068858_102283038 3300005842 Bacteria 535
110 Ga0068860_100774950 3300005843 Bacteria 972
111 Ga0068862_100594218 3300005844 Bacteria 1062
112 Ga0068862_100879443 3300005844 Bacteria 880
113 Ga0068862_101550335 3300005844 Bacteria 669
114 Ga0081455_10080367 3300005937 Bacteria 2673
115 Ga0081538_10031801 3300005981 Bacteria 3551
116 Ga0081538_10038340 3300005981 Bacteria 3093
117 Ga0081540_1031389 3300005983 Bacteria 2921
118 Ga0081539_10001944 3300005985 Bacteria 31666
119 Ga0081539_10448187 3300005985 Bacteria 535
120 Ga0070717_10161922 3300006028 Bacteria 1941
121 Ga0075365_10510618 3300006038 Bacteria 850
122 Ga0075365_10850033 3300006038 Bacteria 644
123 Ga0075365_11305859 3300006038 Bacteria 510
124 Ga0075363_100564136 3300006048 Bacteria 680
125 Ga0075364_10021257 3300006051 Bacteria 4088
126 Ga0075364_10575362 3300006051 Bacteria 770
127 Ga0075432_10111726 3300006058 Bacteria 1019
128 Ga0075432_10435120 3300006058 Bacteria 573
129 Ga0070716_101576498 3300006173 Bacteria 539
130 Ga0070712_100006663 3300006175 Bacteria 7180
131 Ga0097621_100210656 3300006237 Bacteria 1691
132 Ga0075428_100009539 3300006844 Bacteria 10779
133 Ga0075428_100046251 3300006844 Bacteria 4780
134 Ga0075428_100422119 3300006844 Bacteria 1429
135 Ga0075430_100003238 3300006846 Bacteria 13644
136 Ga0075430_100117604 3300006846 Bacteria 2216
137 Ga0075431_100001983 3300006847 Bacteria 19532
138 Ga0075431_100017396 3300006847 Bacteria 7305
139 Ga0075431_100091917 3300006847 Bacteria 3132
140 Ga0075431_101657788 3300006847 Bacteria 597
141 Ga0075434_100936628 3300006871 Bacteria 881
142 Ga0075429_100013710 3300006880 Bacteria 7027
143 Ga0075429_100035063 3300006880 Bacteria 4361
144 Ga0075429_101149992 3300006880 Bacteria 678
145 Ga0075429_101901990 3300006880 Bacteria 516
146 Ga0068865_100176831 3300006881 Bacteria 1641
147 Ga0068865_100981771 3300006881 Bacteria 739
148 Ga0097620_100571882 3300006931 Bacteria 1224
149 Ga0105240_10017196 3300009093 Bacteria 9756
150 Ga0105240_10028283 3300009093 Bacteria 7323
151 Ga0111539_10001722 3300009094 Bacteria 29116
152 Ga0111539_10059684 3300009094 Bacteria 4522
153 Ga0111539_10238208 3300009094 Bacteria 2118
154 Ga0111539_10776036 3300009094 Bacteria 1115
155 Ga0105245_10071991 3300009098 Bacteria 3140
156 Ga0105245_10722774 3300009098 Bacteria 1030
157 Ga0105245_10877018 3300009098 Bacteria 938
158 Ga0105247_10449804 3300009101 Bacteria 928
159 Ga0114129_10003335 3300009147 Bacteria 22558
160 Ga0114129_10052615 3300009147 Bacteria 5715
161 Ga0114129_10079468 3300009147 Bacteria 4561
162 Ga0114129_11171644 3300009147 Bacteria 959
163 Ga0114129_11196340 3300009147 Bacteria 947
164 Ga0105243_10026577 3300009148 Bacteria 4431
165 Ga0105243_10192189 3300009148 Bacteria 1783
166 Ga0105243_10281767 3300009148 Bacteria 1497
167 Ga0105243_10974627 3300009148 Bacteria 849
168 Ga0105241_11046754 3300009174 Bacteria 766
169 Ga0105242_11733285 3300009176 Bacteria 662
170 Ga0105242_11856342 3300009176 Bacteria 642
171 Ga0105242_11973930 3300009176 Bacteria 625
172 Ga0105248_10669521 3300009177 Bacteria 1171
173 Ga0105248_13157631 3300009177 Bacteria 524
174 Ga0105237_10008196 3300009545 Bacteria 11351
175 Ga0105237_10129767 3300009545 Bacteria 2515
176 Ga0105237_10950431 3300009545 Bacteria 866
177 Ga0105237_12000274 3300009545 Bacteria 588
178 Ga0105238_10012459 3300009551 Bacteria 8576
179 Ga0105238_11261518 3300009551 Bacteria 764
180 Ga0105238_11354306 3300009551 Bacteria 738
181 Ga0105238_12348662 3300009551 Bacteria 569
182 Ga0105249_10184495 3300009553 Bacteria 2032
183 Ga0105249_12929034 3300009553 Bacteria 548
184 Ga0105249_13436692 3300009553 Bacteria 510
185 Ga0105239_10412048 3300010375 Bacteria 1530
186 Ga0105239_10999898 3300010375 Bacteria 961
187 Ga0105239_11414466 3300010375 Bacteria 803
188 Ga0105239_12004131 3300010375 Bacteria 672
189 Ga0105239_12306508 3300010375 Bacteria 626
190 Ga0105246_11449009 3300011119 Bacteria 643
191 Ga0105246_11839325 3300011119 Bacteria 580
192 Ga0157373_11251628 3300013100 Bacteria 560
193 Ga0157371_10036675 3300013102 Bacteria 3511
194 Ga0157370_10045892 3300013104 Bacteria 4191
195 Ga0157370_10719345 3300013104 Bacteria 911
196 Ga0157369_10018956 3300013105 Bacteria 7707
197 Ga0157369_10553264 3300013105 Bacteria 1189
198 Ga0157374_12041031 3300013296 Bacteria 600
199 Ga0157374_12381723 3300013296 Bacteria 557
200 Ga0157378_10708161 3300013297 Bacteria 1027
201 Ga0157378_11723484 3300013297 Bacteria 674
202 Ga0163162_11409815 3300013306 Bacteria 793
203 Ga0163162_11844712 3300013306 Bacteria 692
204 Ga0157372_10018348 3300013307 Bacteria 7521
205 Ga0157372_13228819 3300013307 Bacteria 520
206 Ga0157375_12314046 3300013308 Bacteria 641
207 Ga0163163_11555642 3300014325 Bacteria 722
208 Ga0157380_10343298 3300014326 Bacteria 1394
209 Ga0157380_10393016 3300014326 Bacteria 1313
210 Ga0157380_11492685 3300014326 Bacteria 729
