F469445

General Info

Members Datasets Scaffolds Average Seq Length
615 419 1230 219

Family's Representative Sequence

Representative Sequence 3300025304|Ga0209257_1000237|Ga0209257_1000237120
Length 242
Sequence MLVKAFFHKENPDPPDRLESAPMAYLDFVSSLHNSTKRDYRQRVLDYDKAECAIVAKQYGKDYWDGDRRYGYGGYRYDGRWFPVAEKIAKHYGLKPGQRVLDIGCGKGYLLHELTRAVPGIEIAGIDISRYAIENAKEEVRPFLQVGSADKLPFPNKHFDLVVSLTTFHNLKIDALFAALAEAERVGRGGKYIMIESYRNEREKVNLLYWQLTCESFYSPEEWQWLMTKAGYTGDYGCIYFE

Samples

Sample ID Description Type Environment
1 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
94 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
95 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
96 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
153 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
162 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
163 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
164 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
165 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
169 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
204 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
205 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
206 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
207 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
229 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
232 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
273 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
283 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
294 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
300 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
301 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
302 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
305 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
306 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
307 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
308 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
309 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
310 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
314 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
315 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
321 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
322 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
323 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
324 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
325 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
326 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
327 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
328 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
329 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
330 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
331 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
332 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
333 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
334 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
335 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
336 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
337 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
338 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
339 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
340 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
341 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
342 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
343 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
344 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
345 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
346 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
347 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
348 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
349 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
350 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
351 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
352 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
353 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
354 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
355 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
356 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
357 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
358 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
359 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
360 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
361 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
362 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
363 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
364 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
365 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
366 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
367 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
368 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
369 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
370 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
371 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
372 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
373 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
374 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
375 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
376 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
377 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
378 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
379 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
380 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
381 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
382 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
383 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
384 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
385 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
386 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
387 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
388 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
389 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
390 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
391 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
392 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
393 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
394 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
395 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
396 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
397 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
398 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
399 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
400 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
401 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
402 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
403 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
404 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
405 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
406 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
