F469283

General Info

Members Datasets Scaffolds Average Seq Length
613 371 1226 191

Family's Representative Sequence

Representative Sequence 3300046455|Ga0495603_0419963|Ga0495603_0419963_13_603
Length 196
Sequence MVAREEACMSVHIHPAVDSGLTPGSGKFAGGTLSCRCTSQPVKVEISSAIAHNHACGCTKCWKPSGATFSIVAVVPSDKVSVTANGDKLAVVDKAALIQRYACTKCGTHMYGPVEKVHAFQNLTFIHPELFTEAGAPPPEFAAFVSSVIEDGVDPGQMAGIRARIRELGLEPYDCLNPPLMDYLATFAAKAKGVRA

Samples

Sample ID Description Type Environment
1 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
198 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
199 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
212 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
219 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
251 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
252 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
263 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
264 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
265 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
322 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
323 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
324 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
325 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
326 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
327 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
328 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
329 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
330 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
331 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
332 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
333 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
334 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
335 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
336 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
337 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
338 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
339 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
340 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
341 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
342 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
343 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
344 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
345 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
346 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
347 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
348 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
349 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
350 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
351 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
352 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
353 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
354 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
355 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
356 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
357 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
358 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
359 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
360 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
361 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
364 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
365 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
371 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.99
Nodule 0
Rhizoplane 3.75
Rhizosphere 85.15
Stem 0
Stem Tuber 0
Unclassified 0.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495603_0419963 3300046455 Bacteria 766
2 JGI25406J46586_10020875 3300003203 Bacteria 2639
3 rootL2_10154766 3300003322 Bacteria 3053
4 Ga0055542_1010010 3300003762 Bacteria 1758
5 Ga0055530_10062555 3300003791 Bacteria 826
6 Ga0058859_11380943 3300004798 Bacteria 655
7 Ga0065707_10089556 3300005295 Bacteria 4338
8 Ga0065707_10192738 3300005295 Bacteria 1352
9 Ga0070658_10076262 3300005327 Bacteria 2750
10 Ga0070683_100027027 3300005329 Bacteria 5173
11 Ga0070690_100006055 3300005330 Bacteria 6842
12 Ga0070690_100088413 3300005330 Bacteria 2037
13 Ga0070670_100040142 3300005331 Bacteria 4025
14 Ga0070670_100086395 3300005331 Bacteria 2695
15 Ga0070670_100327717 3300005331 Bacteria 1342
16 Ga0070666_10041689 3300005335 Bacteria 3068
17 Ga0070666_10048609 3300005335 Bacteria 2851
18 Ga0068868_100006782 3300005338 Bacteria 8131
19 Ga0070660_100184517 3300005339 Bacteria 1689
20 Ga0070689_100020265 3300005340 Bacteria 4933
21 Ga0070689_100208304 3300005340 Bacteria 1599
22 Ga0070687_100689670 3300005343 Bacteria 712
23 Ga0070661_100020418 3300005344 Bacteria 4723
24 Ga0070661_100073380 3300005344 Bacteria 2519
25 Ga0070668_100049173 3300005347 Bacteria 3244
26 Ga0070669_100013730 3300005353 Bacteria 5758
27 Ga0070669_100072168 3300005353 Bacteria 2555
28 Ga0070675_100004789 3300005354 Bacteria 10319
29 Ga0070671_100003787 3300005355 Bacteria 11868