211 Ga0157377_10231332 3300014745 Bacteria 1189
212 Ga0157377_10496632 3300014745 Bacteria 852
213 Ga0157379_11686256 3300014968 Bacteria 620
214 Ga0163161_10439105 3300017792 Bacteria 1053
215 Ga0163161_11106705 3300017792 Bacteria 681
216 Ga0197907_10098597 3300020069 Bacteria 598
217 Ga0206356_11289496 3300020070 Bacteria 651
218 Ga0206351_10688490 3300020077 Bacteria 579
219 Ga0206351_10911287 3300020077 Bacteria 705
220 Ga0206352_10164340 3300020078 Bacteria 678
221 Ga0154015_1060446 3300020610 Bacteria 812
222 Ga0224712_10154363 3300022467 Bacteria 1020
223 Ga0224712_10347030 3300022467 Bacteria 701
224 Ga0224712_10459863 3300022467 Bacteria 612
225 Ga0224712_10461317 3300022467 Bacteria 611
226 Ga0224712_10550334 3300022467 Bacteria 561
227 Ga0207692_10129207 3300025898 Bacteria 1424
228 Ga0207692_11191007 3300025898 Bacteria 506
229 Ga0207688_10037028 3300025901 Bacteria 2705
230 Ga0207680_10781160 3300025903 Bacteria 685
231 Ga0207699_10236858 3300025906 Bacteria 1252
232 Ga0207707_10011669 3300025912 Bacteria 7648
233 Ga0207707_10627612 3300025912 Bacteria 907
234 Ga0207707_11608671 3300025912 Bacteria 511
235 Ga0207695_10038965 3300025913 Bacteria 5111
236 Ga0207695_10147488 3300025913 Bacteria 2295
237 Ga0207671_10100450 3300025914 Bacteria 2191
238 Ga0207671_10628104 3300025914 Bacteria 856
239 Ga0207693_10031688 3300025915 Bacteria 4177
240 Ga0207693_10250137 3300025915 Bacteria 1391
241 Ga0207693_11340979 3300025915 Bacteria 534
242 Ga0207663_10080308 3300025916 Bacteria 2132
243 Ga0207663_11400668 3300025916 Bacteria 563
244 Ga0207660_10009615 3300025917 Bacteria 6259
245 Ga0207660_10059372 3300025917 Bacteria 2746
246 Ga0207660_10172993 3300025917 Bacteria 1673
247 Ga0207662_10116212 3300025918 Bacteria 1673
248 Ga0207657_10041538 3300025919 Bacteria 4066
249 Ga0207657_10726746 3300025919 Bacteria 770
250 Ga0207649_10348642 3300025920 Bacteria 1095
251 Ga0207652_10020788 3300025921 Bacteria 5409
252 Ga0207652_10160589 3300025921 Bacteria 2015
253 Ga0207652_10330386 3300025921 Bacteria 1377
254 Ga0207681_10643065 3300025923 Bacteria 879
255 Ga0207694_10263231 3300025924 Bacteria 1413
256 Ga0207694_11041411 3300025924 Bacteria 692
257 Ga0207650_10855205 3300025925 Bacteria 772
258 Ga0207650_11203830 3300025925 Bacteria 645
259 Ga0207659_11554566 3300025926 Bacteria 565
260 Ga0207659_11868377 3300025926 Bacteria 509
261 Ga0207687_10331290 3300025927 Bacteria 1235
262 Ga0207687_10468519 3300025927 Bacteria 1047
263 Ga0207700_10056965 3300025928 Bacteria 2944
264 Ga0207700_10906521 3300025928 Bacteria 789
265 Ga0207664_10010745 3300025929 Bacteria 6477
266 Ga0207664_10035134 3300025929 Bacteria 3865
267 Ga0207690_10047082 3300025932 Bacteria 2859
268 Ga0207690_10123364 3300025932 Bacteria 1885
269 Ga0207690_10423607 3300025932 Bacteria 1065
270 Ga0207706_10041153 3300025933 Bacteria 4097
271 Ga0207686_10899493 3300025934 Bacteria 714
272 Ga0207709_10079313 3300025935 Bacteria 2111
273 Ga0207709_10174517 3300025935 Bacteria 1512
274 Ga0207704_10442328 3300025938 Bacteria 1036
275 Ga0207665_11513528 3300025939 Bacteria 533
276 Ga0207691_10171701 3300025940 Bacteria 1899
277 Ga0207691_10336221 3300025940 Bacteria 1293
278 Ga0207711_11000931 3300025941 Bacteria 775
279 Ga0207689_10536735 3300025942 Bacteria 982
280 Ga0207661_10005176 3300025944 Bacteria 9165
281 Ga0207661_10062725 3300025944 Bacteria 3008
282 Ga0207661_10735639 3300025944 Bacteria 908
283 Ga0207679_10055116 3300025945 Bacteria 2929
284 Ga0207679_10852272 3300025945 Bacteria 832
285 Ga0207679_10947206 3300025945 Bacteria 788
286 Ga0207712_10128777 3300025961 Bacteria 1926
287 Ga0207712_10166984 3300025961 Bacteria 1716
288 Ga0207668_10132553 3300025972 Bacteria 1905
289 Ga0207640_10040722 3300025981 Bacteria 2950
290 Ga0207640_10772833 3300025981 Bacteria 830
291 Ga0207640_11202591 3300025981 Bacteria 674
292 Ga0207658_11071974 3300025986 Bacteria 736
293 Ga0207677_10177510 3300026023 Bacteria 1672
294 Ga0207677_10460557 3300026023 Bacteria 1091
295 Ga0207703_11073422 3300026035 Bacteria 773
296 Ga0207639_10621565 3300026041 Bacteria 997
297 Ga0207678_11446840 3300026067 Bacteria 607
298 Ga0207708_10064590 3300026075 Bacteria 2797
299 Ga0207708_10110745 3300026075 Bacteria 2131
300 Ga0207702_10237000 3300026078 Bacteria 1708
301 Ga0207641_12250084 3300026088 Bacteria 545
302 Ga0207648_10242544 3300026089 Bacteria 1605
303 Ga0207648_10779326 3300026089 Bacteria 889
304 Ga0207676_11779539 3300026095 Bacteria 615
305 Ga0207674_10236361 3300026116 Bacteria 1775
306 Ga0207675_100061000 3300026118 Bacteria 3521
307 Ga0207675_102418679 3300026118 Bacteria 537
308 Ga0207683_10087450 3300026121 Bacteria 2771
309 Ga0207683_10113699 3300026121 Bacteria 2425
310 Ga0207683_11523806 3300026121 Bacteria 617
311 Ga0207698_10017002 3300026142 Bacteria 4923
312 Ga0207698_11802227 3300026142 Bacteria 627
313 Ga0209974_10129985 3300027876 Bacteria 897