407 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
408 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
409 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
410 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
411 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
412 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
413 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
414 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
415 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
416 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
417 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
418 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
419 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.9
Metatranscriptomes 0
Isolates 16.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.54
Nodule 12.36
Rhizoplane 3.58
Rhizosphere 62.28
Stem 0
Stem Tuber 0
Unclassified 6.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209257_1000237 3300025304 Bacteria 128812
2 JGI25153J46596_10007099 3300003215 Bacteria 5562
3 JGI25153J46596_10026976 3300003215 Bacteria 2021
4 JGI25160J50197_1000598 3300003354 Bacteria 20171
5 JGI25160J50197_1019482 3300003354 Bacteria 2078
6 Ga0055542_1009623 3300003762 Bacteria 1813
7 Ga0055526_1024805 3300003771 Bacteria 1946
8 Ga0055531_10005901 3300003794 Bacteria 7063
9 Ga0055531_10021594 3300003794 Bacteria 2490
10 Ga0065165_1005280 3300005262 Bacteria 7367
11 Ga0065707_10167273 3300005295 Bacteria 1502
12 Ga0065707_10207371 3300005295 Unclassified 1282
13 Ga0070658_10030778 3300005327 Bacteria 4311
14 Ga0070683_100229652 3300005329 Bacteria 1764
15 Ga0070680_100178838 3300005336 Bacteria 1787
16 Ga0070680_100452995 3300005336 Bacteria 1096
17 Ga0070682_100036457 3300005337 Bacteria 3007
18 Ga0068868_100061959 3300005338 Bacteria 2964
19 Ga0070660_100310017 3300005339 Bacteria 1295
20 Ga0070689_100000734 3300005340 Bacteria 20048
21 Ga0070689_100536735 3300005340 Bacteria 1006
22 Ga0070661_100246380 3300005344 Bacteria 1378
23 Ga0070661_100330472 3300005344 Bacteria 1192
24 Ga0070675_100076746 3300005354 Bacteria 2780
25 Ga0070671_100394949 3300005355 Bacteria 1183
26 Ga0070659_100089687 3300005366 Bacteria 2463
27 Ga0070667_100030685 3300005367 Bacteria 4483
28 Ga0070709_10021250 3300005434 Bacteria 3778
29 Ga0070714_100265758 3300005435 Bacteria 1590
30 Ga0070713_100063583 3300005436 Bacteria 3095
31 Ga0070713_100591229 3300005436 Bacteria 1054
32 Ga0070711_100002251 3300005439 Bacteria 10951
33 Ga0070663_100227992 3300005455 Bacteria 1466
34 Ga0070662_100101608 3300005457 Bacteria 2177
35 Ga0070681_10011098 3300005458 Bacteria 8914
36 Ga0070681_10044063 3300005458 Bacteria 4466
37 Ga0070681_10145917 3300005458 Bacteria 2295
38 Ga0070681_10260865 3300005458 Bacteria 1645
39 Ga0070681_10370020 3300005458 Unclassified 1343
40 Ga0068867_100040361 3300005459 Bacteria 3406
41 Ga0070706_100044027 3300005467 Bacteria 4124
42 Ga0070706_100073456 3300005467 Bacteria 3166
43 Ga0070707_100000020 3300005468 Bacteria 130967
44 Ga0070698_100156058 3300005471 Bacteria 2228
45 Ga0070699_100015186 3300005518 Bacteria 6617
46 Ga0070679_100197086 3300005530 Unclassified 1981
47 Ga0070679_100201670 3300005530 Bacteria 1955
48 Ga0070679_100489850 3300005530 Bacteria 1173
49 Ga0070684_100004199 3300005535 Bacteria 10915
50 Ga0070684_100011818 3300005535 Bacteria 6968
51 Ga0070684_100019553 3300005535 Bacteria 5604
52 Ga0070697_100018311 3300005536 Bacteria 5521
53 Ga0070697_100512882 3300005536 Bacteria 1049
54 Ga0068853_100132287 3300005539 Bacteria 2234
55 Ga0068853_100309194 3300005539 Bacteria 1463
56 Ga0070696_100008884 3300005546 Bacteria 6722
57 Ga0070696_100211230 3300005546 Bacteria 1453
58 Ga0070693_100197377 3300005547 Bacteria 1305
59 Ga0068855_100182468 3300005563 Bacteria 2372
60 Ga0068855_100187040 3300005563 Bacteria 2339
61 Ga0068855_100438135 3300005563 Bacteria 1427
62 Ga0068855_100785149 3300005563 Unclassified 1013
63 Ga0070664_100366201 3300005564 Bacteria 1313
64 Ga0070664_100507380 3300005564 Bacteria 1112
65 Ga0068854_100007157 3300005578 Bacteria 7127
66 Ga0068854_100269739 3300005578 Bacteria 1366
67 Ga0068856_100002728 3300005614 Bacteria 18074
68 Ga0068856_100019720 3300005614 Bacteria 6544
69 Ga0068856_100931377 3300005614 Bacteria 887
70 Ga0070702_100289164 3300005615 Bacteria 1129
71 Ga0070702_100337741 3300005615 Bacteria 1056
72 Ga0070702_100501498 3300005615 Bacteria 891
73 Ga0068852_100293724 3300005616 Bacteria 1571
74 Ga0068852_100713301 3300005616 Bacteria 1014
75 Ga0068859_100085840 3300005617 Bacteria 3193
76 Ga0068859_100168154 3300005617 Bacteria 2273
77 Ga0068861_100242287 3300005719 Bacteria 1534
78 Ga0068870_10188307 3300005840 Unclassified 1243
79 Ga0068863_100067005 3300005841 Bacteria 3396
80 Ga0068863_100211725 3300005841 Bacteria 1867
81 Ga0068858_100385800 3300005842 Bacteria 1344
82 Ga0068862_100049183 3300005844 Bacteria 3601
83 Ga0068862_100260414 3300005844 Bacteria 1583
84 Ga0081455_10055172 3300005937 Bacteria 3381
85 Ga0081540_1049626 3300005983 Bacteria 2092
86 Ga0070717_10014773 3300006028 Bacteria 6007
87 Ga0070717_10860772 3300006028 Bacteria 825
88 Ga0075365_10008468 3300006038 Bacteria 5844
89 Ga0075365_10026717 3300006038 Bacteria 3667
90 Ga0075365_10083187 3300006038 Bacteria 2171
91 Ga0075365_10109080 3300006038 Bacteria 1901
92 Ga0075365_10231619 3300006038 Bacteria 1297
93 Ga0075368_10032519 3300006042 Bacteria 2027
94 Ga0075363_100044334 3300006048 Bacteria 2356
95 Ga0075363_100098318 3300006048 Bacteria 1617
96 Ga0075364_10006263 3300006051 Bacteria 6981
97 Ga0075364_10071941 3300006051 Bacteria 2278
98 Ga0070716_100007093 3300006173 Bacteria 5504
99 Ga0070712_100016872 3300006175 Bacteria 4723
100 Ga0070712_100088551 3300006175 Bacteria 2262
101 Ga0075367_10026900 3300006178 Bacteria 3267
102 Ga0075366_10007532 3300006195 Bacteria 6019
103 Ga0075370_10009763 3300006353 Bacteria 4998
104 Ga0075370_10010180 3300006353 Bacteria 4904
105 Ga0075370_10068230 3300006353 Bacteria 2030
106 Ga0068871_100164624 3300006358 Bacteria 1898
107 Ga0075428_100142560 3300006844 Unclassified 2605
108 Ga0075431_100352115 3300006847 Bacteria 1480
109 Ga0075433_10077130 3300006852 Bacteria 2935
110 Ga0075433_10494096 3300006852 Unclassified 1077
111 Ga0075434_100010232 3300006871 Bacteria 8785
112 Ga0075434_100142946 3300006871 Bacteria 2413
113 Ga0097620_100085840 3300006931 Bacteria 3193
114 Ga0097620_100124979 3300006931 Bacteria 2641
115 Ga0097620_100168154 3300006931 Bacteria 2273
116 Ga0099824_1021120 3300006942 Bacteria 4616
117 Ga0075435_100426842 3300007076 Unclassified 1142
118 Ga0099794_10006785 3300007265 Unclassified 4660
119 Ga0099794_10192593 3300007265 Bacteria 1043
120 Ga0099795_10039806 3300007788 Bacteria 1666
121 Ga0105240_10002279 3300009093 Bacteria 31086
122 Ga0105240_10018909 3300009093 Bacteria 9225
123 Ga0105247_10113557 3300009101 Bacteria 1746
124 Ga0105247_10132446 3300009101 Bacteria 1626
125 Ga0114129_10100449 3300009147 Bacteria 4003
126 Ga0114129_10679348 3300009147 Unclassified 1326
127 Ga0105241_10078485 3300009174 Bacteria 2580
128 Ga0105241_10299201 3300009174 Bacteria 1380
129 Ga0105248_10337696 3300009177 Bacteria 1696
130 Ga0105237_10004359 3300009545 Bacteria 16403
131 Ga0105237_10074064 3300009545 Bacteria 3396