30 Ga0070671_100048124 3300005355 Bacteria 3545
31 Ga0070671_100110819 3300005355 Bacteria 2306
32 Ga0070671_100630227 3300005355 Bacteria 928
33 Ga0070673_100043372 3300005364 Bacteria 3475
34 Ga0070688_100179377 3300005365 Bacteria 1468
35 Ga0070659_100237228 3300005366 Bacteria 1508
36 Ga0070667_100049122 3300005367 Bacteria 3552
37 Ga0070667_100500673 3300005367 Bacteria 1114
38 Ga0070667_100752225 3300005367 Bacteria 903
39 Ga0070703_10280281 3300005406 Bacteria 687
40 Ga0070709_10010121 3300005434 Bacteria 5212
41 Ga0070709_10318037 3300005434 Bacteria 1141
42 Ga0070713_100014773 3300005436 Bacteria 5810
43 Ga0070711_100059157 3300005439 Bacteria 2659
44 Ga0070711_100553360 3300005439 Bacteria 955
45 Ga0070694_100067638 3300005444 Bacteria 2453
46 Ga0070663_100105874 3300005455 Bacteria 2106
47 Ga0070663_100301538 3300005455 Bacteria 1282
48 Ga0070678_100399183 3300005456 Bacteria 1194
49 Ga0070662_100277657 3300005457 Bacteria 1355
50 Ga0070681_10186513 3300005458 Bacteria 1994
51 Ga0070681_11169236 3300005458 Bacteria 691
52 Ga0068867_100013255 3300005459 Bacteria 5839
53 Ga0068867_100022115 3300005459 Bacteria 4544
54 Ga0068867_100813697 3300005459 Bacteria 834
55 Ga0070706_100003129 3300005467 Bacteria 16366
56 Ga0070707_100109624 3300005468 Bacteria 2677
57 Ga0070707_100359470 3300005468 Bacteria 1414
58 Ga0070707_101066373 3300005468 Bacteria 774
59 Ga0070698_101322999 3300005471 Bacteria 671
60 Ga0070699_100009743 3300005518 Bacteria 8312
61 Ga0070699_100264232 3300005518 Bacteria 1539
62 Ga0070679_100040724 3300005530 Bacteria 4622
63 Ga0070684_100191986 3300005535 Bacteria 1859
64 Ga0068853_100046192 3300005539 Bacteria 3733
65 Ga0070672_100014689 3300005543 Bacteria 5555
66 Ga0070686_100012709 3300005544 Bacteria 4804
67 Ga0070696_100004667 3300005546 Bacteria 9152
68 Ga0070696_100317221 3300005546 Bacteria 1198
69 Ga0070696_100751517 3300005546 Bacteria 799
70 Ga0070693_100041209 3300005547 Bacteria 2597
71 Ga0070693_100088730 3300005547 Bacteria 1860
72 Ga0070693_100335596 3300005547 Bacteria 1030
73 Ga0070665_100025868 3300005548 Bacteria 5910
74 Ga0070665_100366123 3300005548 Bacteria 1448
75 Ga0070704_101308764 3300005549 Bacteria 663
76 Ga0068855_100141927 3300005563 Bacteria 2737
77 Ga0068855_100330155 3300005563 Bacteria 1684
78 Ga0068855_100486243 3300005563 Bacteria 1343
79 Ga0070664_100025818 3300005564 Bacteria 4870
80 Ga0068857_100335965 3300005577 Bacteria 1397
81 Ga0068857_100542475 3300005577 Bacteria 1095
82 Ga0068857_101043182 3300005577 Bacteria 788
83 Ga0068854_100498490 3300005578 Bacteria 1025
84 Ga0068856_100138999 3300005614 Bacteria 2436
85 Ga0070702_100017608 3300005615 Bacteria 3690
86 Ga0070702_100027187 3300005615 Bacteria 3084
87 Ga0070702_100148208 3300005615 Bacteria 1503
88 Ga0068852_100026655 3300005616 Bacteria 4702
89 Ga0068852_100115573 3300005616 Bacteria 2446
90 Ga0068859_100032106 3300005617 Bacteria 5274
91 Ga0068859_100039097 3300005617 Bacteria 4758
92 Ga0068859_100139824 3300005617 Bacteria 2495
93 Ga0068864_100038887 3300005618 Bacteria 4064
94 Ga0068864_100075405 3300005618 Bacteria 2945
95 Ga0068864_100109164 3300005618 Bacteria 2463
96 Ga0068864_100692913 3300005618 Bacteria 995
97 Ga0068861_100004518 3300005719 Bacteria 9340
98 Ga0068851_10012874 3300005834 Bacteria 3952
99 Ga0068870_10023846 3300005840 Bacteria 3022
100 Ga0068870_10041456 3300005840 Bacteria 2392
101 Ga0068863_100001038 3300005841 Bacteria 27788
102 Ga0068863_100018489 3300005841 Bacteria 6670
103 Ga0068863_100083255 3300005841 Bacteria 3031
104 Ga0068863_100084971 3300005841 Bacteria 2999
105 Ga0068863_100162493 3300005841 Bacteria 2140
106 Ga0068858_100019180 3300005842 Bacteria 6398
107 Ga0068858_100103613 3300005842 Bacteria 2654
108 Ga0068860_100005532 3300005843 Bacteria 12790
109 Ga0068860_100063092 3300005843 Bacteria 3520
110 Ga0068860_100125024 3300005843 Bacteria 2465
111 Ga0068862_100008333 3300005844 Bacteria 8579
112 Ga0068862_100975390 3300005844 Bacteria 837
113 Ga0068862_101386898 3300005844 Bacteria 706
114 Ga0081455_10000574 3300005937 Bacteria 47956
115 Ga0081455_10055314 3300005937 Bacteria 3376
116 Ga0081539_10000105 3300005985 Bacteria 197356
117 Ga0081539_10018446 3300005985 Bacteria 4842
118 Ga0070717_10538789 3300006028 Bacteria 1057
119 Ga0070717_10937728 3300006028 Bacteria 788
120 Ga0075365_10031454 3300006038 Bacteria 3404
121 Ga0070715_10004618 3300006163 Bacteria 4539
122 Ga0070715_10429890 3300006163 Bacteria 741
123 Ga0070716_100020156 3300006173 Bacteria 3497
124 Ga0070716_100045533 3300006173 Bacteria 2463
125 Ga0070712_100388215 3300006175 Bacteria 1151
126 Ga0070712_100572754 3300006175 Bacteria 953
127 Ga0070712_100880058 3300006175 Bacteria 771
128 Ga0097621_100065634 3300006237 Bacteria 2988
129 Ga0068871_100173250 3300006358 Bacteria 1851
130 Ga0068871_100367813 3300006358 Bacteria 1275
131 Ga0075428_100044859 3300006844 Bacteria 4858
132 Ga0075428_100083468 3300006844 Bacteria 3486
133 Ga0075428_100319423 3300006844 Unclassified 1669