314 Ga0207428_10064377 3300027907 Bacteria 2894
315 Ga0207428_10067956 3300027907 Bacteria 2805
316 Ga0207428_10296083 3300027907 Bacteria 1198
317 Ga0268266_10423159 3300028379 Bacteria 1262
318 Ga0268266_10631120 3300028379 Bacteria 1030
319 Ga0268265_10527442 3300028380 Bacteria 1117
320 Ga0268265_10604638 3300028380 Bacteria 1048
321 Ga0307513_10617264 3300031456 Bacteria 793
322 Ga0307408_100053979 3300031548 Bacteria 2905
323 Ga0307408_101202402 3300031548 Bacteria 707
324 Ga0316575_10068481 3300031665 Bacteria 1424
325 Ga0316576_10015053 3300031727 Bacteria 5179
326 Ga0316578_10133245 3300031728 Bacteria 1495
327 Ga0307405_10475139 3300031731 Bacteria 997
328 Ga0307413_10081304 3300031824 Bacteria 2077
329 Ga0307413_10146929 3300031824 Bacteria 1637
330 Ga0307413_10229420 3300031824 Bacteria 1362
331 Ga0307413_10400119 3300031824 Bacteria 1076
332 Ga0307413_10615480 3300031824 Bacteria 891
333 Ga0307413_11074283 3300031824 Bacteria 694
334 Ga0307413_11267005 3300031824 Bacteria 644
335 Ga0307410_10005582 3300031852 Bacteria 6681
336 Ga0307410_10178405 3300031852 Bacteria 1606
337 Ga0307410_10580683 3300031852 Bacteria 932
338 Ga0307410_10658296 3300031852 Bacteria 879
339 Ga0307410_11723344 3300031852 Bacteria 555
340 Ga0307406_10066940 3300031901 Bacteria 2340
341 Ga0307407_10088622 3300031903 Bacteria 1891
342 Ga0307407_10335648 3300031903 Bacteria 1065
343 Ga0307407_10701620 3300031903 Bacteria 762
344 Ga0307409_100001728 3300031995 Bacteria 11014
345 Ga0307409_100024933 3300031995 Bacteria 4183
346 Ga0307409_100031392 3300031995 Bacteria 3833
347 Ga0307409_101168009 3300031995 Bacteria 792
348 Ga0307416_100005034 3300032002 Bacteria 8058
349 Ga0307416_100012905 3300032002 Bacteria 5653
350 Ga0307416_100015303 3300032002 Bacteria 5295
351 Ga0307416_101375799 3300032002 Bacteria 811
352 Ga0307414_10010575 3300032004 Bacteria 5365
353 Ga0307414_10293406 3300032004 Bacteria 1372
354 Ga0307411_10012219 3300032005 Bacteria 4674
355 Ga0307415_100005151 3300032126 Bacteria 6897
356 Ga0307415_100065806 3300032126 Bacteria 2527
357 Ga0307415_100214531 3300032126 Bacteria 1538
358 Ga0307415_101974335 3300032126 Bacteria 568
359 Ga0316585_10099593 3300032137 Bacteria 953
360 Ga0316580_10027565 3300032139 Bacteria 1756
361 Ga0316593_10238984 3300032168 Bacteria 678
362 Ga0316592_1061134 3300033524 Bacteria 846
363 Ga0373926_0017910 3300035083 Bacteria 2433
364 Ga0373936_0023692 3300035113 Bacteria 2394
365 Ga0373960_0192249 3300035121 Bacteria 718
366 Ga0373943_0026447 3300035170 Bacteria 2718
367 Ga0373946_0059699 3300035171 Bacteria 1619
368 Ga0316574_0003381 3300035398 Bacteria 8224
369 Ga0373924_0068704 3300035410 Bacteria 1492
370 Ga0373931_0131392 3300035691 Bacteria 1442
371 Ga0373935_0107101 3300035692 Bacteria 1850
372 Ga0373935_0131058 3300035692 Bacteria 1685
373 Ga0373927_0175467 3300035695 Bacteria 1405
374 Ga0373947_0001839 3300035725 Bacteria 12971
375 Ga0373937_1436309 3300036401 Bacteria 637
376 Ga0316582_0794577 3300036647 Bacteria 648
377 Ga0316584_0190016 3300036712 Bacteria 1518
378 Ga0373925_0369006 3300037068 Bacteria 1168
379 Ga0373925_0579287 3300037068 Bacteria 924
380 Ga0395899_0271096 3300037312 Bacteria 1158
381 Ga0395899_0405763 3300037312 Bacteria 901
382 Ga0395899_0546841 3300037312 Bacteria 745
383 Ga0395898_0446200 3300037466 Bacteria 1232
384 Ga0395905_0756945 3300037471 Bacteria 874
385 Ga0395901_0282556 3300038443 Bacteria 1724
386 Ga0395901_0338597 3300038443 Bacteria 1554
387 Ga0436365_1686534 3300039437 Bacteria 881
388 Ga0436360_0222491 3300039438 Bacteria 2546
389 Ga0436361_0793805 3300039447 Bacteria 533
390 Ga0436363_0494406 3300039450 Bacteria 1397
391 Ga0436362_0224011 3300039453 Bacteria 3218
392 Ga0451845_0448535 3300041501 Bacteria 560
393 Ga0451855_0651508 3300041511 Bacteria 937
394 Ga0451853_2926470 3300041512 Bacteria 697
395 Ga0439448_0071493 3300042005 Bacteria 1156
396 Ga0439448_0239816 3300042005 Bacteria 639
397 Ga0439450_054710 3300042008 Bacteria 954
398 Ga0439455_0270392 3300042012 Bacteria 500
399 Ga0439463_170140 3300042016 Bacteria 565
400 Ga0439463_178214 3300042016 Bacteria 551
401 Ga0450905_012666 3300042142 Bacteria 1189
402 Ga0439460_0083937 3300042461 Bacteria 1003
403 Ga0450916_021223 3300042530 Bacteria 893
404 Ga0451577_0007395 3300042876 Bacteria 10782
405 Ga0466972_0638375 3300044658 Bacteria 504
406 Ga0466963_0001983 3300044694 Bacteria 11234
407 Ga0466963_0006301 3300044694 Bacteria 7014
408 Ga0466963_0110222 3300044694 Bacteria 1889
409 Ga0466963_0146930 3300044694 Bacteria 1636
410 Ga0466963_0866824 3300044694 Bacteria 636
411 Ga0466964_0018933 3300044706 Bacteria 2644
412 Ga0466964_0218333 3300044706 Bacteria 924
413 Ga0453684_0031795 3300044712 Bacteria 7403
414 Ga0466971_0217624 3300044719 Bacteria 904
415 Ga0466957_0068928 3300044842 Bacteria 2184
416 Ga0466957_0105896 3300044842 Bacteria 1778
417 Ga0466957_0141834 3300044842 Bacteria 1548