132 Ga0105237_10121998 3300009545 Bacteria 2601
133 Ga0105237_10700930 3300009545 Bacteria 1019
134 Ga0105238_10002364 3300009551 Bacteria 18959
135 Ga0105238_10085437 3300009551 Bacteria 3143
136 Ga0105238_10152087 3300009551 Bacteria 2289
137 Ga0105238_10176143 3300009551 Bacteria 2115
138 Ga0105249_10399757 3300009553 Bacteria 1404
139 Ga0105249_10453067 3300009553 Bacteria 1322
140 Ga0099796_10019084 3300010159 Unclassified 2072
141 Ga0105239_10557155 3300010375 Bacteria 1306
142 Ga0105246_10063473 3300011119 Bacteria 2576
143 Ga0105246_10525940 3300011119 Bacteria 1009
144 Ga0157313_1002372 3300012503 Bacteria 1120
145 Ga0157370_10361858 3300013104 Bacteria 1337
146 Ga0157369_10009251 3300013105 Bacteria 11271
147 Ga0157369_10092566 3300013105 Bacteria 3226
148 Ga0157369_10111488 3300013105 Bacteria 2907
149 Ga0157374_10033476 3300013296 Bacteria 4689
150 Ga0157378_10745981 3300013297 Bacteria 1001
151 Ga0163162_10077755 3300013306 Bacteria 3383
152 Ga0157372_10076701 3300013307 Bacteria 3774
153 Ga0157372_10153951 3300013307 Bacteria 2655
154 Ga0157372_10369359 3300013307 Bacteria 1672
155 Ga0157375_10201855 3300013308 Bacteria 2144
156 Ga0157379_10527351 3300014968 Bacteria 1097
157 Ga0214544_1000006 3300021320 Bacteria 380728
158 Ga0214542_1000002 3300021321 Bacteria 720798
159 Ga0214545_1000002 3300021324 Bacteria 727485
160 Ga0214545_1048848 3300021324 Bacteria 880
161 Ga0214543_1000017 3300021327 Bacteria 290109
162 Ga0213872_10002130 3300021361 Bacteria 11892
163 Ga0213872_10008886 3300021361 Bacteria 4839
164 Ga0213876_10041805 3300021384 Bacteria 2422
165 Ga0213875_10106213 3300021388 Bacteria 1311
166 Ga0209677_100408 3300025253 Bacteria 25703
167 Ga0209148_1000448 3300025254 Bacteria 45242
168 Ga0209233_1022560 3300025261 Bacteria 1608
169 Ga0209455_1004302 3300025272 Bacteria 4712
170 Ga0209564_1007711 3300025295 Bacteria 5484
171 Ga0209564_1008749 3300025295 Bacteria 4937
172 Ga0209758_1000065 3300025297 Bacteria 306288
173 Ga0209758_1001699 3300025297 Bacteria 24739
174 Ga0209758_1036793 3300025297 Bacteria 1903
175 Ga0209758_1086366 3300025297 Bacteria 932
176 Ga0209050_1004342 3300025298 Bacteria 9653
177 Ga0209256_1006673 3300025299 Bacteria 5998
178 Ga0207426_1000772 3300025302 Bacteria 35283
179 Ga0209257_1000869 3300025304 Bacteria 42897
180 Ga0209257_1018210 3300025304 Bacteria 2717
181 Ga0207697_10132490 3300025315 Bacteria 1078
182 Ga0207692_10573315 3300025898 Bacteria 723
183 Ga0207710_10018049 3300025900 Bacteria 2998
184 Ga0207688_10025433 3300025901 Bacteria 3250
185 Ga0207680_10213786 3300025903 Bacteria 1319
186 Ga0207647_10004176 3300025904 Bacteria 10707
187 Ga0207699_10010854 3300025906 Bacteria 4587
188 Ga0207699_10021896 3300025906 Bacteria 3454
189 Ga0207643_10099878 3300025908 Bacteria 1701
190 Ga0207705_10036219 3300025909 Bacteria 3531
191 Ga0207684_10055028 3300025910 Bacteria 3376
192 Ga0207684_10120238 3300025910 Bacteria 2252
193 Ga0207654_10132965 3300025911 Bacteria 1577
194 Ga0207707_10000413 3300025912 Bacteria 44774
195 Ga0207707_10012531 3300025912 Bacteria 7372
196 Ga0207707_10092213 3300025912 Bacteria 2647
197 Ga0207707_10122744 3300025912 Unclassified 2271
198 Ga0207695_10001941 3300025913 Bacteria 32125
199 Ga0207695_10218522 3300025913 Bacteria 1814
200 Ga0207695_10236529 3300025913 Bacteria 1729
201 Ga0207695_10292008 3300025913 Bacteria 1522
202 Ga0207671_10018679 3300025914 Bacteria 5312
203 Ga0207671_10070353 3300025914 Bacteria 2608
204 Ga0207671_10099954 3300025914 Bacteria 2196
205 Ga0207671_10339155 3300025914 Bacteria 1191
206 Ga0207693_10024151 3300025915 Bacteria 4827
207 Ga0207663_10003349 3300025916 Bacteria 7826
208 Ga0207663_10226251 3300025916 Bacteria 1364
209 Ga0207660_10224366 3300025917 Bacteria 1476
210 Ga0207660_10434401 3300025917 Bacteria 1060
211 Ga0207657_10276838 3300025919 Bacteria 1333
212 Ga0207649_10154632 3300025920 Bacteria 1583
213 Ga0207649_10505221 3300025920 Bacteria 920
214 Ga0207652_10062399 3300025921 Unclassified 3220
215 Ga0207652_10086021 3300025921 Bacteria 2756
216 Ga0207652_10264855 3300025921 Bacteria 1550
217 Ga0207646_10000008 3300025922 Bacteria 457143
218 Ga0207646_10000009 3300025922 Bacteria 453146
219 Ga0207694_10499213 3300025924 Bacteria 1019
220 Ga0207700_10022049 3300025928 Bacteria 4362
221 Ga0207700_10022351 3300025928 Bacteria 4339
222 Ga0207700_10110178 3300025928 Bacteria 2214
223 Ga0207664_10236347 3300025929 Bacteria 1590
224 Ga0207664_10254459 3300025929 Bacteria 1534
225 Ga0207644_10340408 3300025931 Bacteria 1216
226 Ga0207690_10125029 3300025932 Bacteria 1874
227 Ga0207706_10092556 3300025933 Bacteria 2658
228 Ga0207706_10683136 3300025933 Unclassified 878
229 Ga0207670_10001592 3300025936 Bacteria 11856
230 Ga0207670_10264382 3300025936 Bacteria 1335
231 Ga0207665_10055299 3300025939 Bacteria 2677
232 Ga0207665_10123048 3300025939 Bacteria 1834
233 Ga0207711_10029525 3300025941 Bacteria 4626
234 Ga0207661_10017507 3300025944 Bacteria 5305
235 Ga0207661_10114734 3300025944 Bacteria 2284
236 Ga0207679_10359121 3300025945 Bacteria 1272
237 Ga0207667_10061889 3300025949 Bacteria 3915
238 Ga0207667_10692489 3300025949 Unclassified 1022
239 Ga0207640_10016759 3300025981 Bacteria 4270
240 Ga0207640_10387454 3300025981 Bacteria 1134
241 Ga0207658_10395139 3300025986 Bacteria 1214
242 Ga0207703_10292342 3300026035 Bacteria 1483
243 Ga0207639_10426883 3300026041 Bacteria 1199
244 Ga0207639_10796080 3300026041 Bacteria 881
245 Ga0207678_10134469 3300026067 Bacteria 2110
246 Ga0207678_10242619 3300026067 Bacteria 1543
247 Ga0207702_10000178 3300026078 Bacteria 76683
248 Ga0207641_10035262 3300026088 Bacteria 4167
249 Ga0207641_10070838 3300026088 Bacteria 2997
250 Ga0207648_10074324 3300026089 Bacteria 2962
251 Ga0207674_10097029 3300026116 Bacteria 2932
252 Ga0207698_10256579 3300026142 Bacteria 1603
253 Ga0207698_10272335 3300026142 Bacteria 1561
254 Ga0209389_1000257 3300027296 Bacteria 33836
255 Ga0209589_1002133 3300027357 Bacteria 33836
256 Ga0209489_100906 3300027361 Bacteria 59164
257 Ga0209588_1073008 3300027671 Bacteria 1108
258 Ga0209813_10070514 3300027866 Bacteria 1135
259 Ga0268265_10085356 3300028380 Bacteria 2505
260 Ga0268264_10654165 3300028381 Bacteria 1040
261 Ga0265326_10033960 3300028558 Bacteria 1451
262 Ga0265319_1004993 3300028563 Bacteria 6458
263 Ga0265319_1043674 3300028563 Bacteria 1504
264 Ga0265334_10012295 3300028573 Bacteria 3598
265 Ga0265318_10017318 3300028577 Bacteria 2960
266 Ga0265323_10031594 3300028653 Bacteria 1967
267 Ga0265322_10034557 3300028654 Bacteria 1440
268 Ga0265336_10000099 3300028666 Bacteria 66151
269 Ga0307515_10024570 3300028794 Bacteria 10494
270 Ga0265338_10000207 3300028800 Bacteria 110193
271 Ga0265338_10043350 3300028800 Bacteria 4175
272 Ga0265338_10102917 3300028800 Unclassified 2321
273 Ga0265338_10177916 3300028800 Unclassified 1624
274 Ga0265324_10020343 3300029957 Bacteria 2385
275 Ga0265330_10029997 3300031235 Bacteria 2444
276 Ga0265328_10003656 3300031239 Bacteria 6777
277 Ga0265328_10026624 3300031239 Bacteria 2173
278 Ga0265320_10006419 3300031240 Bacteria 7414
279 Ga0265325_10000044 3300031241 Bacteria 89107
280 Ga0265325_10040721 3300031241 Bacteria 2439
281 Ga0265339_10281959 3300031249 Bacteria 796