134 Ga0075430_100087425 3300006846 Bacteria 2608
135 Ga0075430_100325480 3300006846 Bacteria 1270
136 Ga0075431_100114802 3300006847 Bacteria 2780
137 Ga0075431_100476274 3300006847 Bacteria 1241
138 Ga0075431_101247634 3300006847 Bacteria 705
139 Ga0075433_10226659 3300006852 Bacteria 1660
140 Ga0075433_10331988 3300006852 Bacteria 1344
141 Ga0075434_100294349 3300006871 Bacteria 1643
142 Ga0075429_100948527 3300006880 Bacteria 752
143 Ga0068865_100923931 3300006881 Bacteria 760
144 Ga0075436_100041309 3300006914 Bacteria 3182
145 Ga0097620_100032106 3300006931 Bacteria 5274
146 Ga0097620_100039094 3300006931 Bacteria 4758
147 Ga0097620_100139829 3300006931 Bacteria 2495
148 Ga0075435_100251859 3300007076 Bacteria 1503
149 Ga0075435_100535940 3300007076 Bacteria 1013
150 Ga0099794_10011865 3300007265 Bacteria 3745
151 Ga0105240_10227039 3300009093 Bacteria 2172
152 Ga0105240_10502355 3300009093 Bacteria 1348
153 Ga0105240_10563255 3300009093 Bacteria 1259
154 Ga0111539_10090392 3300009094 Bacteria 3598
155 Ga0111539_10225665 3300009094 Bacteria 2182
156 Ga0111539_10391580 3300009094 Bacteria 1618
157 Ga0105245_10006367 3300009098 Bacteria 10390
158 Ga0105247_10014095 3300009101 Bacteria 4794
159 Ga0105247_10033142 3300009101 Bacteria 3140
160 Ga0114129_10091032 3300009147 Bacteria 4227
161 Ga0114129_10181414 3300009147 Bacteria 2864
162 Ga0114129_10277904 3300009147 Bacteria 2238
163 Ga0105243_10028869 3300009148 Bacteria 4262
164 Ga0105243_10295283 3300009148 Bacteria 1466
165 Ga0105241_11199510 3300009174 Bacteria 719
166 Ga0105242_10258392 3300009176 Bacteria 1572
167 Ga0105248_10036849 3300009177 Bacteria 5470
168 Ga0105248_10079926 3300009177 Bacteria 3675
169 Ga0105248_10086413 3300009177 Bacteria 3529
170 Ga0105248_10149750 3300009177 Bacteria 2633
171 Ga0105248_10925774 3300009177 Bacteria 984
172 Ga0105237_10663828 3300009545 Bacteria 1049
173 Ga0105237_10696324 3300009545 Bacteria 1023
174 Ga0105237_10928523 3300009545 Bacteria 877
175 Ga0105238_10027002 3300009551 Bacteria 5851
176 Ga0105238_10519114 3300009551 Bacteria 1194
177 Ga0105238_10689120 3300009551 Bacteria 1033
178 Ga0105249_10360521 3300009553 Bacteria 1475
179 Ga0105249_10567936 3300009553 Bacteria 1186
180 Ga0105249_11040165 3300009553 Bacteria 888
181 Ga0105239_10854086 3300010375 Bacteria 1044
182 Ga0105246_10002904 3300011119 Bacteria 10371
183 Ga0105246_10081812 3300011119 Bacteria 2303
184 Ga0157373_10179720 3300013100 Bacteria 1489
185 Ga0157369_10005846 3300013105 Bacteria 14292
186 Ga0157369_10195179 3300013105 Bacteria 2126
187 Ga0157369_10347463 3300013105 Bacteria 1541
188 Ga0157378_10669463 3300013297 Bacteria 1055
189 Ga0163162_10060267 3300013306 Bacteria 3830
190 Ga0163162_10133306 3300013306 Bacteria 2594
191 Ga0163162_10371835 3300013306 Bacteria 1562
192 Ga0157372_10210531 3300013307 Bacteria 2253
193 Ga0157372_10274814 3300013307 Bacteria 1958
194 Ga0157372_10728486 3300013307 Bacteria 1153
195 Ga0157375_10097245 3300013308 Bacteria 3018
196 Ga0157375_10218950 3300013308 Bacteria 2062
197 Ga0163163_10033262 3300014325 Bacteria 4987
198 Ga0163163_10267263 3300014325 Bacteria 1761
199 Ga0157380_10117867 3300014326 Bacteria 2243
200 Ga0157379_10022799 3300014968 Bacteria 5548
201 Ga0157379_10127707 3300014968 Bacteria 2288
202 Ga0157376_10115910 3300014969 Bacteria 2366
203 Ga0157376_10190924 3300014969 Bacteria 1878
204 Ga0157376_10338671 3300014969 Bacteria 1436
205 Ga0163161_10053428 3300017792 Bacteria 2930
206 Ga0213872_10063699 3300021361 Bacteria 1666
207 Ga0228598_1003032 3300024227 Bacteria 3640
208 Ga0209258_114192 3300025242 Bacteria 932
209 Ga0209148_1000826 3300025254 Bacteria 22316
210 Ga0209455_1000826 3300025272 Bacteria 16776
211 Ga0209758_1000070 3300025297 Bacteria 284093
212 Ga0209758_1042838 3300025297 Bacteria 1674
213 Ga0209050_1023510 3300025298 Bacteria 2166
214 Ga0207426_1048510 3300025302 Bacteria 1275
215 Ga0209051_1020227 3300025303 Bacteria 2874
216 Ga0209257_1000296 3300025304 Bacteria 109517
217 Ga0207656_10038242 3300025321 Bacteria 2023
218 Ga0207653_10005707 3300025885 Bacteria 3882
219 Ga0207692_10224294 3300025898 Bacteria 1115
220 Ga0207647_10391459 3300025904 Bacteria 784
221 Ga0207685_10018081 3300025905 Bacteria 2294
222 Ga0207699_10336661 3300025906 Bacteria 1062
223 Ga0207643_10037032 3300025908 Bacteria 2737
224 Ga0207705_10012162 3300025909 Bacteria 6219
225 Ga0207705_10100829 3300025909 Bacteria 2123
226 Ga0207705_10671329 3300025909 Bacteria 806
227 Ga0207684_10043436 3300025910 Bacteria 3811
228 Ga0207684_10229354 3300025910 Bacteria 1602
229 Ga0207654_10757820 3300025911 Bacteria 700
230 Ga0207707_10274163 3300025912 Bacteria 1462
231 Ga0207695_10016351 3300025913 Bacteria 8683
232 Ga0207695_10531069 3300025913 Bacteria 1058
233 Ga0207695_10626787 3300025913 Bacteria 957
234 Ga0207671_10077169 3300025914 Bacteria 2494
235 Ga0207671_10531961 3300025914 Bacteria 937
236 Ga0207693_10341015 3300025915 Bacteria 1173
237 Ga0207663_10050434 3300025916 Bacteria 2586
238 Ga0207663_10062957 3300025916 Bacteria 2360