418 Ga0466957_0881246 3300044842 Bacteria 639
419 Ga0466960_0000134 3300044901 Bacteria 25178
420 Ga0466960_0185220 3300044901 Bacteria 1130
421 Ga0466960_0594628 3300044901 Bacteria 656
422 Ga0466958_0003586 3300045836 Bacteria 8083
423 Ga0466958_0142485 3300045836 Bacteria 1510
424 Ga0466958_0145901 3300045836 Bacteria 1491
425 Ga0466958_0210245 3300045836 Bacteria 1239
426 Ga0466967_0002237 3300045976 Bacteria 11926
427 Ga0466967_0003272 3300045976 Bacteria 10502
428 Ga0466967_0003674 3300045976 Bacteria 10098
429 Ga0466967_0005253 3300045976 Bacteria 8926
430 Ga0466967_0014447 3300045976 Bacteria 6151
431 Ga0466967_0167939 3300045976 Bacteria 2062
432 Ga0466967_0650129 3300045976 Bacteria 1042
433 Ga0466967_2297497 3300045976 Bacteria 535
434 Ga0495627_033454 3300046453 Bacteria 1612
435 Ga0495592_0066337 3300046454 Bacteria 2641
436 Ga0495592_0186191 3300046454 Bacteria 1410
437 Ga0495629_0349869 3300046459 Bacteria 1008
438 Ga0495629_0365742 3300046459 Bacteria 982
439 Ga0495641_0017841 3300046461 Bacteria 3682
440 Ga0495651_0116265 3300046462 Bacteria 1971
441 Ga0495651_0193026 3300046462 Bacteria 1431
442 Ga0495653_0211270 3300046463 Bacteria 1310
443 Ga0495653_0359389 3300046463 Bacteria 935
444 Ga0495582_0113670 3300046473 Bacteria 1521
445 Ga0495582_0279245 3300046473 Bacteria 959
446 Ga0495639_0000851 3300046475 Bacteria 13866
447 Ga0495639_0214923 3300046475 Bacteria 944
448 Ga0495639_0280866 3300046475 Bacteria 827
449 Ga0495662_0007031 3300046476 Bacteria 5589
450 Ga0495662_0016008 3300046476 Bacteria 3638
451 Ga0495664_0123457 3300046477 Bacteria 1566
452 Ga0495664_0192979 3300046477 Bacteria 1234
453 Ga0495664_0777369 3300046477 Bacteria 563
454 Ga0495594_0107600 3300046499 Bacteria 1571
455 Ga0495594_0120931 3300046499 Bacteria 1480
456 Ga0495596_0126362 3300046500 Bacteria 993
457 Ga0495618_0294383 3300046514 Bacteria 1009
458 Ga0495618_0613168 3300046514 Bacteria 646
459 Ga0495628_0257092 3300046516 Bacteria 1302
460 Ga0495628_0378943 3300046516 Bacteria 1036
461 Ga0495630_0043776 3300046517 Bacteria 3345
462 Ga0495630_0071584 3300046517 Bacteria 2609
463 Ga0495630_0093679 3300046517 Bacteria 2270
464 Ga0495630_0674816 3300046517 Bacteria 791
465 Ga0495631_0475996 3300046518 Bacteria 532
466 Ga0495644_0283060 3300046523 Bacteria 647
467 Ga0495666_0000713 3300046526 Bacteria 15149
468 Ga0495652_0043411 3300046529 Bacteria 3872
469 Ga0495652_0388815 3300046529 Bacteria 990
470 Ga0495640_0020894 3300046533 Bacteria 4812
471 Ga0495586_0044832 3300046535 Bacteria 2382
472 Ga0495586_0147355 3300046535 Bacteria 1323
473 Ga0495586_0533343 3300046535 Bacteria 677
474 Ga0495587_0255197 3300046536 Bacteria 985
475 Ga0495609_0166907 3300046538 Bacteria 931
476 Ga0495645_0115385 3300046543 Bacteria 1897
477 Ga0495645_0245072 3300046543 Bacteria 1194
478 Ga0495645_0286887 3300046543 Bacteria 1080
479 Ga0495667_0142381 3300046559 Bacteria 1545
480 Ga0495667_0821142 3300046559 Bacteria 573
481 Ga0495634_0243747 3300046642 Bacteria 1101
482 Ga0495635_0023487 3300046663 Bacteria 4296
483 Ga0495599_0254330 3300046678 Bacteria 1068
484 Ga0495599_0543977 3300046678 Bacteria 680
485 Ga0495623_0233344 3300046679 Bacteria 1042
486 Ga0495646_0143307 3300046680 Bacteria 1334
487 Ga0495646_0356536 3300046680 Bacteria 765
488 Ga0495647_0001760 3300046681 Bacteria 6711
489 Ga0495658_0000553 3300046683 Bacteria 20442
490 Ga0495658_0374502 3300046683 Bacteria 906
491 Ga0495613_0132226 3300046689 Bacteria 1786
492 Ga0495624_0023632 3300046690 Bacteria 4051
493 Ga0495624_0177918 3300046690 Bacteria 1297
494 Ga0495624_0220025 3300046690 Bacteria 1151
495 Ga0495670_0387306 3300046691 Bacteria 755
496 Ga0495589_0537673 3300046794 Bacteria 533
497 Ga0495600_0124274 3300046809 Bacteria 1678
498 Ga0495581_0001024 3300047315 Bacteria 15118
499 Ga0495604_0073224 3300047317 Bacteria 2586
500 Ga0495674_0018272 3300047319 Bacteria 6528
501 Ga0495674_0046195 3300047319 Bacteria 3865
502 Ga0495674_0502671 3300047319 Bacteria 969
503 Ga0495676_0015498 3300047321 Bacteria 6786
504 Ga0495676_0022008 3300047321 Bacteria 5555
505 Ga0495680_0054146 3300047322 Bacteria 3117
506 Ga0495675_0560953 3300047444 Bacteria 650
507 Ga0495684_0128314 3300047471 Bacteria 1906
508 Ga0495684_0291910 3300047471 Bacteria 1173
509 Ga0495684_0711939 3300047471 Bacteria 664
510 Ga0495593_0001730 3300047673 Bacteria 12934
511 Ga0495602_0185061 3300048088 Bacteria 1602
512 Ga0495614_0025792 3300048089 Bacteria 2534
513 Ga0496100_0057141 3300048903 Bacteria 2555
514 Ga0496100_0255341 3300048903 Bacteria 1298
515 Ga0496101_0001072 3300048904 Bacteria 16205
516 Ga0496101_0413888 3300048904 Bacteria 1062
517 Ga0496101_0854112 3300048904 Bacteria 717
518 Ga0496102_0014571 3300048905 Bacteria 6833
519 Ga0496102_0481950 3300048905 Bacteria 1162
520 Ga0496102_0526396 3300048905 Bacteria 1105
521 Ga0496103_0016541 3300048906 Bacteria 4402