282 Ga0265331_10032276 3300031250 Bacteria 2596
283 Ga0265316_10183108 3300031344 Bacteria 1559
284 Ga0307509_10021388 3300031507 Bacteria 7315
285 Ga0307508_10029344 3300031616 Bacteria 4973
286 Ga0307508_10214083 3300031616 Bacteria 1527
287 Ga0265314_10027761 3300031711 Bacteria 4232
288 Ga0265314_10049657 3300031711 Bacteria 2935
289 Ga0265342_10248434 3300031712 Bacteria 950
290 Ga0307516_10024446 3300031730 Bacteria 6170
291 Ga0307516_10194474 3300031730 Bacteria 1752
292 Ga0373934_0023025 3300035086 Unclassified 2406
293 Ga0373934_0115243 3300035086 Bacteria 1091
294 Ga0373923_0070050 3300035111 Bacteria 1504
295 Ga0373953_0025039 3300035117 Bacteria 2276
296 Ga0373954_0000028 3300035118 Bacteria 56501
297 Ga0373954_0011049 3300035118 Unclassified 3996
298 Ga0373954_0152505 3300035118 Bacteria 1129
299 Ga0373957_0022023 3300035120 Bacteria 2268
300 Ga0373955_0125369 3300035172 Bacteria 1496
301 Ga0373955_0280987 3300035172 Bacteria 1001
302 Ga0373924_0015319 3300035410 Bacteria 2914
303 Ga0373924_0017101 3300035410 Bacteria 2778
304 Ga0373935_0097397 3300035692 Unclassified 1935
305 Ga0373935_0198502 3300035692 Bacteria 1385
306 Ga0373927_0010569 3300035695 Bacteria 6152
307 Ga0373927_0090344 3300035695 Bacteria 1989
308 Ga0373933_0000059 3300035724 Bacteria 65716
309 Ga0373933_0002564 3300035724 Bacteria 10185
310 Ga0373933_0032499 3300035724 Bacteria 3033
311 Ga0373933_0091350 3300035724 Bacteria 1879
312 Ga0373937_0006395 3300036401 Bacteria 10164
313 Ga0373937_0530964 3300036401 Bacteria 1118
314 Ga0373925_0231583 3300037068 Bacteria 1477
315 Ga0395900_0001930 3300037418 Bacteria 23498
316 Ga0395900_0025198 3300037418 Bacteria 6090
317 Ga0395898_0008158 3300037466 Bacteria 11088
318 Ga0395898_0011709 3300037466 Bacteria 9095
319 Ga0395905_0085812 3300037471 Bacteria 2950
320 Ga0436364_0271964 3300037853 Bacteria 1294
321 Ga0436364_0498888 3300037853 Bacteria 3359
322 Ga0436364_1546823 3300037853 Bacteria 14246
323 Ga0395901_0166327 3300038443 Bacteria 2316
324 Ga0395901_0336223 3300038443 Bacteria 1560
325 Ga0436365_0331775 3300039437 Bacteria 3447
326 Ga0436365_0814122 3300039437 Unclassified 715
327 Ga0436365_0846359 3300039437 Bacteria 2112
328 Ga0436365_1377630 3300039437 Bacteria 1107
329 Ga0436360_1125229 3300039438 Bacteria 4629
330 Ga0436360_1351773 3300039438 Bacteria 2707
331 Ga0436361_0477005 3300039447 Bacteria 40055
332 Ga0436361_0490272 3300039447 Bacteria 1487
333 Ga0436361_0531386 3300039447 Bacteria 1087
334 Ga0436361_0566119 3300039447 Bacteria 1858
335 Ga0436361_0708281 3300039447 Bacteria 2156
336 Ga0436363_1285991 3300039450 Bacteria 1444
337 Ga0436362_0838402 3300039453 Unclassified 1363
338 Ga0436362_1196515 3300039453 Bacteria 1311
339 Ga0439465_0120273 3300041413 Bacteria 920
340 Ga0451791_0815847 3300041451 Bacteria 1420
341 Ga0451804_0217302 3300041463 Bacteria 786
342 Ga0451804_0988873 3300041463 Bacteria 1081
343 Ga0451851_1169058 3300041507 Bacteria 726
344 Ga0439455_0000914 3300042012 Unclassified 4583
345 Ga0451577_0000783 3300042876 Bacteria 47827
346 Ga0451577_0001149 3300042876 Bacteria 37392
347 Ga0451577_0034886 3300042876 Unclassified 4533
348 Ga0451577_0371993 3300042876 Bacteria 1296
349 Ga0451577_0375571 3300042876 Bacteria 1290
350 Ga0451577_0438434 3300042876 Bacteria 1186
351 Ga0466972_0065167 3300044658 Bacteria 1743
352 Ga0453683_0000347 3300044673 Bacteria 56122
353 Ga0453683_0000470 3300044673 Bacteria 46319
354 Ga0453683_0003456 3300044673 Bacteria 11641
355 Ga0453683_0007302 3300044673 Bacteria 7523
356 Ga0453683_0025686 3300044673 Bacteria 3739
357 Ga0453683_0129218 3300044673 Bacteria 1591
358 Ga0466966_0071196 3300044684 Bacteria 2179
359 Ga0466963_0576062 3300044694 Bacteria 795
360 Ga0466964_0140147 3300044706 Bacteria 1111
361 Ga0453684_0000304 3300044712 Bacteria 207436
362 Ga0453684_0001334 3300044712 Bacteria 72456
363 Ga0453684_0002139 3300044712 Bacteria 49532
364 Ga0453684_0005066 3300044712 Bacteria 26675
365 Ga0453684_0014106 3300044712 Bacteria 12849
366 Ga0453684_0093358 3300044712 Bacteria 3707
367 Ga0466970_0108734 3300044765 Bacteria 1514
368 Ga0466960_0062445 3300044901 Bacteria 1831
369 Ga0466959_0164358 3300045049 Bacteria 1559
370 Ga0451576_0000236 3300045051 Bacteria 135064
371 Ga0451576_0000295 3300045051 Bacteria 121139
372 Ga0451576_0001231 3300045051 Bacteria 45348
373 Ga0451576_0137411 3300045051 Bacteria 2549
374 Ga0451576_0160364 3300045051 Bacteria 2347
375 Ga0451576_0173874 3300045051 Bacteria 2248
376 Ga0451576_0206691 3300045051 Unclassified 2050
377 Ga0451576_0547037 3300045051 Bacteria 1216
378 Ga0495592_0017692 3300046454 Bacteria 5415
379 Ga0495592_0327280 3300046454 Bacteria 989
380 Ga0495590_0046263 3300046457 Bacteria 1518
381 Ga0495629_0458460 3300046459 Bacteria 863
382 Ga0495653_0144818 3300046463 Bacteria 1667
383 Ga0495580_0025867 3300046472 Unclassified 4285
384 Ga0495639_0206713 3300046475 Bacteria 962
385 Ga0495608_0017720 3300046511 Bacteria 4924
386 Ga0495620_0065944 3300046515 Bacteria 1493
387 Ga0495628_0160656 3300046516 Bacteria 1708
388 Ga0495643_0001856 3300046522 Bacteria 17938
389 Ga0495648_0066038 3300046524 Bacteria 2123
390 Ga0495652_0244207 3300046529 Bacteria 1334
391 Ga0495665_0018515 3300046531 Unclassified 3742
392 Ga0495665_0059347 3300046531 Bacteria 2019
393 Ga0495640_0075546 3300046533 Bacteria 2250
394 Ga0495586_0297912 3300046535 Bacteria 924
395 Ga0495598_0107229 3300046537 Unclassified 932
396 Ga0495668_0021222 3300046616 Bacteria 3727
397 Ga0495634_0053907 3300046642 Bacteria 2692
398 Ga0495634_0107162 3300046642 Bacteria 1800
399 Ga0495657_0058438 3300046675 Bacteria 2561
400 Ga0495657_0326561 3300046675 Bacteria 911
401 Ga0495599_0130826 3300046678 Bacteria 1559
402 Ga0495646_0295761 3300046680 Bacteria 858
403 Ga0495658_0132054 3300046683 Bacteria 1521
404 Ga0495613_0415442 3300046689 Bacteria 916
405 Ga0495613_0532508 3300046689 Unclassified 788
406 Ga0495581_0173107 3300047315 Bacteria 1263
407 Ga0495604_0121364 3300047317 Bacteria 1891
408 Ga0495636_0073783 3300047318 Bacteria 1460
409 Ga0495672_0074878 3300047320 Bacteria 1905
410 Ga0495672_0217213 3300047320 Bacteria 946
411 Ga0495680_0029337 3300047322 Bacteria 4505
412 Ga0495687_007498 3300047443 Bacteria 6414
413 Ga0495673_0035796 3300047469 Bacteria 2284
414 Ga0495684_0016397 3300047471 Bacteria 5705
415 Ga0495593_0185326 3300047673 Bacteria 1048
416 Ga0495602_0313551 3300048088 Bacteria 1144
417 Ga0495602_0616859 3300048088 Unclassified 744
418 Ga0496100_0276781 3300048903 Bacteria 1250
419 Ga0496101_0528823 3300048904 Bacteria 932
420 Ga0496102_0017025 3300048905 Bacteria 6361
421 Ga0496102_0566376 3300048905 Bacteria 1059
422 Ga0496103_0028462 3300048906 Bacteria 3391
423 Ga0496104_0058389 3300048907 Bacteria 3652
424 Ga0496105_0034047 3300048908 Bacteria 4188
425 Ga0496106_0089705 3300048909 Bacteria 2371
426 Ga0496106_0786412 3300048909 Bacteria 755
427 Ga0496108_0031144 3300048911 Bacteria 4424
428 Ga0496108_0276385 3300048911 Bacteria 1462
429 Ga0496110_0029672 3300048913 Bacteria 4710
430 Ga0496110_0030627 3300048913 Bacteria 4639
431 Ga0496110_0040221 3300048913 Bacteria 4075
432 Ga0496110_0896146 3300048913 Bacteria 793
433 Ga0496111_0303650 3300048914 Unclassified 1183
434 Ga0496112_0017370 3300048915 Bacteria 6759