239 Ga0207663_10109518 3300025916 Bacteria 1872
240 Ga0207662_10558055 3300025918 Bacteria 794
241 Ga0207657_10011942 3300025919 Bacteria 8595
242 Ga0207649_10027711 3300025920 Bacteria 3328
243 Ga0207649_10071106 3300025920 Bacteria 2221
244 Ga0207649_10720795 3300025920 Bacteria 774
245 Ga0207652_10124812 3300025921 Bacteria 2292
246 Ga0207652_10582643 3300025921 Bacteria 1004
247 Ga0207646_10853003 3300025922 Bacteria 809
248 Ga0207681_10296412 3300025923 Bacteria 1278
249 Ga0207694_10106666 3300025924 Bacteria 2225
250 Ga0207694_10210374 3300025924 Bacteria 1584
251 Ga0207650_10950166 3300025925 Bacteria 730
252 Ga0207659_10021492 3300025926 Bacteria 4284
253 Ga0207687_10781262 3300025927 Bacteria 814
254 Ga0207700_10043298 3300025928 Bacteria 3306
255 Ga0207700_10102591 3300025928 Bacteria 2285
256 Ga0207664_10164628 3300025929 Bacteria 1894
257 Ga0207664_10787670 3300025929 Bacteria 855
258 Ga0207644_10059508 3300025931 Bacteria 2763
259 Ga0207644_10150992 3300025931 Bacteria 1797
260 Ga0207644_11039509 3300025931 Bacteria 688
261 Ga0207706_10279993 3300025933 Bacteria 1455
262 Ga0207686_10166730 3300025934 Bacteria 1549
263 Ga0207709_10472859 3300025935 Bacteria 973
264 Ga0207709_10552840 3300025935 Bacteria 905
265 Ga0207670_10445824 3300025936 Bacteria 1043
266 Ga0207665_10031381 3300025939 Bacteria 3515
267 Ga0207665_10133273 3300025939 Bacteria 1766
268 Ga0207691_10005729 3300025940 Bacteria 12011
269 Ga0207711_10117965 3300025941 Bacteria 2367
270 Ga0207711_10573655 3300025941 Bacteria 1052
271 Ga0207661_10088597 3300025944 Bacteria 2573
272 Ga0207679_10052017 3300025945 Bacteria 3002
273 Ga0207667_10118301 3300025949 Bacteria 2731
274 Ga0207667_10425919 3300025949 Bacteria 1350
275 Ga0207667_10554886 3300025949 Bacteria 1162
276 Ga0207667_11133250 3300025949 Bacteria 764
277 Ga0207651_10024815 3300025960 Bacteria 3715
278 Ga0207712_10200205 3300025961 Bacteria 1583
279 Ga0207712_10531069 3300025961 Bacteria 1010
280 Ga0207712_10691268 3300025961 Bacteria 890
281 Ga0207712_10812512 3300025961 Bacteria 822
282 Ga0207668_10796327 3300025972 Bacteria 836
283 Ga0207658_10537896 3300025986 Bacteria 1044
284 Ga0207677_10124666 3300026023 Bacteria 1944
285 Ga0207703_10002110 3300026035 Bacteria 17497
286 Ga0207703_10276467 3300026035 Bacteria 1523
287 Ga0207639_10041200 3300026041 Bacteria 3453
288 Ga0207678_10009792 3300026067 Bacteria 8431
289 Ga0207678_10157428 3300026067 Bacteria 1940
290 Ga0207702_10349154 3300026078 Bacteria 1415
291 Ga0207702_10364080 3300026078 Bacteria 1386
292 Ga0207702_10912068 3300026078 Bacteria 871
293 Ga0207641_10000884 3300026088 Bacteria 31284
294 Ga0207641_10059598 3300026088 Bacteria 3251
295 Ga0207641_10129178 3300026088 Bacteria 2266
296 Ga0207641_10143736 3300026088 Bacteria 2155
297 Ga0207648_10021726 3300026089 Bacteria 5766
298 Ga0207676_10378930 3300026095 Bacteria 1316
299 Ga0207676_10706036 3300026095 Bacteria 977
300 Ga0207674_10610524 3300026116 Bacteria 1054
301 Ga0207675_100009297 3300026118 Bacteria 9217
302 Ga0207683_10310577 3300026121 Bacteria 1443
303 Ga0207683_10330340 3300026121 Bacteria 1398
304 Ga0207683_10715083 3300026121 Bacteria 929
305 Ga0207698_10087196 3300026142 Bacteria 2541
306 Ga0207698_10130080 3300026142 Bacteria 2149
307 Ga0209179_1063562 3300027512 Bacteria 803
308 Ga0209970_1007248 3300027614 Bacteria 1818
309 Ga0209983_1003339 3300027665 Bacteria 3439
310 Ga0209971_1000615 3300027682 Bacteria 9236
311 Ga0209974_10011606 3300027876 Bacteria 2957
312 Ga0207428_10000016 3300027907 Bacteria 327690
313 Ga0268266_10034023 3300028379 Bacteria 4332
314 Ga0268266_10122610 3300028379 Bacteria 2315
315 Ga0268266_10198533 3300028379 Bacteria 1835
316 Ga0268265_10032607 3300028380 Bacteria 3777
317 Ga0268265_10699702 3300028380 Bacteria 979
318 Ga0268264_10000213 3300028381 Bacteria 115513
319 Ga0268264_10092173 3300028381 Bacteria 2615
320 Ga0268264_10395703 3300028381 Bacteria 1326
321 Ga0268264_10444476 3300028381 Bacteria 1255
322 Ga0265762_1002299 3300030760 Bacteria 3453
323 Ga0265767_100371 3300030836 Bacteria 1850
324 Ga0265760_10120721 3300031090 Unclassified 841
325 Ga0307513_10078452 3300031456 Bacteria 3416
326 Ga0307513_10112553 3300031456 Bacteria 2712
327 Ga0307509_10000026 3300031507 Bacteria 231153
328 Ga0307408_100435700 3300031548 Bacteria 1134
329 Ga0307508_10022803 3300031616 Bacteria 5690
330 Ga0307508_10140460 3300031616 Bacteria 2019
331 Ga0307410_10208830 3300031852 Bacteria 1495
332 Ga0307410_10484871 3300031852 Bacteria 1015
333 Ga0307406_10942318 3300031901 Bacteria 737
334 Ga0307412_10112823 3300031911 Bacteria 1944
335 Ga0307416_100218596 3300032002 Bacteria 1825
336 Ga0307416_100244606 3300032002 Bacteria 1741
337 Ga0307416_100367956 3300032002 Bacteria 1462
338 Ga0307415_101436210 3300032126 Bacteria 658
339 Ga0373932_0044677 3300035112 Bacteria 1293
340 Ga0373939_0228812 3300035114 Bacteria 715
341 Ga0373954_0253077 3300035118 Bacteria 867
342 Ga0373956_0206198 3300035119 Bacteria 932
343 Ga0373956_0359538 3300035119 Bacteria 694