522 Ga0496104_0060139 3300048907 Bacteria 3599
523 Ga0496104_0124937 3300048907 Bacteria 2470
524 Ga0496104_0474132 3300048907 Bacteria 1163
525 Ga0496104_1073820 3300048907 Bacteria 709
526 Ga0496105_0023599 3300048908 Bacteria 4991
527 Ga0496105_1302501 3300048908 Bacteria 530
528 Ga0496105_1349111 3300048908 Bacteria 519
529 Ga0496106_0001527 3300048909 Bacteria 17401
530 Ga0496106_1234302 3300048909 Bacteria 582
531 Ga0496106_1322804 3300048909 Bacteria 559
532 Ga0496107_0000195 3300048910 Bacteria 31680
533 Ga0496108_0056396 3300048911 Bacteria 3301
534 Ga0496108_0113306 3300048911 Bacteria 2321
535 Ga0496108_0966430 3300048911 Bacteria 729
536 Ga0496109_0114223 3300048912 Bacteria 2512
537 Ga0496109_0841991 3300048912 Bacteria 855
538 Ga0496109_0958831 3300048912 Bacteria 793
539 Ga0496109_1638785 3300048912 Bacteria 577
540 Ga0496110_0167335 3300048913 Bacteria 1994
541 Ga0496110_0167652 3300048913 Bacteria 1992
542 Ga0496110_0364152 3300048913 Bacteria 1317
543 Ga0496110_0442420 3300048913 Bacteria 1185
544 Ga0496110_0662948 3300048913 Bacteria 944
545 Ga0496110_1216242 3300048913 Bacteria 662
546 Ga0496110_1216548 3300048913 Bacteria 662
547 Ga0496110_1625820 3300048913 Bacteria 556
548 Ga0496111_0158881 3300048914 Bacteria 1678
549 Ga0496111_0448322 3300048914 Bacteria 952
550 Ga0496111_0521329 3300048914 Bacteria 874
551 Ga0496112_0004469 3300048915 Bacteria 11856
552 Ga0496112_0517131 3300048915 Bacteria 1128
553 Ga0496113_0282137 3300048916 Bacteria 1328
554 Ga0496113_0534166 3300048916 Bacteria 941
555 Ga0496114_0012858 3300048917 Bacteria 6705
556 Ga0496114_0676878 3300048917 Bacteria 906
557 Ga0496115_0005252 3300048918 Bacteria 9414
558 Ga0501031_1000495 3300049568 Bacteria 534
559 Ga0501034_0000497 3300049571 Bacteria 63778
560 Ga0501034_0018616 3300049571 Bacteria 7119
561 Ga0501034_0064428 3300049571 Bacteria 3679
562 Ga0501036_0867340 3300049572 Bacteria 742
563 Ga0501037_0655877 3300049573 Bacteria 701
564 Ga0501038_0250522 3300049574 Bacteria 1403
565 Ga0501040_0049257 3300049576 Bacteria 2880
566 Ga0501042_0010955 3300049578 Bacteria 6104
567 Ga0501048_0368283 3300049582 Bacteria 1025
568 Ga0501067_0000079 3300049583 Bacteria 56004
569 Ga0501067_0045197 3300049583 Bacteria 2446
570 Ga0501067_0052084 3300049583 Bacteria 2268
571 Ga0501067_0159140 3300049583 Bacteria 1258
572 Ga0501067_0295749 3300049583 Bacteria 901
573 Ga0501068_0000017 3300049584 Bacteria 59930
574 Ga0501068_0571994 3300049584 Bacteria 735
575 Ga0501069_0000037 3300049585 Bacteria 85354
576 Ga0501069_0101674 3300049585 Bacteria 1632
577 Ga0501070_0225556 3300049586 Bacteria 1536
578 Ga0501070_0425390 3300049586 Bacteria 1072
579 Ga0501071_0005022 3300049587 Bacteria 8458
580 Ga0501071_0451739 3300049587 Bacteria 984
581 Ga0501074_0589700 3300049590 Bacteria 786
582 Ga0501075_0274042 3300049591 Bacteria 1286
583 Ga0501075_0941573 3300049591 Bacteria 656
584 Ga0501202_007148 3300049652 Bacteria 2013
585 Ga0501081_1037393 3300049743 Bacteria 620
586 Ga0501271_013746 3300049768 Bacteria 890
587 Ga0501045_0042923 3300049824 Bacteria 3292
588 nmdc:mga00v17_15852_c1 3300050491 Bacteria 1269
589 nmdc:mga0yw44_1211286_c1 3300050492 Bacteria 509
590 nmdc:mga0yw44_13173_c1 3300050492 Bacteria 4344
591 nmdc:mga05p37_1794_c1 3300050507 Bacteria 25059
592 nmdc:mga05p37_236417_c1 3300050507 Bacteria 2199
593 nmdc:mga05p37_4742_c1 3300050507 Bacteria 15887
594 nmdc:mga09592_381_c1 3300050508 Bacteria 32515
595 nmdc:mga09592_46065_c1 3300050508 Bacteria 3674
596 nmdc:mga09592_547536_c1 3300050508 Bacteria 994
597 nmdc:mga09592_559309_c1 3300050508 Bacteria 982
598 nmdc:mga0qj67_6487_c1 3300050509 Bacteria 8598
599 nmdc:mga0qj67_90378_c1 3300050509 Bacteria 2460
600 nmdc:mga06r32_21545_c1 3300050510 Bacteria 5950
601 nmdc:mga06r32_5928_c1 3300050510 Bacteria 10997
602 nmdc:mga06r32_80717_c1 3300050510 Bacteria 3166
603 nmdc:mga08y16_102930_c1 3300050511 Bacteria 2973
604 nmdc:mga08y16_2126518_c1 3300050511 Bacteria 509
605 nmdc:mga08y16_233686_c1 3300050511 Bacteria 1901
606 nmdc:mga08y16_70077_c1 3300050511 Bacteria 3655
607 nmdc:mga0n895_1049706_c1 3300050512 Bacteria 794
608 nmdc:mga08x19_206342_c1 3300050514 Bacteria 1348
609 nmdc:mga08x19_783856_c1 3300050514 Bacteria 677
610 Ga0495601_0047822 3300053077 Bacteria 2693
611 Ga0495601_0069956 3300053077 Bacteria 2239
612 Ga0495601_0103012 3300053077 Bacteria 1844
613 Ga0495612_0043544 3300053078 Bacteria 1834
614 Ga0495612_0100474 3300053078 Bacteria 1231
615 Ga0495612_0315987 3300053078 Bacteria 702
616 Ga0495619_0311305 3300053085 Bacteria 1090
617 Ga0500566_0102077 3300053094 Bacteria 1571
618 Ga0500616_0001661 3300053153 Bacteria 20563
619 Ga0500616_0004678 3300053153 Bacteria 9648
620 Ga0500657_168959 3300053728 Bacteria 779
621 Ga0587083_0079063 3300059505 Bacteria 780
622 Ga0530510_0023958 3300061734 Bacteria 4353
623 Ga0530510_0538371 3300061734 Bacteria 886