435 Ga0496112_0929135 3300048915 Unclassified 791
436 Ga0496113_0489771 3300048916 Bacteria 987
437 Ga0496116_0308727 3300048919 Bacteria 748
438 Ga0496117_0102276 3300048920 Bacteria 1809
439 Ga0496118_0106447 3300048921 Bacteria 1876
440 Ga0496119_0033415 3300048922 Bacteria 3409
441 Ga0496121_0044988 3300048924 Bacteria 3800
442 Ga0496121_0126501 3300048924 Bacteria 1920
443 Ga0496121_0183516 3300048924 Bacteria 1507
444 Ga0496121_0431710 3300048924 Bacteria 854
445 Ga0496124_0272788 3300048927 Bacteria 1238
446 Ga0496125_0000341 3300048928 Bacteria 89076
447 Ga0496125_0001114 3300048928 Bacteria 41120
448 Ga0496125_0013113 3300048928 Bacteria 8173
449 Ga0496126_0022126 3300048929 Bacteria 6193
450 Ga0496126_0059066 3300048929 Bacteria 3455
451 Ga0496126_0081875 3300048929 Bacteria 2853
452 Ga0495682_0094472 3300049460 Bacteria 1074
453 Ga0501032_0029851 3300049569 Bacteria 3740
454 Ga0501033_0002050 3300049570 Bacteria 17522
455 Ga0501037_0012219 3300049573 Bacteria 6320
456 Ga0501040_0002661 3300049576 Bacteria 11523
457 Ga0501043_0029148 3300049579 Bacteria 4335
458 Ga0501046_0000182 3300049580 Bacteria 63950
459 Ga0501046_0235078 3300049580 Bacteria 1353
460 Ga0501046_0302895 3300049580 Unclassified 1167
461 Ga0501047_0012684 3300049581 Bacteria 7983
462 Ga0501047_0073522 3300049581 Bacteria 3291
463 Ga0501070_0050926 3300049586 Bacteria 3437
464 Ga0501070_0051306 3300049586 Bacteria 3425
465 Ga0501070_0244347 3300049586 Bacteria 1469
466 Ga0501074_0046468 3300049590 Bacteria 3139
467 Ga0501075_0241533 3300049591 Bacteria 1377
468 Ga0501075_0509202 3300049591 Bacteria 918
469 Ga0501076_0356609 3300049592 Bacteria 1201
470 Ga0501080_0012796 3300049742 Bacteria 7697
471 Ga0501080_0024806 3300049742 Bacteria 5561
472 Ga0501081_0103480 3300049743 Unclassified 2015
473 Ga0501083_0077075 3300049744 Bacteria 2212
474 Ga0501035_0108041 3300049822 Bacteria 2439
475 Ga0501044_0047129 3300049823 Bacteria 4459
476 Ga0501044_0234686 3300049823 Bacteria 1780
477 Ga0501045_0566761 3300049824 Unclassified 842
478 nmdc:mga00v17_317043_c1 3300050491 Bacteria 1013
479 nmdc:mga00v17_42912_c1 3300050491 Bacteria 2722
480 nmdc:mga0yw44_13005_c1 3300050492 Bacteria 4363
481 nmdc:mga0yw44_71942_c1 3300050492 Bacteria 2148
482 nmdc:mga0k408_57857_c1 3300050493 Bacteria 2251
483 nmdc:mga06z11_36442_c1 3300050494 Bacteria 2429
484 nmdc:mga06z11_48654_c1 3300050494 Bacteria 2159
485 nmdc:mga04h51_12823_c1 3300050495 Bacteria 2362
486 nmdc:mga04h51_15276_c1 3300050495 Bacteria 1865
487 nmdc:mga07m45_226132_c1 3300050496 Bacteria 1089
488 nmdc:mga07m45_40474_c1 3300050496 Bacteria 2607
489 nmdc:mga05p37_758983_c1 3300050507 Unclassified 1068
490 nmdc:mga08y16_231124_c1 3300050511 Bacteria 1913
491 nmdc:mga0n895_4465_c1 3300050512 Bacteria 11499
492 Ga0495601_0115993 3300053077 Bacteria 1737
493 Ga0495612_0036408 3300053078 Bacteria 1997
494 Ga0495612_0080317 3300053078 Bacteria 1370
495 Ga0500578_0201418 3300053086 Bacteria 1218
496 Ga0500643_100690 3300053087 Bacteria 784
497 Ga0500644_0061508 3300053088 Unclassified 1324
498 Ga0500646_0003687 3300053090 Bacteria 3921
499 Ga0500647_0167155 3300053091 Bacteria 1017
500 Ga0500641_0001080 3300053096 Bacteria 9716
501 Ga0500641_0002792 3300053096 Bacteria 6185
502 Ga0500557_000010 3300053105 Bacteria 118251
503 Ga0500569_031384 3300053109 Bacteria 1494
504 Ga0500572_000803 3300053111 Bacteria 10022
505 Ga0500642_0000206 3300053130 Bacteria 24090
506 Ga0500642_0001027 3300053130 Bacteria 8041
507 Ga0500559_0000560 3300053136 Bacteria 25755
508 Ga0500568_0010021 3300053139 Bacteria 4466
509 Ga0500604_0005118 3300053151 Bacteria 3464
510 Ga0500622_0154755 3300053156 Bacteria 1080
511 Ga0500639_148136 3300053163 Bacteria 1086
512 Ga0500636_0011640 3300053177 Bacteria 5148
513 Ga0500625_001171 3300053729 Bacteria 8622
514 Ga0501084_0355158 3300054114 Bacteria 1238
515 Ga0501082_0355318 3300060353 Bacteria 1278
516 Ga0466962_0136949 3300061719 Bacteria 1185
517 2507509813 2507262055 Bacteria 8048963
518 2508543829 2508501009 Bacteria 7784016
519 2508698383 2508501042 Bacteria 8719808
520 2513625238 2513237092 Bacteria 8341956
521 2513646120 2513237095 Bacteria 8976980
522 2513701008 2513237102 Bacteria 7703324
523 2513875892 2513237139 Bacteria 8737671
524 2513891795 2513237141 Bacteria 8496279
525 2514011442 2513237161 Bacteria 8871253
526 2517103486 2517093001 Bacteria 9002274
527 2617349338 2617270735 Bacteria 9163226
528 2617378140 2617270741 Bacteria 8201522
529 2643757342 2643221547 Bacteria 4740017
530 2793060213 2791355196 Bacteria 7323613
531 2805917578 2802429603 Bacteria 8777136
532 2818241541 2816332527 Bacteria 8933356
533 2824602082 2824600985 Bacteria 8488197
534 2824610070 2824609381 Bacteria 8672835
535 2824620121 2824617872 Bacteria 8814715
536 2824627668 2824626560 Bacteria 8813858
537 2824636763 2824635225 Bacteria 8785348
538 2824645056 2824644064 Bacteria 8743947
539 2824654925 2824653114 Bacteria 8493680
540 2824672572 2824671348 Bacteria 8369588
541 2824680878 2824679649 Bacteria 8248951
542 2824689095 2824687955 Bacteria 8360029
543 2824697462 2824696289 Bacteria 8335049
544 2824715382 2824714736 Bacteria 8717648
545 2824724763 2824723954 Bacteria 8758240
546 2824733592 2824732956 Bacteria 7810675
547 2824746967 2824746037 Bacteria 7911610
548 2824774071 2824773399 Bacteria 8360218
549 2838130119 2838122688 Bacteria 8803140
550 2841941276 2841941048 Bacteria 8688029
551 2841952697 2841949485 Bacteria 8680857
552 2841962208 2841957949 Bacteria 8652217
553 2841967431 2841966195 Bacteria 8673214
554 2841979171 2841974524 Bacteria 8931498
555 2841990747 2841983080 Bacteria 8395090
556 2842038587 2842038055 Bacteria 8002051
557 2842048468 2842045827 Bacteria 8006841
558 2844317983 2844315083 Bacteria 8138177
559 2847945360 2847939898 Bacteria 8606328
560 2849080452 2849076700 Bacteria 7039503
561 2857510195 2857509624 Bacteria 7472071
562 2874615689 2874612657 Bacteria 8252029
563 2879089243 2879083081 Bacteria 8587928
564 2881366190 2881364244 Bacteria 7710352
565 2883355235 2883354860 Bacteria 5865246
566 2885372783 2885366525 Bacteria 8326213
567 2888382781 2888378607 Bacteria 9652610
568 2888423261 2888419890 Bacteria 7857137
569 2903729707 2903727486 Bacteria 8281579
570 2906605856 2906602504 Bacteria 8295279
571 2908778904 2908775508 Bacteria 8092255
572 2922395190 2922393267 Bacteria 8285685
573 2928130558 2928125067 Bacteria 5937560
574 2935611328 2935608549 Bacteria 8203142
575 2935648712 2935648319 Bacteria 8801166
576 2935657205 2935656913 Bacteria 8965014
577 2935775297 2935769743 Bacteria 7878163
578 2935779500 2935777560 Bacteria 8077691
579 2935791505 2935785616 Bacteria 7962367
580 2935799817 2935793552 Bacteria 8012592
581 2935812062 2935810662 Bacteria 9401221
582 2935820805 2935819856 Bacteria 8261050
583 2935850935 2935847175 Bacteria 8228321
584 2935913698 2935908558 Bacteria 8568796
585 2935920312 2935916978 Bacteria 9113783
586 2935930651 2935926038 Bacteria 8601059
587 2935939376 2935934488 Bacteria 8602579
588 2935946325 2935942939 Bacteria 8599779
589 2935955836 2935951376 Bacteria 8602333
590 2935972454 2935967501 Bacteria 8603075
591 2935991090 2935984226 Bacteria 8302647
592 2936011622 2936011229 Bacteria 8801034
593 2936020217 2936019824 Bacteria 8804134