344 Ga0373960_0136757 3300035121 Bacteria 826
345 Ga0373943_0079306 3300035170 Bacteria 1680
346 Ga0373931_0026179 3300035691 Bacteria 2966
347 Ga0373931_0083702 3300035691 Bacteria 1765
348 Ga0373935_0048884 3300035692 Bacteria 2680
349 Ga0373937_0004321 3300036401 Bacteria 12057
350 Ga0373937_0008337 3300036401 Bacteria 8997
351 Ga0373925_0050654 3300037068 Bacteria 3098
352 Ga0395900_0356167 3300037418 Bacteria 1436
353 Ga0395900_0527641 3300037418 Bacteria 1128
354 Ga0395898_0109345 3300037466 Bacteria 2650
355 Ga0395901_0188672 3300038443 Bacteria 2162
356 Ga0242419_003848 3300038698 Bacteria 1028
357 Ga0436361_0171979 3300039447 Bacteria 1374
358 Ga0436363_0286024 3300039450 Bacteria 1770
359 Ga0451802_1638322 3300041460 Bacteria 748
360 Ga0450904_000207 3300042139 Bacteria 12815
361 Ga0466964_0207571 3300044706 Bacteria 944
362 Ga0466971_0163175 3300044719 Bacteria 1043
363 Ga0466960_0281791 3300044901 Bacteria 932
364 Ga0451576_0264344 3300045051 Bacteria 1798
365 Ga0466958_0001142 3300045836 Bacteria 12301
366 Ga0495617_001473 3300046452 Bacteria 10310
367 Ga0495627_001417 3300046453 Bacteria 14123
368 Ga0495592_0069966 3300046454 Bacteria 2558
369 Ga0495629_0122444 3300046459 Bacteria 1812
370 Ga0495651_0052233 3300046462 Bacteria 3148
371 Ga0495650_0074512 3300046471 Bacteria 1323
372 Ga0495650_0099659 3300046471 Bacteria 1093
373 Ga0495580_0081516 3300046472 Bacteria 2255
374 Ga0495580_0269540 3300046472 Bacteria 1163
375 Ga0495605_0002566 3300046474 Bacteria 11166
376 Ga0495605_0065834 3300046474 Bacteria 1723
377 Ga0495662_0123584 3300046476 Bacteria 1271
378 Ga0495584_0012836 3300046491 Bacteria 4275
379 Ga0495584_0063992 3300046491 Bacteria 1849
380 Ga0495584_0192536 3300046491 Bacteria 1036
381 Ga0495585_0000775 3300046492 Bacteria 28225
382 Ga0495585_0145532 3300046492 Bacteria 1238
383 Ga0495585_0379207 3300046492 Bacteria 683
384 Ga0495596_0003663 3300046500 Bacteria 7691
385 Ga0495596_0034010 3300046500 Bacteria 2026
386 Ga0495596_0036403 3300046500 Bacteria 1949
387 Ga0495596_0080314 3300046500 Bacteria 1266
388 Ga0495607_0004445 3300046501 Bacteria 10303
389 Ga0495607_0026763 3300046501 Bacteria 3575
390 Ga0495583_0003742 3300046506 Bacteria 11314
391 Ga0495583_0047308 3300046506 Bacteria 1979
392 Ga0495583_0207339 3300046506 Bacteria 795
393 Ga0495606_0255753 3300046507 Bacteria 969
394 Ga0495610_0133102 3300046512 Bacteria 1078
395 Ga0495616_0000665 3300046513 Bacteria 25531
396 Ga0495616_0014589 3300046513 Bacteria 4393
397 Ga0495616_0131508 3300046513 Bacteria 1146
398 Ga0495616_0185850 3300046513 Bacteria 921
399 Ga0495618_0462143 3300046514 Unclassified 769
400 Ga0495628_0049921 3300046516 Bacteria 3311
401 Ga0495628_0197847 3300046516 Bacteria 1515
402 Ga0495631_0011775 3300046518 Bacteria 4289
403 Ga0495631_0107514 3300046518 Bacteria 1199
404 Ga0495632_0003555 3300046519 Bacteria 11012
405 Ga0495637_0016013 3300046520 Bacteria 3510
406 Ga0495643_0001205 3300046522 Bacteria 25092
407 Ga0495643_0004052 3300046522 Bacteria 10445
408 Ga0495648_0066518 3300046524 Bacteria 2113
409 Ga0495642_0001343 3300046528 Bacteria 11014
410 Ga0495642_0003053 3300046528 Bacteria 6660
411 Ga0495642_0161866 3300046528 Bacteria 970
412 Ga0495652_0063358 3300046529 Bacteria 3113
413 Ga0495654_0095724 3300046530 Bacteria 1372
414 Ga0495654_0120106 3300046530 Bacteria 1190
415 Ga0495640_0064841 3300046533 Bacteria 2468
416 Ga0495640_0195623 3300046533 Bacteria 1284
417 Ga0495587_0023785 3300046536 Bacteria 3763
418 Ga0495609_0025910 3300046538 Bacteria 2686
419 Ga0495609_0170309 3300046538 Bacteria 920
420 Ga0495597_0005559 3300046542 Bacteria 6654
421 Ga0495597_0010931 3300046542 Bacteria 4415
422 Ga0495597_0145492 3300046542 Bacteria 975
423 Ga0495622_0054660 3300046557 Bacteria 1852
424 Ga0495622_0092829 3300046557 Bacteria 1386
425 Ga0495633_0046518 3300046558 Bacteria 2052
426 Ga0495656_0009418 3300046615 Bacteria 3511
427 Ga0495668_0002311 3300046616 Bacteria 15958
428 Ga0495668_0004149 3300046616 Bacteria 10469
429 Ga0495634_0086363 3300046642 Bacteria 2043
430 Ga0495611_0022249 3300046648 Bacteria 2743
431 Ga0495611_0089864 3300046648 Bacteria 1419
432 Ga0495611_0135596 3300046648 Bacteria 1149
433 Ga0495625_0160716 3300046660 Bacteria 1505
434 Ga0495625_0189151 3300046660 Bacteria 1365
435 Ga0495661_0009965 3300046665 Bacteria 6496
436 Ga0495661_0011037 3300046665 Bacteria 6137
437 Ga0495661_0012955 3300046665 Bacteria 5616
438 Ga0495661_0124717 3300046665 Bacteria 1418
439 Ga0495661_0159139 3300046665 Bacteria 1214
440 Ga0495588_0096786 3300046674 Bacteria 1548
441 Ga0495599_0161212 3300046678 Bacteria 1386
442 Ga0495599_0179016 3300046678 Bacteria 1307
443 Ga0495623_0089606 3300046679 Bacteria 1890
444 Ga0495669_0001151 3300046684 Bacteria 10976
445 Ga0495669_0091110 3300046684 Bacteria 1408
446 Ga0495624_0242595 3300046690 Bacteria 1090
447 Ga0495670_0007522 3300046691 Bacteria 5355
448 Ga0495670_0042864 3300046691 Bacteria 2258
449 Ga0495670_0145681 3300046691 Bacteria 1241
450 Ga0495670_0160368 3300046691 Bacteria 1181