624 Ga0081455_10001869
625 JGI24735J21928_10082237
626 JGI25406J46586_10003092
627 Ga0070683_100261187
628 Ga0070683_100271140
629 Ga0070683_100763389
630 Ga0070683_102108363
631 Ga0068869_100525763
632 Ga0068869_100937746
633 Ga0068869_101555550
634 Ga0070680_100005441
635 Ga0070680_100114766
636 Ga0070680_100450901
637 Ga0070680_100644080
638 Ga0070682_100160270
639 Ga0070682_100260153
640 Ga0068868_100191255
641 Ga0068868_102331732
642 Ga0070660_100027884
643 Ga0070660_100255961
644 Ga0070660_101297394
645 Ga0070689_100158577
646 Ga0070689_100605934
647 Ga0070691_10102956
648 Ga0070687_100322152
649 Ga0070687_100773474
650 Ga0070661_100154054
651 Ga0070692_10006341
652 Ga0070692_10092868
653 Ga0070669_100507611
654 Ga0070669_100520872
655 Ga0070675_100410791
656 Ga0070675_100511582
657 Ga0070675_100847320
658 Ga0070674_100324327
659 Ga0070659_100013220
660 Ga0070659_100568589
661 Ga0070659_100739291
662 Ga0070667_100352328
663 Ga0070667_100574146
664 Ga0070703_10566494
665 Ga0070709_10183490
666 Ga0070709_10742360
667 Ga0070714_100044953
668 Ga0070714_100073560
669 Ga0070713_100060811
670 Ga0070713_101546882
671 Ga0070710_10447839
672 Ga0070710_10534043
673 Ga0070701_10916877
674 Ga0070711_100037552
675 Ga0070711_100553732
676 Ga0070700_100594854
677 Ga0070700_100717341
678 Ga0070694_100992168
679 Ga0070708_100026292
680 Ga0070663_101527897
681 Ga0070662_101724806
682 Ga0070681_10004093
683 Ga0070681_10365233
684 Ga0070681_11513026
685 Ga0068867_100123515
686 Ga0068867_101125920
687 Ga0070685_10267846
688 Ga0070685_11416638
689 Ga0070706_101198272
690 Ga0074259_11654613
691 Ga0070679_100007176
692 Ga0070679_100057794
693 Ga0070679_100278522
694 Ga0070684_100009236
695 Ga0070684_100215982
696 Ga0070684_101498802
697 Ga0070697_101429151
698 Ga0068853_100075657
699 Ga0068853_100564648
700 Ga0070672_101310381
701 Ga0070672_101463035
702 Ga0070686_100558069
703 Ga0070695_100000042
704 Ga0070665_100149269
705 Ga0070704_101812864
706 Ga0068855_100206314
707 Ga0068855_100354828
708 Ga0070664_100192056
709 Ga0070664_101149461
710 Ga0070664_101616572
711 Ga0070664_102339153
712 Ga0068857_100032686
713 Ga0068854_100025256
714 Ga0068854_101283541
715 Ga0068856_100163831
716 Ga0068856_100820307
717 Ga0068856_102476257
718 Ga0070702_100368130
719 Ga0070702_101073677
720 Ga0068852_100002400
721 Ga0068852_100397068
722 Ga0068859_100571874
723 Ga0068864_100400786
724 Ga0068864_100970494
725 Ga0068861_100382685
726 Ga0068851_10046587
727 Ga0068851_10210802
728 Ga0068870_10247467
729 Ga0068870_10702279
730 Ga0068863_101598906
731 Ga0068858_101478778
732 Ga0068858_102283038
733 Ga0068860_100774950
734 Ga0068862_100594218
735 Ga0068862_100879443
736 Ga0068862_101550335
737 Ga0081455_10080367
738 Ga0081538_10031801
739 Ga0081538_10038340
740 Ga0081540_1031389
741 Ga0081539_10001944
742 Ga0081539_10448187
743 Ga0070717_10161922
744 Ga0075365_10510618
745 Ga0075365_10850033
746 Ga0075365_11305859
747 Ga0075363_100564136
748 Ga0075364_10021257
749 Ga0075364_10575362
750 Ga0075432_10111726
751 Ga0075432_10435120
752 Ga0070716_101576498
753 Ga0070712_100006663
754 Ga0097621_100210656
755 Ga0075428_100009539
756 Ga0075428_100046251
757 Ga0075428_100422119
758 Ga0075430_100003238
759 Ga0075430_100117604
760 Ga0075431_100001983
761 Ga0075431_100017396
762 Ga0075431_100091917
763 Ga0075431_101657788
764 Ga0075434_100936628
765 Ga0075429_100013710
766 Ga0075429_100035063
767 Ga0075429_101149992
768 Ga0075429_101901990
769 Ga0068865_100176831
770 Ga0068865_100981771
771 Ga0097620_100571882
772 Ga0105240_10017196
773 Ga0105240_10028283
774 Ga0111539_10001722
775 Ga0111539_10059684
776 Ga0111539_10238208
777 Ga0111539_10776036
778 Ga0105245_10071991
779 Ga0105245_10722774
780 Ga0105245_10877018
781 Ga0105247_10449804
782 Ga0114129_10003335
783 Ga0114129_10052615
784 Ga0114129_10079468
785 Ga0114129_11171644
786 Ga0114129_11196340
787 Ga0105243_10026577
788 Ga0105243_10192189
789 Ga0105243_10281767
790 Ga0105243_10974627
791 Ga0105241_11046754
792 Ga0105242_11733285
793 Ga0105242_11856342
794 Ga0105242_11973930
795 Ga0105248_10669521
796 Ga0105248_13157631
797 Ga0105237_10008196
798 Ga0105237_10129767
799 Ga0105237_10950431
800 Ga0105237_12000274
801 Ga0105238_10012459
802 Ga0105238_11261518
803 Ga0105238_11354306
804 Ga0105238_12348662
805 Ga0105249_10184495
806 Ga0105249_12929034
807 Ga0105249_13436692
808 Ga0105239_10412048
809 Ga0105239_10999898
810 Ga0105239_11414466
811 Ga0105239_12004131
812 Ga0105239_12306508
813 Ga0105246_11449009
814 Ga0105246_11839325
815 Ga0157373_11251628
816 Ga0157371_10036675
817 Ga0157370_10045892
818 Ga0157370_10719345
819 Ga0157369_10018956
820 Ga0157369_10553264
821 Ga0157374_12041031
822 Ga0157374_12381723
823 Ga0157378_10708161
824 Ga0157378_11723484
825 Ga0163162_11409815
826 Ga0163162_11844712
827 Ga0157372_10018348
828 Ga0157372_13228819
829 Ga0157375_12314046
830 Ga0163163_11555642
831 Ga0157380_10343298