594 2936028912 2936028420 Bacteria 8965941
595 2936038656 2936037263 Bacteria 9446081
596 2936046940 2936046547 Bacteria 8903709
597 2936058180 2936055302 Bacteria 8785755
598 3005512742 3005506211 Bacteria 6943378
599 3005590509 3005587118 Bacteria 7794411
600 8016530819 8016522445 Bacteria 8156687
601 8016536109 8016530956 Bacteria 8155261
602 8016552843 8016548790 Bacteria 8155074
603 8016561222 8016557553 Bacteria 8154380
604 8016574463 8016566248 Bacteria 8158151
605 8016578556 8016575299 Bacteria 8154085
606 8016590471 8016583857 Bacteria 10421953
607 8016599080 8016595262 Bacteria 8149947
608 8016611972 8016603502 Bacteria 8731218
609 8016621829 8016613128 Bacteria 8794220
610 8016628019 8016622563 Bacteria 7999408
611 8016632343 8016630954 Bacteria 9217207
612 8019535835 8019530166 Bacteria 8155624
613 8019543642 8019538911 Bacteria 7872763
614 8019555134 8019547302 Bacteria 7996444
615 8019688707 8019687851 Bacteria 8712826
616 Ga0209257_1000237
617 JGI25153J46596_10007099
618 JGI25153J46596_10026976
619 JGI25160J50197_1000598
620 JGI25160J50197_1019482
621 Ga0055542_1009623
622 Ga0055526_1024805
623 Ga0055531_10005901
624 Ga0055531_10021594
625 Ga0065165_1005280
626 Ga0065707_10167273
627 Ga0065707_10207371
628 Ga0070658_10030778
629 Ga0070683_100229652
630 Ga0070680_100178838
631 Ga0070680_100452995
632 Ga0070682_100036457
633 Ga0068868_100061959
634 Ga0070660_100310017
635 Ga0070689_100000734
636 Ga0070689_100536735
637 Ga0070661_100246380
638 Ga0070661_100330472
639 Ga0070675_100076746
640 Ga0070671_100394949
641 Ga0070659_100089687
642 Ga0070667_100030685
643 Ga0070709_10021250
644 Ga0070714_100265758
645 Ga0070713_100063583
646 Ga0070713_100591229
647 Ga0070711_100002251
648 Ga0070663_100227992
649 Ga0070662_100101608
650 Ga0070681_10011098
651 Ga0070681_10044063
652 Ga0070681_10145917
653 Ga0070681_10260865
654 Ga0070681_10370020
655 Ga0068867_100040361
656 Ga0070706_100044027
657 Ga0070706_100073456
658 Ga0070707_100000020
659 Ga0070698_100156058
660 Ga0070699_100015186
661 Ga0070679_100197086
662 Ga0070679_100201670
663 Ga0070679_100489850
664 Ga0070684_100004199
665 Ga0070684_100011818
666 Ga0070684_100019553
667 Ga0070697_100018311
668 Ga0070697_100512882
669 Ga0068853_100132287
670 Ga0068853_100309194
671 Ga0070696_100008884
672 Ga0070696_100211230
673 Ga0070693_100197377
674 Ga0068855_100182468
675 Ga0068855_100187040
676 Ga0068855_100438135
677 Ga0068855_100785149
678 Ga0070664_100366201
679 Ga0070664_100507380
680 Ga0068854_100007157
681 Ga0068854_100269739
682 Ga0068856_100002728
683 Ga0068856_100019720
684 Ga0068856_100931377
685 Ga0070702_100289164
686 Ga0070702_100337741
687 Ga0070702_100501498
688 Ga0068852_100293724
689 Ga0068852_100713301
690 Ga0068859_100085840
691 Ga0068859_100168154
692 Ga0068861_100242287
693 Ga0068870_10188307
694 Ga0068863_100067005
695 Ga0068863_100211725
696 Ga0068858_100385800
697 Ga0068862_100049183
698 Ga0068862_100260414
699 Ga0081455_10055172
700 Ga0081540_1049626
701 Ga0070717_10014773
702 Ga0070717_10860772
703 Ga0075365_10008468
704 Ga0075365_10026717
705 Ga0075365_10083187
706 Ga0075365_10109080
707 Ga0075365_10231619
708 Ga0075368_10032519
709 Ga0075363_100044334
710 Ga0075363_100098318
711 Ga0075364_10006263
712 Ga0075364_10071941
713 Ga0070716_100007093
714 Ga0070712_100016872
715 Ga0070712_100088551
716 Ga0075367_10026900
717 Ga0075366_10007532
718 Ga0075370_10009763
719 Ga0075370_10010180
720 Ga0075370_10068230
721 Ga0068871_100164624
722 Ga0075428_100142560
723 Ga0075431_100352115
724 Ga0075433_10077130
725 Ga0075433_10494096
726 Ga0075434_100010232
727 Ga0075434_100142946
728 Ga0097620_100085840
729 Ga0097620_100124979
730 Ga0097620_100168154
731 Ga0099824_1021120
732 Ga0075435_100426842
733 Ga0099794_10006785
734 Ga0099794_10192593
735 Ga0099795_10039806
736 Ga0105240_10002279
737 Ga0105240_10018909
738 Ga0105247_10113557
739 Ga0105247_10132446
740 Ga0114129_10100449
741 Ga0114129_10679348
742 Ga0105241_10078485
743 Ga0105241_10299201
744 Ga0105248_10337696
745 Ga0105237_10004359
746 Ga0105237_10074064
747 Ga0105237_10121998
748 Ga0105237_10700930
749 Ga0105238_10002364
750 Ga0105238_10085437
751 Ga0105238_10152087
752 Ga0105238_10176143
753 Ga0105249_10399757
754 Ga0105249_10453067
755 Ga0099796_10019084
756 Ga0105239_10557155
757 Ga0105246_10063473
758 Ga0105246_10525940
759 Ga0157313_1002372
760 Ga0157370_10361858
761 Ga0157369_10009251
762 Ga0157369_10092566
763 Ga0157369_10111488
764 Ga0157374_10033476
765 Ga0157378_10745981
766 Ga0163162_10077755
767 Ga0157372_10076701
768 Ga0157372_10153951
769 Ga0157372_10369359
770 Ga0157375_10201855
771 Ga0157379_10527351
772 Ga0214544_1000006
773 Ga0214542_1000002
774 Ga0214545_1000002
775 Ga0214545_1048848
776 Ga0214543_1000017
777 Ga0213872_10002130
778 Ga0213872_10008886
779 Ga0213876_10041805
780 Ga0213875_10106213
781 Ga0209677_100408
782 Ga0209148_1000448
783 Ga0209233_1022560
784 Ga0209455_1004302
785 Ga0209564_1007711
786 Ga0209564_1008749
787 Ga0209758_1000065
788 Ga0209758_1001699
789 Ga0209758_1036793
790 Ga0209758_1086366
791 Ga0209050_1004342
792 Ga0209256_1006673
793 Ga0207426_1000772
794 Ga0209257_1000869
795 Ga0209257_1018210
796 Ga0207697_10132490
797 Ga0207692_10573315
798 Ga0207710_10018049
799 Ga0207688_10025433
800 Ga0207680_10213786
801 Ga0207647_10004176
802 Ga0207699_10010854
803 Ga0207699_10021896
804 Ga0207643_10099878
805 Ga0207705_10036219
806 Ga0207684_10055028
807 Ga0207684_10120238
808 Ga0207654_10132965
809 Ga0207707_10000413
810 Ga0207707_10012531
811 Ga0207707_10092213
812 Ga0207707_10122744
813 Ga0207695_10001941
814 Ga0207695_10218522
815 Ga0207695_10236529
816 Ga0207695_10292008
817 Ga0207671_10018679
818 Ga0207671_10070353
819 Ga0207671_10099954
820 Ga0207671_10339155
821 Ga0207693_10024151
822 Ga0207663_10003349
823 Ga0207663_10226251
824 Ga0207660_10224366
825 Ga0207660_10434401
826 Ga0207657_10276838
827 Ga0207649_10154632
828 Ga0207649_10505221
829 Ga0207652_10062399
830 Ga0207652_10086021
831 Ga0207652_10264855
832 Ga0207646_10000008
833 Ga0207646_10000009
834 Ga0207694_10499213
835 Ga0207700_10022049
836 Ga0207700_10022351
837 Ga0207700_10110178
838 Ga0207664_10236347
839 Ga0207664_10254459
840 Ga0207644_10340408
841 Ga0207690_10125029
842 Ga0207706_10092556
843 Ga0207706_10683136
844 Ga0207670_10001592
845 Ga0207670_10264382
846 Ga0207665_10055299
847 Ga0207665_10123048
848 Ga0207711_10029525
849 Ga0207661_10017507
850 Ga0207661_10114734
851 Ga0207679_10359121
852 Ga0207667_10061889
853 Ga0207667_10692489
854 Ga0207640_10016759
855 Ga0207640_10387454
856 Ga0207658_10395139
857 Ga0207703_10292342
858 Ga0207639_10426883
859 Ga0207639_10796080
860 Ga0207678_10134469
861 Ga0207678_10242619
862 Ga0207702_10000178
863 Ga0207641_10035262
864 Ga0207641_10070838
865 Ga0207648_10074324
866 Ga0207674_10097029
867 Ga0207698_10256579
868 Ga0207698_10272335
869 Ga0209389_1000257
870 Ga0209589_1002133
871 Ga0209489_100906
872 Ga0209588_1073008
873 Ga0209813_10070514
874 Ga0268265_10085356
875 Ga0268264_10654165
876 Ga0265326_10033960
877 Ga0265319_1004993
878 Ga0265319_1043674
879 Ga0265334_10012295
880 Ga0265318_10017318
881 Ga0265323_10031594
882 Ga0265322_10034557
883 Ga0265336_10000099
884 Ga0307515_10024570
885 Ga0265338_10000207
886 Ga0265338_10043350