451 Ga0495671_0003065 3300046692 Bacteria 10376
452 Ga0495671_0166705 3300046692 Bacteria 1071
453 Ga0495649_0256858 3300046694 Bacteria 896
454 Ga0495589_0001109 3300046794 Bacteria 16055
455 Ga0495589_0235155 3300046794 Bacteria 858
456 Ga0495660_0050502 3300046810 Bacteria 2265
457 Ga0495581_0193828 3300047315 Bacteria 1189
458 Ga0495581_0268559 3300047315 Bacteria 997
459 Ga0495604_0375352 3300047317 Bacteria 940
460 Ga0495674_0120258 3300047319 Bacteria 2219
461 Ga0495674_0221755 3300047319 Bacteria 1563
462 Ga0495674_0262662 3300047319 Bacteria 1418
463 Ga0495672_0055955 3300047320 Bacteria 2299
464 Ga0495672_0057750 3300047320 Bacteria 2252
465 Ga0495672_0062830 3300047320 Bacteria 2134
466 Ga0495676_0007156 3300047321 Bacteria 10239
467 Ga0495687_004013 3300047443 Bacteria 10222
468 Ga0495677_0016053 3300047445 Bacteria 2718
469 Ga0495677_0030028 3300047445 Bacteria 1977
470 Ga0495677_0036894 3300047445 Bacteria 1785
471 Ga0495681_0003176 3300047470 Bacteria 11484
472 Ga0495684_0425163 3300047471 Bacteria 928
473 Ga0495602_0066759 3300048088 Bacteria 3098
474 Ga0495602_0102839 3300048088 Bacteria 2340
475 Ga0495615_0023201 3300048090 Bacteria 1420
476 Ga0495626_0010592 3300048091 Bacteria 4910
477 Ga0495626_0029091 3300048091 Bacteria 2676
478 Ga0495626_0062769 3300048091 Bacteria 1686
479 Ga0495626_0082986 3300048091 Bacteria 1420
480 Ga0495626_0117182 3300048091 Bacteria 1148
481 Ga0496100_0979667 3300048903 Bacteria 665
482 Ga0496102_0003105 3300048905 Bacteria 14083
483 Ga0496102_0513016 3300048905 Bacteria 1121
484 Ga0496103_0037505 3300048906 Bacteria 2970
485 Ga0496103_0110766 3300048906 Bacteria 1744
486 Ga0496104_0234417 3300048907 Bacteria 1747
487 Ga0496104_0767558 3300048907 Bacteria 871
488 Ga0496106_0051884 3300048909 Bacteria 3093
489 Ga0496107_0254004 3300048910 Bacteria 1308
490 Ga0496108_0172152 3300048911 Bacteria 1874
491 Ga0496109_0546809 3300048912 Bacteria 1092
492 Ga0496110_0014219 3300048913 Bacteria 6604
493 Ga0496112_0064550 3300048915 Bacteria 3613
494 Ga0496112_0217832 3300048915 Bacteria 1865
495 Ga0496113_0087015 3300048916 Bacteria 2402
496 Ga0496113_0100222 3300048916 Bacteria 2244
497 Ga0496113_0700767 3300048916 Bacteria 808
498 Ga0496114_0004430 3300048917 Bacteria 10897
499 Ga0496114_0072593 3300048917 Bacteria 2895
500 Ga0496115_0287230 3300048918 Bacteria 1350
501 Ga0496115_0327385 3300048918 Bacteria 1252
502 Ga0496115_0569738 3300048918 Bacteria 903
503 Ga0496116_0022407 3300048919 Bacteria 4733
504 Ga0496117_0000155 3300048920 Bacteria 146091
505 Ga0496118_0000066 3300048921 Bacteria 207678
506 Ga0496119_0029988 3300048922 Bacteria 3674
507 Ga0496120_0036176 3300048923 Bacteria 2941
508 Ga0496121_0224672 3300048924 Bacteria 1320
509 Ga0496121_0282089 3300048924 Bacteria 1135
510 Ga0496124_0039210 3300048927 Bacteria 4107
511 Ga0496125_0007912 3300048928 Bacteria 11223
512 Ga0496125_0017446 3300048928 Bacteria 6842
513 Ga0496126_0008998 3300048929 Bacteria 10683
514 Ga0501034_0856881 3300049571 Bacteria 798
515 Ga0501036_0371583 3300049572 Bacteria 1194
516 Ga0501036_0667708 3300049572 Bacteria 860
517 Ga0501037_0686984 3300049573 Bacteria 682
518 Ga0501038_0277462 3300049574 Bacteria 1320
519 Ga0501038_0634149 3300049574 Bacteria 806
520 Ga0501043_0418421 3300049579 Bacteria 1010
521 Ga0501046_0159380 3300049580 Bacteria 1698
522 Ga0501046_0208143 3300049580 Bacteria 1453
523 Ga0501047_0015416 3300049581 Bacteria 7281
524 Ga0501048_0284847 3300049582 Bacteria 1175
525 Ga0501067_0045099 3300049583 Bacteria 2449
526 Ga0501068_0003560 3300049584 Bacteria 8417
527 Ga0501068_0323230 3300049584 Bacteria 989
528 Ga0501070_0025942 3300049586 Bacteria 4917
529 Ga0501070_0626413 3300049586 Bacteria 856
530 Ga0501071_0217632 3300049587 Bacteria 1437
531 Ga0501073_0069109 3300049589 Bacteria 2461
532 Ga0501073_0203398 3300049589 Bacteria 1369
533 Ga0501075_0046292 3300049591 Bacteria 3268
534 Ga0501075_0429999 3300049591 Bacteria 1007
535 Ga0501076_0277357 3300049592 Bacteria 1373
536 Ga0501077_0010615 3300049593 Bacteria 5736
537 Ga0501080_0005002 3300049742 Bacteria 11805
538 Ga0501083_0012278 3300049744 Bacteria 5995
539 Ga0501035_0181732 3300049822 Bacteria 1812
540 Ga0501044_0033312 3300049823 Bacteria 5415
541 Ga0501044_0066855 3300049823 Bacteria 3664
542 Ga0501044_0155186 3300049823 Bacteria 2269
543 nmdc:mga05p37_191298_c1 3300050507 Bacteria 2484
544 nmdc:mga05p37_424653_c1 3300050507 Bacteria 1546
545 nmdc:mga09592_153751_c1 3300050508 Bacteria 1985
546 nmdc:mga0qj67_93078_c1 3300050509 Bacteria 2423
547 nmdc:mga06r32_152130_c1 3300050510 Bacteria 2293
548 nmdc:mga06r32_215477_c1 3300050510 Bacteria 1908
549 nmdc:mga06r32_785477_c1 3300050510 Bacteria 913
550 nmdc:mga06r32_871299_c1 3300050510 Bacteria 858
551 nmdc:mga08y16_26_c1 3300050511 Bacteria 223965
552 nmdc:mga08y16_339432_c1 3300050511 Bacteria 1544
553 nmdc:mga08y16_71915_c1 3300050511 Bacteria 3604
554 nmdc:mga0n895_289461_c1 3300050512 Bacteria 1661
555 nmdc:mga0n895_58048_c1 3300050512 Bacteria 3816
556 nmdc:mga0rr50_169230_c1 3300050513 Bacteria 1779