832 Ga0157380_10393016
833 Ga0157380_11492685
834 Ga0157377_10231332
835 Ga0157377_10496632
836 Ga0157379_11686256
837 Ga0163161_10439105
838 Ga0163161_11106705
839 Ga0197907_10098597
840 Ga0206356_11289496
841 Ga0206351_10688490
842 Ga0206351_10911287
843 Ga0206352_10164340
844 Ga0154015_1060446
845 Ga0224712_10154363
846 Ga0224712_10347030
847 Ga0224712_10459863
848 Ga0224712_10461317
849 Ga0224712_10550334
850 Ga0207692_10129207
851 Ga0207692_11191007
852 Ga0207688_10037028
853 Ga0207680_10781160
854 Ga0207699_10236858
855 Ga0207707_10011669
856 Ga0207707_10627612
857 Ga0207707_11608671
858 Ga0207695_10038965
859 Ga0207695_10147488
860 Ga0207671_10100450
861 Ga0207671_10628104
862 Ga0207693_10031688
863 Ga0207693_10250137
864 Ga0207693_11340979
865 Ga0207663_10080308
866 Ga0207663_11400668
867 Ga0207660_10009615
868 Ga0207660_10059372
869 Ga0207660_10172993
870 Ga0207662_10116212
871 Ga0207657_10041538
872 Ga0207657_10726746
873 Ga0207649_10348642
874 Ga0207652_10020788
875 Ga0207652_10160589
876 Ga0207652_10330386
877 Ga0207681_10643065
878 Ga0207694_10263231
879 Ga0207694_11041411
880 Ga0207650_10855205
881 Ga0207650_11203830
882 Ga0207659_11554566
883 Ga0207659_11868377
884 Ga0207687_10331290
885 Ga0207687_10468519
886 Ga0207700_10056965
887 Ga0207700_10906521
888 Ga0207664_10010745
889 Ga0207664_10035134
890 Ga0207690_10047082
891 Ga0207690_10123364
892 Ga0207690_10423607
893 Ga0207706_10041153
894 Ga0207686_10899493
895 Ga0207709_10079313
896 Ga0207709_10174517
897 Ga0207704_10442328
898 Ga0207665_11513528
899 Ga0207691_10171701
900 Ga0207691_10336221
901 Ga0207711_11000931
902 Ga0207689_10536735
903 Ga0207661_10005176
904 Ga0207661_10062725
905 Ga0207661_10735639
906 Ga0207679_10055116
907 Ga0207679_10852272
908 Ga0207679_10947206
909 Ga0207712_10128777
910 Ga0207712_10166984
911 Ga0207668_10132553
912 Ga0207640_10040722
913 Ga0207640_10772833
914 Ga0207640_11202591
915 Ga0207658_11071974
916 Ga0207677_10177510
917 Ga0207677_10460557
918 Ga0207703_11073422
919 Ga0207639_10621565
920 Ga0207678_11446840
921 Ga0207708_10064590
922 Ga0207708_10110745
923 Ga0207702_10237000
924 Ga0207641_12250084
925 Ga0207648_10242544
926 Ga0207648_10779326
927 Ga0207676_11779539
928 Ga0207674_10236361
929 Ga0207675_100061000
930 Ga0207675_102418679
931 Ga0207683_10087450
932 Ga0207683_10113699
933 Ga0207683_11523806
934 Ga0207698_10017002
935 Ga0207698_11802227
936 Ga0209974_10129985
937 Ga0207428_10064377
938 Ga0207428_10067956
939 Ga0207428_10296083
940 Ga0268266_10423159
941 Ga0268266_10631120
942 Ga0268265_10527442
943 Ga0268265_10604638
944 Ga0307513_10617264
945 Ga0307408_100053979
946 Ga0307408_101202402
947 Ga0316575_10068481
948 Ga0316576_10015053
949 Ga0316578_10133245
950 Ga0307405_10475139
951 Ga0307413_10081304
952 Ga0307413_10146929
953 Ga0307413_10229420
954 Ga0307413_10400119
955 Ga0307413_10615480
956 Ga0307413_11074283
957 Ga0307413_11267005
958 Ga0307410_10005582
959 Ga0307410_10178405
960 Ga0307410_10580683
961 Ga0307410_10658296
962 Ga0307410_11723344
963 Ga0307406_10066940
964 Ga0307407_10088622
965 Ga0307407_10335648
966 Ga0307407_10701620
967 Ga0307409_100001728
968 Ga0307409_100024933
969 Ga0307409_100031392
970 Ga0307409_101168009
971 Ga0307416_100005034
972 Ga0307416_100012905
973 Ga0307416_100015303
974 Ga0307416_101375799
975 Ga0307414_10010575
976 Ga0307414_10293406
977 Ga0307411_10012219
978 Ga0307415_100005151
979 Ga0307415_100065806
980 Ga0307415_100214531
981 Ga0307415_101974335
982 Ga0316585_10099593
983 Ga0316580_10027565
984 Ga0316593_10238984
985 Ga0316592_1061134
986 Ga0373926_0017910
987 Ga0373936_0023692
988 Ga0373960_0192249
989 Ga0373943_0026447
990 Ga0373946_0059699
991 Ga0316574_0003381
992 Ga0373924_0068704
993 Ga0373931_0131392
994 Ga0373935_0107101
995 Ga0373935_0131058
996 Ga0373927_0175467
997 Ga0373947_0001839
998 Ga0373937_1436309
999 Ga0316582_0794577
1000 Ga0316584_0190016
1001 Ga0373925_0369006
1002 Ga0373925_0579287
1003 Ga0395899_0271096
1004 Ga0395899_0405763
1005 Ga0395899_0546841
1006 Ga0395898_0446200
1007 Ga0395905_0756945
1008 Ga0395901_0282556
1009 Ga0395901_0338597
1010 Ga0436365_1686534
1011 Ga0436360_0222491
1012 Ga0436361_0793805
1013 Ga0436363_0494406
1014 Ga0436362_0224011
1015 Ga0451845_0448535
1016 Ga0451855_0651508
1017 Ga0451853_2926470
1018 Ga0439448_0071493
1019 Ga0439448_0239816
1020 Ga0439450_054710
1021 Ga0439455_0270392
1022 Ga0439463_170140
1023 Ga0439463_178214
1024 Ga0450905_012666
1025 Ga0439460_0083937
1026 Ga0450916_021223
1027 Ga0451577_0007395
1028 Ga0466972_0638375
1029 Ga0466963_0001983
1030 Ga0466963_0006301
1031 Ga0466963_0110222
1032 Ga0466963_0146930
1033 Ga0466963_0866824
1034 Ga0466964_0018933
1035 Ga0466964_0218333
1036 Ga0453684_0031795
1037 Ga0466971_0217624
1038 Ga0466957_0068928
1039 Ga0466957_0105896
1040 Ga0466957_0141834
1041 Ga0466957_0881246
1042 Ga0466960_0000134
1043 Ga0466960_0185220