887 Ga0265338_10102917
888 Ga0265338_10177916
889 Ga0265324_10020343
890 Ga0265330_10029997
891 Ga0265328_10003656
892 Ga0265328_10026624
893 Ga0265320_10006419
894 Ga0265325_10000044
895 Ga0265325_10040721
896 Ga0265339_10281959
897 Ga0265331_10032276
898 Ga0265316_10183108
899 Ga0307509_10021388
900 Ga0307508_10029344
901 Ga0307508_10214083
902 Ga0265314_10027761
903 Ga0265314_10049657
904 Ga0265342_10248434
905 Ga0307516_10024446
906 Ga0307516_10194474
907 Ga0373934_0023025
908 Ga0373934_0115243
909 Ga0373923_0070050
910 Ga0373953_0025039
911 Ga0373954_0000028
912 Ga0373954_0011049
913 Ga0373954_0152505
914 Ga0373957_0022023
915 Ga0373955_0125369
916 Ga0373955_0280987
917 Ga0373924_0015319
918 Ga0373924_0017101
919 Ga0373935_0097397
920 Ga0373935_0198502
921 Ga0373927_0010569
922 Ga0373927_0090344
923 Ga0373933_0000059
924 Ga0373933_0002564
925 Ga0373933_0032499
926 Ga0373933_0091350
927 Ga0373937_0006395
928 Ga0373937_0530964
929 Ga0373925_0231583
930 Ga0395900_0001930
931 Ga0395900_0025198
932 Ga0395898_0008158
933 Ga0395898_0011709
934 Ga0395905_0085812
935 Ga0436364_0271964
936 Ga0436364_0498888
937 Ga0436364_1546823
938 Ga0395901_0166327
939 Ga0395901_0336223
940 Ga0436365_0331775
941 Ga0436365_0814122
942 Ga0436365_0846359
943 Ga0436365_1377630
944 Ga0436360_1125229
945 Ga0436360_1351773
946 Ga0436361_0477005
947 Ga0436361_0490272
948 Ga0436361_0531386
949 Ga0436361_0566119
950 Ga0436361_0708281
951 Ga0436363_1285991
952 Ga0436362_0838402
953 Ga0436362_1196515
954 Ga0439465_0120273
955 Ga0451791_0815847
956 Ga0451804_0217302
957 Ga0451804_0988873
958 Ga0451851_1169058
959 Ga0439455_0000914
960 Ga0451577_0000783
961 Ga0451577_0001149
962 Ga0451577_0034886
963 Ga0451577_0371993
964 Ga0451577_0375571
965 Ga0451577_0438434
966 Ga0466972_0065167
967 Ga0453683_0000347
968 Ga0453683_0000470
969 Ga0453683_0003456
970 Ga0453683_0007302
971 Ga0453683_0025686
972 Ga0453683_0129218
973 Ga0466966_0071196
974 Ga0466963_0576062
975 Ga0466964_0140147
976 Ga0453684_0000304
977 Ga0453684_0001334
978 Ga0453684_0002139
979 Ga0453684_0005066
980 Ga0453684_0014106
981 Ga0453684_0093358
982 Ga0466970_0108734
983 Ga0466960_0062445
984 Ga0466959_0164358
985 Ga0451576_0000236
986 Ga0451576_0000295
987 Ga0451576_0001231
988 Ga0451576_0137411
989 Ga0451576_0160364
990 Ga0451576_0173874
991 Ga0451576_0206691
992 Ga0451576_0547037
993 Ga0495592_0017692
994 Ga0495592_0327280
995 Ga0495590_0046263
996 Ga0495629_0458460
997 Ga0495653_0144818
998 Ga0495580_0025867
999 Ga0495639_0206713
1000 Ga0495608_0017720
1001 Ga0495620_0065944
1002 Ga0495628_0160656
1003 Ga0495643_0001856
1004 Ga0495648_0066038
1005 Ga0495652_0244207
1006 Ga0495665_0018515
1007 Ga0495665_0059347
1008 Ga0495640_0075546
1009 Ga0495586_0297912
1010 Ga0495598_0107229
1011 Ga0495668_0021222
1012 Ga0495634_0053907
1013 Ga0495634_0107162
1014 Ga0495657_0058438
1015 Ga0495657_0326561
1016 Ga0495599_0130826
1017 Ga0495646_0295761
1018 Ga0495658_0132054
1019 Ga0495613_0415442
1020 Ga0495613_0532508
1021 Ga0495581_0173107
1022 Ga0495604_0121364
1023 Ga0495636_0073783
1024 Ga0495672_0074878
1025 Ga0495672_0217213
1026 Ga0495680_0029337
1027 Ga0495687_007498
1028 Ga0495673_0035796
1029 Ga0495684_0016397
1030 Ga0495593_0185326
1031 Ga0495602_0313551
1032 Ga0495602_0616859
1033 Ga0496100_0276781
1034 Ga0496101_0528823
1035 Ga0496102_0017025
1036 Ga0496102_0566376
1037 Ga0496103_0028462
1038 Ga0496104_0058389
1039 Ga0496105_0034047
1040 Ga0496106_0089705
1041 Ga0496106_0786412
1042 Ga0496108_0031144
1043 Ga0496108_0276385
1044 Ga0496110_0029672
1045 Ga0496110_0030627
1046 Ga0496110_0040221
1047 Ga0496110_0896146
1048 Ga0496111_0303650
1049 Ga0496112_0017370
1050 Ga0496112_0929135
1051 Ga0496113_0489771
1052 Ga0496116_0308727
1053 Ga0496117_0102276
1054 Ga0496118_0106447
1055 Ga0496119_0033415
1056 Ga0496121_0044988
1057 Ga0496121_0126501
1058 Ga0496121_0183516
1059 Ga0496121_0431710
1060 Ga0496124_0272788
1061 Ga0496125_0000341
1062 Ga0496125_0001114
1063 Ga0496125_0013113
1064 Ga0496126_0022126
1065 Ga0496126_0059066
1066 Ga0496126_0081875
1067 Ga0495682_0094472
1068 Ga0501032_0029851
1069 Ga0501033_0002050
1070 Ga0501037_0012219
1071 Ga0501040_0002661
1072 Ga0501043_0029148
1073 Ga0501046_0000182
1074 Ga0501046_0235078
1075 Ga0501046_0302895
1076 Ga0501047_0012684
1077 Ga0501047_0073522
1078 Ga0501070_0050926
1079 Ga0501070_0051306
1080 Ga0501070_0244347
1081 Ga0501074_0046468
1082 Ga0501075_0241533
1083 Ga0501075_0509202
1084 Ga0501076_0356609
1085 Ga0501080_0012796
1086 Ga0501080_0024806
1087 Ga0501081_0103480
1088 Ga0501083_0077075
1089 Ga0501035_0108041
1090 Ga0501044_0047129
1091 Ga0501044_0234686
1092 Ga0501045_0566761
1093 nmdc:mga00v17_317043_c1
1094 nmdc:mga00v17_42912_c1
1095 nmdc:mga0yw44_13005_c1
1096 nmdc:mga0yw44_71942_c1
1097 nmdc:mga0k408_57857_c1
1098 nmdc:mga06z11_36442_c1
1099 nmdc:mga06z11_48654_c1
1100 nmdc:mga04h51_12823_c1
1101 nmdc:mga04h51_15276_c1
1102 nmdc:mga07m45_226132_c1
1103 nmdc:mga07m45_40474_c1
1104 nmdc:mga05p37_758983_c1
1105 nmdc:mga08y16_231124_c1
1106 nmdc:mga0n895_4465_c1
1107 Ga0495601_0115993
1108 Ga0495612_0036408
1109 Ga0495612_0080317
1110 Ga0500578_0201418
1111 Ga0500643_100690
1112 Ga0500644_0061508
1113 Ga0500646_0003687
1114 Ga0500647_0167155
1115 Ga0500641_0001080
1116 Ga0500641_0002792
1117 Ga0500557_000010
1118 Ga0500569_031384
1119 Ga0500572_000803
1120 Ga0500642_0000206
1121 Ga0500642_0001027
1122 Ga0500559_0000560
1123 Ga0500568_0010021
1124 Ga0500604_0005118
1125 Ga0500622_0154755
1126 Ga0500639_148136
1127 Ga0500636_0011640
1128 Ga0500625_001171
1129 Ga0501084_0355158
1130 Ga0501082_0355318
1131 Ga0466962_0136949
1132 2507509813
1133 2508543829
1134 2508698383
1135 2513625238
1136 2513646120
1137 2513701008
1138 2513875892
1139 2513891795
1140 2514011442
1141 2517103486
1142 2617349338
1143 2617378140
1144 2643757342
1145 2793060213
1146 2805917578
1147 2818241541
1148 2824602082
1149 2824610070
1150 2824620121
1151 2824627668
1152 2824636763
1153 2824645056
1154 2824654925
1155 2824672572
1156 2824680878
1157 2824689095
1158 2824697462
1159 2824715382
1160 2824724763
1161 2824733592
1162 2824746967
1163 2824774071
1164 2838130119
1165 2841941276
1166 2841952697
1167 2841962208
1168 2841967431
1169 2841979171
1170 2841990747
1171 2842038587
1172 2842048468
1173 2844317983
1174 2847945360
1175 2849080452
1176 2857510195
1177 2874615689
1178 2879089243
1179 2881366190
1180 2883355235
1181 2885372783
1182 2888382781
1183 2888423261
1184 2903729707
1185 2906605856
1186 2908778904
1187 2922395190
1188 2928130558
1189 2935611328
1190 2935648712
1191 2935657205
1192 2935775297
1193 2935779500
1194 2935791505
1195 2935799817
1196 2935812062
1197 2935820805
1198 2935850935
1199 2935913698
1200 2935920312
1201 2935930651
1202 2935939376
1203 2935946325
1204 2935955836
1205 2935972454
1206 2935991090
1207 2936011622
1208 2936020217
1209 2936028912
1210 2936038656
1211 2936046940
1212 2936058180
1213 3005512742
1214 3005590509
1215 8016530819
1216 8016536109
1217 8016552843
1218 8016561222
1219 8016574463
1220 8016578556
1221 8016590471
1222 8016599080
1223 8016611972
1224 8016621829
1225 8016628019
1226 8016632343
1227 8019535835
1228 8019543642
1229 8019555134
1230 8019688707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13649