557 nmdc:mga0rr50_334321_c1 3300050513 Bacteria 1272
558 nmdc:mga08x19_265403_c1 3300050514 Bacteria 1187
559 nmdc:mga08x19_61466_c1 3300050514 Bacteria 2434
560 nmdc:mga08x19_79989_c1 3300050514 Bacteria 2144
561 nmdc:mga0a205_47420_c1 3300050515 Bacteria 4145
562 Ga0495601_0020516 3300053077 Bacteria 4037
563 Ga0495601_0132853 3300053077 Bacteria 1621
564 Ga0495612_0040285 3300053078 Unclassified 1903
565 Ga0495595_0112578 3300053084 Bacteria 1321
566 Ga0495619_0237768 3300053085 Bacteria 1262
567 Ga0500644_0095669 3300053088 Bacteria 1120
568 Ga0500647_0032684 3300053091 Bacteria 2480
569 Ga0500583_0022400 3300053092 Bacteria 2646
570 Ga0500583_0119315 3300053092 Bacteria 1304
571 Ga0500566_0001563 3300053094 Bacteria 13446
572 Ga0500566_0005151 3300053094 Bacteria 7787
573 Ga0500640_006117 3300053095 Bacteria 4565
574 Ga0500641_0287068 3300053096 Bacteria 680
575 Ga0500554_000195 3300053102 Bacteria 12748
576 Ga0500554_018540 3300053102 Bacteria 1881
577 Ga0500556_0109266 3300053104 Bacteria 1071
578 Ga0500562_020784 3300053108 Bacteria 1705
579 Ga0500572_003034 3300053111 Bacteria 3915
580 Ga0500595_000381 3300053119 Bacteria 28625
581 Ga0500595_045322 3300053119 Bacteria 1389
582 Ga0500597_006548 3300053120 Bacteria 3877
583 Ga0500597_081860 3300053120 Bacteria 1401
584 Ga0500614_000293 3300053123 Bacteria 12887
585 Ga0500614_019556 3300053123 Bacteria 1553
586 Ga0500614_161702 3300053123 Bacteria 679
587 Ga0500617_077922 3300053124 Bacteria 1441
588 Ga0500642_0063389 3300053130 Bacteria 1665
589 Ga0500658_0016366 3300053134 Bacteria 2763
590 Ga0500658_0046676 3300053134 Bacteria 1755
591 Ga0500559_0026585 3300053136 Bacteria 2466
592 Ga0500564_027982 3300053138 Bacteria 2596
593 Ga0500577_0378875 3300053142 Bacteria 619
594 Ga0500585_062316 3300053144 Bacteria 1343
595 Ga0500585_189319 3300053144 Bacteria 693
596 Ga0500588_0005882 3300053146 Bacteria 2747
597 Ga0500603_012682 3300053150 Bacteria 1941
598 Ga0500616_0000030 3300053153 Bacteria 415224
599 Ga0500633_0066439 3300053160 Bacteria 1280
600 Ga0500638_079925 3300053162 Bacteria 1554
601 Ga0500636_0293026 3300053177 Bacteria 806
602 Ga0500576_088160 3300053725 Bacteria 1295
603 Ga0500601_011578 3300053737 Bacteria 991
604 Ga0501084_0887713 3300054114 Bacteria 750
605 Ga0590071_007065 3300059421 Bacteria 2657
606 Ga0590077_021723 3300059426 Bacteria 1368
607 Ga0587082_038120 3300059504 Bacteria 869
608 Ga0587088_077231 3300059508 Bacteria 706
609 Ga0587092_031669 3300059512 Bacteria 878
610 Ga0587067_092321 3300059640 Bacteria 688
611 Ga0587107_062877 3300059652 Bacteria 659
612 Ga0501082_0208927 3300060353 Bacteria 1698
613 Ga0530510_0385917 3300061734 Bacteria 1054
614 Ga0495603_0419963
615 JGI25406J46586_10020875
616 rootL2_10154766
617 Ga0055542_1010010
618 Ga0055530_10062555
619 Ga0058859_11380943
620 Ga0065707_10089556
621 Ga0065707_10192738
622 Ga0070658_10076262
623 Ga0070683_100027027
624 Ga0070690_100006055
625 Ga0070690_100088413
626 Ga0070670_100040142
627 Ga0070670_100086395
628 Ga0070670_100327717
629 Ga0070666_10041689
630 Ga0070666_10048609
631 Ga0068868_100006782
632 Ga0070660_100184517
633 Ga0070689_100020265
634 Ga0070689_100208304
635 Ga0070687_100689670
636 Ga0070661_100020418
637 Ga0070661_100073380
638 Ga0070668_100049173
639 Ga0070669_100013730
640 Ga0070669_100072168
641 Ga0070675_100004789
642 Ga0070671_100003787
643 Ga0070671_100048124
644 Ga0070671_100110819
645 Ga0070671_100630227
646 Ga0070673_100043372
647 Ga0070688_100179377
648 Ga0070659_100237228
649 Ga0070667_100049122
650 Ga0070667_100500673
651 Ga0070667_100752225
652 Ga0070703_10280281
653 Ga0070709_10010121
654 Ga0070709_10318037
655 Ga0070713_100014773
656 Ga0070711_100059157
657 Ga0070711_100553360
658 Ga0070694_100067638
659 Ga0070663_100105874
660 Ga0070663_100301538
661 Ga0070678_100399183
662 Ga0070662_100277657
663 Ga0070681_10186513
664 Ga0070681_11169236
665 Ga0068867_100013255
666 Ga0068867_100022115
667 Ga0068867_100813697
668 Ga0070706_100003129
669 Ga0070707_100109624
670 Ga0070707_100359470
671 Ga0070707_101066373
672 Ga0070698_101322999
673 Ga0070699_100009743
674 Ga0070699_100264232
675 Ga0070679_100040724
676 Ga0070684_100191986
677 Ga0068853_100046192
678 Ga0070672_100014689
679 Ga0070686_100012709
680 Ga0070696_100004667
681 Ga0070696_100317221
682 Ga0070696_100751517
683 Ga0070693_100041209
684 Ga0070693_100088730
685 Ga0070693_100335596
686 Ga0070665_100025868
687 Ga0070665_100366123
688 Ga0070704_101308764
689 Ga0068855_100141927
690 Ga0068855_100330155
691 Ga0068855_100486243
692 Ga0070664_100025818
693 Ga0068857_100335965
694 Ga0068857_100542475
695 Ga0068857_101043182
696 Ga0068854_100498490
697 Ga0068856_100138999
698 Ga0070702_100017608
699 Ga0070702_100027187
700 Ga0070702_100148208
701 Ga0068852_100026655
702 Ga0068852_100115573
703 Ga0068859_100032106
704 Ga0068859_100039097
705 Ga0068859_100139824
706 Ga0068864_100038887
707 Ga0068864_100075405
708 Ga0068864_100109164
709 Ga0068864_100692913
710 Ga0068861_100004518
711 Ga0068851_10012874