1044 Ga0466960_0594628
1045 Ga0466958_0003586
1046 Ga0466958_0142485
1047 Ga0466958_0145901
1048 Ga0466958_0210245
1049 Ga0466967_0002237
1050 Ga0466967_0003272
1051 Ga0466967_0003674
1052 Ga0466967_0005253
1053 Ga0466967_0014447
1054 Ga0466967_0167939
1055 Ga0466967_0650129
1056 Ga0466967_2297497
1057 Ga0495627_033454
1058 Ga0495592_0066337
1059 Ga0495592_0186191
1060 Ga0495629_0349869
1061 Ga0495629_0365742
1062 Ga0495641_0017841
1063 Ga0495651_0116265
1064 Ga0495651_0193026
1065 Ga0495653_0211270
1066 Ga0495653_0359389
1067 Ga0495582_0113670
1068 Ga0495582_0279245
1069 Ga0495639_0000851
1070 Ga0495639_0214923
1071 Ga0495639_0280866
1072 Ga0495662_0007031
1073 Ga0495662_0016008
1074 Ga0495664_0123457
1075 Ga0495664_0192979
1076 Ga0495664_0777369
1077 Ga0495594_0107600
1078 Ga0495594_0120931
1079 Ga0495596_0126362
1080 Ga0495618_0294383
1081 Ga0495618_0613168
1082 Ga0495628_0257092
1083 Ga0495628_0378943
1084 Ga0495630_0043776
1085 Ga0495630_0071584
1086 Ga0495630_0093679
1087 Ga0495630_0674816
1088 Ga0495631_0475996
1089 Ga0495644_0283060
1090 Ga0495666_0000713
1091 Ga0495652_0043411
1092 Ga0495652_0388815
1093 Ga0495640_0020894
1094 Ga0495586_0044832
1095 Ga0495586_0147355
1096 Ga0495586_0533343
1097 Ga0495587_0255197
1098 Ga0495609_0166907
1099 Ga0495645_0115385
1100 Ga0495645_0245072
1101 Ga0495645_0286887
1102 Ga0495667_0142381
1103 Ga0495667_0821142
1104 Ga0495634_0243747
1105 Ga0495635_0023487
1106 Ga0495599_0254330
1107 Ga0495599_0543977
1108 Ga0495623_0233344
1109 Ga0495646_0143307
1110 Ga0495646_0356536
1111 Ga0495647_0001760
1112 Ga0495658_0000553
1113 Ga0495658_0374502
1114 Ga0495613_0132226
1115 Ga0495624_0023632
1116 Ga0495624_0177918
1117 Ga0495624_0220025
1118 Ga0495670_0387306
1119 Ga0495589_0537673
1120 Ga0495600_0124274
1121 Ga0495581_0001024
1122 Ga0495604_0073224
1123 Ga0495674_0018272
1124 Ga0495674_0046195
1125 Ga0495674_0502671
1126 Ga0495676_0015498
1127 Ga0495676_0022008
1128 Ga0495680_0054146
1129 Ga0495675_0560953
1130 Ga0495684_0128314
1131 Ga0495684_0291910
1132 Ga0495684_0711939
1133 Ga0495593_0001730
1134 Ga0495602_0185061
1135 Ga0495614_0025792
1136 Ga0496100_0057141
1137 Ga0496100_0255341
1138 Ga0496101_0001072
1139 Ga0496101_0413888
1140 Ga0496101_0854112
1141 Ga0496102_0014571
1142 Ga0496102_0481950
1143 Ga0496102_0526396
1144 Ga0496103_0016541
1145 Ga0496104_0060139
1146 Ga0496104_0124937
1147 Ga0496104_0474132
1148 Ga0496104_1073820
1149 Ga0496105_0023599
1150 Ga0496105_1302501
1151 Ga0496105_1349111
1152 Ga0496106_0001527
1153 Ga0496106_1234302
1154 Ga0496106_1322804
1155 Ga0496107_0000195
1156 Ga0496108_0056396
1157 Ga0496108_0113306
1158 Ga0496108_0966430
1159 Ga0496109_0114223
1160 Ga0496109_0841991
1161 Ga0496109_0958831
1162 Ga0496109_1638785
1163 Ga0496110_0167335
1164 Ga0496110_0167652
1165 Ga0496110_0364152
1166 Ga0496110_0442420
1167 Ga0496110_0662948
1168 Ga0496110_1216242
1169 Ga0496110_1216548
1170 Ga0496110_1625820
1171 Ga0496111_0158881
1172 Ga0496111_0448322
1173 Ga0496111_0521329
1174 Ga0496112_0004469
1175 Ga0496112_0517131
1176 Ga0496113_0282137
1177 Ga0496113_0534166
1178 Ga0496114_0012858
1179 Ga0496114_0676878
1180 Ga0496115_0005252
1181 Ga0501031_1000495
1182 Ga0501034_0000497
1183 Ga0501034_0018616
1184 Ga0501034_0064428
1185 Ga0501036_0867340
1186 Ga0501037_0655877
1187 Ga0501038_0250522
1188 Ga0501040_0049257
1189 Ga0501042_0010955
1190 Ga0501048_0368283
1191 Ga0501067_0000079
1192 Ga0501067_0045197
1193 Ga0501067_0052084
1194 Ga0501067_0159140
1195 Ga0501067_0295749
1196 Ga0501068_0000017
1197 Ga0501068_0571994
1198 Ga0501069_0000037
1199 Ga0501069_0101674
1200 Ga0501070_0225556
1201 Ga0501070_0425390
1202 Ga0501071_0005022
1203 Ga0501071_0451739
1204 Ga0501074_0589700
1205 Ga0501075_0274042
1206 Ga0501075_0941573
1207 Ga0501202_007148
1208 Ga0501081_1037393
1209 Ga0501271_013746
1210 Ga0501045_0042923
1211 nmdc:mga00v17_15852_c1
1212 nmdc:mga0yw44_1211286_c1
1213 nmdc:mga0yw44_13173_c1
1214 nmdc:mga05p37_1794_c1
1215 nmdc:mga05p37_236417_c1
1216 nmdc:mga05p37_4742_c1
1217 nmdc:mga09592_381_c1
1218 nmdc:mga09592_46065_c1
1219 nmdc:mga09592_547536_c1
1220 nmdc:mga09592_559309_c1
1221 nmdc:mga0qj67_6487_c1
1222 nmdc:mga0qj67_90378_c1
1223 nmdc:mga06r32_21545_c1
1224 nmdc:mga06r32_5928_c1
1225 nmdc:mga06r32_80717_c1
1226 nmdc:mga08y16_102930_c1
1227 nmdc:mga08y16_2126518_c1
1228 nmdc:mga08y16_233686_c1
1229 nmdc:mga08y16_70077_c1
1230 nmdc:mga0n895_1049706_c1
1231 nmdc:mga08x19_206342_c1
1232 nmdc:mga08x19_783856_c1
1233 Ga0495601_0047822
1234 Ga0495601_0069956
1235 Ga0495601_0103012
1236 Ga0495612_0043544
1237 Ga0495612_0100474
1238 Ga0495612_0315987
1239 Ga0495619_0311305
1240 Ga0500566_0102077
1241 Ga0500616_0001661
1242 Ga0500616_0004678
1243 Ga0500657_168959
1244 Ga0587083_0079063
1245 Ga0530510_0023958
1246 Ga0530510_0538371

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01197

Ribosomal_L31

Ribosomal protein L31

1

64

0.99

Map