Methyltransf_25

Methyltransferase domain

100

190

0.95

PF08241

Methyltransf_11

Methyltransferase domain

101

195

0.94

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

80

232

0.84

PF13847

Methyltransf_31

Methyltransferase domain

94

231

0.84

PF02353

CMAS

Mycolic acid cyclopropane synthetase

84

214

0.79

PF05175

MTS

Methyltransferase small domain

85

205

0.78

PF08242

Methyltransf_12

Methyltransferase domain

101

190

0.78

PF13489

Methyltransf_23

Methyltransferase domain

74

236

0.76

PF07021

MetW

Methionine biosynthesis protein MetW

86

200

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uak-assembly1.cif.gz_A-2 lahsb - c-terminal methyltransferase involved in ripp biosynthesis 0.8506 62 169
6uk5-assembly1.cif.gz_B structure of sam bound cals10, an amino pentose methyltransferase from micromonospora echinaspora involved in calicheamicin biosynthesis 0.8276 59 177
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.8269 60 169
7noy-assembly1.cif.gz_A crystal structure of the heterocyclic toxin methyltransferase from mycobacterium tuberculosis in complex with substrate 1-hydroxyquinolin-4(1h)-one 0.8219 61 176
1xxl-assembly2.cif.gz_B the crystal structure of ycgj protein from bacillus subitilis at 2.1 a resolution 0.8091 63 209
ID Description Score Start End Superfamily
af_Q2G1A8_17_252_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8517 62 210 3.40.50.150
af_Q17539_8_209_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8503 64 169 3.40.50.150
af_A4HYM5_212_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8309 72 169 3.40.50.150
af_A0A1D6ET91_93_186_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8296 70 172 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8283 62 180 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1G3HBB2-F1-model_v4 SAM-dependent methyltransferase 0.9858 62 221 GO:0008757
GO:0032259
AF-A0A0F9D7A4-F1-model_v4 Methyltransferase domain-containing protein 0.9839 69 219 GO:0008168
AF-A0A1J5D1Q4-F1-model_v4 Methyltransferase domain-containing protein 0.9835 62 221
AF-A0A2E3XTZ0-F1-model_v4 SAM-dependent methyltransferase 0.9815 3 221 GO:0008757
GO:0032259
AF-A0A2D6QUI1-F1-model_v4 Methyltransferase domain-containing protein 0.9792 1 120

Map