712 Ga0068870_10023846
713 Ga0068870_10041456
714 Ga0068863_100001038
715 Ga0068863_100018489
716 Ga0068863_100083255
717 Ga0068863_100084971
718 Ga0068863_100162493
719 Ga0068858_100019180
720 Ga0068858_100103613
721 Ga0068860_100005532
722 Ga0068860_100063092
723 Ga0068860_100125024
724 Ga0068862_100008333
725 Ga0068862_100975390
726 Ga0068862_101386898
727 Ga0081455_10000574
728 Ga0081455_10055314
729 Ga0081539_10000105
730 Ga0081539_10018446
731 Ga0070717_10538789
732 Ga0070717_10937728
733 Ga0075365_10031454
734 Ga0070715_10004618
735 Ga0070715_10429890
736 Ga0070716_100020156
737 Ga0070716_100045533
738 Ga0070712_100388215
739 Ga0070712_100572754
740 Ga0070712_100880058
741 Ga0097621_100065634
742 Ga0068871_100173250
743 Ga0068871_100367813
744 Ga0075428_100044859
745 Ga0075428_100083468
746 Ga0075428_100319423
747 Ga0075430_100087425
748 Ga0075430_100325480
749 Ga0075431_100114802
750 Ga0075431_100476274
751 Ga0075431_101247634
752 Ga0075433_10226659
753 Ga0075433_10331988
754 Ga0075434_100294349
755 Ga0075429_100948527
756 Ga0068865_100923931
757 Ga0075436_100041309
758 Ga0097620_100032106
759 Ga0097620_100039094
760 Ga0097620_100139829
761 Ga0075435_100251859
762 Ga0075435_100535940
763 Ga0099794_10011865
764 Ga0105240_10227039
765 Ga0105240_10502355
766 Ga0105240_10563255
767 Ga0111539_10090392
768 Ga0111539_10225665
769 Ga0111539_10391580
770 Ga0105245_10006367
771 Ga0105247_10014095
772 Ga0105247_10033142
773 Ga0114129_10091032
774 Ga0114129_10181414
775 Ga0114129_10277904
776 Ga0105243_10028869
777 Ga0105243_10295283
778 Ga0105241_11199510
779 Ga0105242_10258392
780 Ga0105248_10036849
781 Ga0105248_10079926
782 Ga0105248_10086413
783 Ga0105248_10149750
784 Ga0105248_10925774
785 Ga0105237_10663828
786 Ga0105237_10696324
787 Ga0105237_10928523
788 Ga0105238_10027002
789 Ga0105238_10519114
790 Ga0105238_10689120
791 Ga0105249_10360521
792 Ga0105249_10567936
793 Ga0105249_11040165
794 Ga0105239_10854086
795 Ga0105246_10002904
796 Ga0105246_10081812
797 Ga0157373_10179720
798 Ga0157369_10005846
799 Ga0157369_10195179
800 Ga0157369_10347463
801 Ga0157378_10669463
802 Ga0163162_10060267
803 Ga0163162_10133306
804 Ga0163162_10371835
805 Ga0157372_10210531
806 Ga0157372_10274814
807 Ga0157372_10728486
808 Ga0157375_10097245
809 Ga0157375_10218950
810 Ga0163163_10033262
811 Ga0163163_10267263
812 Ga0157380_10117867
813 Ga0157379_10022799
814 Ga0157379_10127707
815 Ga0157376_10115910
816 Ga0157376_10190924
817 Ga0157376_10338671
818 Ga0163161_10053428
819 Ga0213872_10063699
820 Ga0228598_1003032
821 Ga0209258_114192
822 Ga0209148_1000826
823 Ga0209455_1000826
824 Ga0209758_1000070
825 Ga0209758_1042838
826 Ga0209050_1023510
827 Ga0207426_1048510
828 Ga0209051_1020227
829 Ga0209257_1000296
830 Ga0207656_10038242
831 Ga0207653_10005707
832 Ga0207692_10224294
833 Ga0207647_10391459
834 Ga0207685_10018081
835 Ga0207699_10336661
836 Ga0207643_10037032
837 Ga0207705_10012162
838 Ga0207705_10100829
839 Ga0207705_10671329
840 Ga0207684_10043436
841 Ga0207684_10229354
842 Ga0207654_10757820
843 Ga0207707_10274163
844 Ga0207695_10016351
845 Ga0207695_10531069
846 Ga0207695_10626787
847 Ga0207671_10077169
848 Ga0207671_10531961
849 Ga0207693_10341015
850 Ga0207663_10050434
851 Ga0207663_10062957
852 Ga0207663_10109518
853 Ga0207662_10558055
854 Ga0207657_10011942
855 Ga0207649_10027711
856 Ga0207649_10071106
857 Ga0207649_10720795
858 Ga0207652_10124812
859 Ga0207652_10582643
860 Ga0207646_10853003
861 Ga0207681_10296412
862 Ga0207694_10106666
863 Ga0207694_10210374
864 Ga0207650_10950166
865 Ga0207659_10021492
866 Ga0207687_10781262
867 Ga0207700_10043298
868 Ga0207700_10102591
869 Ga0207664_10164628
870 Ga0207664_10787670
871 Ga0207644_10059508
872 Ga0207644_10150992
873 Ga0207644_11039509
874 Ga0207706_10279993
875 Ga0207686_10166730
876 Ga0207709_10472859
877 Ga0207709_10552840
878 Ga0207670_10445824
879 Ga0207665_10031381
880 Ga0207665_10133273
881 Ga0207691_10005729
882 Ga0207711_10117965
883 Ga0207711_10573655
884 Ga0207661_10088597
885 Ga0207679_10052017
886 Ga0207667_10118301
887 Ga0207667_10425919
888 Ga0207667_10554886
889 Ga0207667_11133250
890 Ga0207651_10024815
891 Ga0207712_10200205
892 Ga0207712_10531069
893 Ga0207712_10691268
894 Ga0207712_10812512
895 Ga0207668_10796327
896 Ga0207658_10537896
897 Ga0207677_10124666
898 Ga0207703_10002110
899 Ga0207703_10276467
900 Ga0207639_10041200
901 Ga0207678_10009792
902 Ga0207678_10157428
903 Ga0207702_10349154
904 Ga0207702_10364080
905 Ga0207702_10912068
906 Ga0207641_10000884
907 Ga0207641_10059598
908 Ga0207641_10129178
909 Ga0207641_10143736
910 Ga0207648_10021726
911 Ga0207676_10378930
912 Ga0207676_10706036
913 Ga0207674_10610524
914 Ga0207675_100009297
915 Ga0207683_10310577
916 Ga0207683_10330340
917 Ga0207683_10715083
918 Ga0207698_10087196
919 Ga0207698_10130080
920 Ga0209179_1063562
921 Ga0209970_1007248
922 Ga0209983_1003339
923 Ga0209971_1000615
924 Ga0209974_10011606
925 Ga0207428_10000016
926 Ga0268266_10034023
927 Ga0268266_10122610
928 Ga0268266_10198533
929 Ga0268265_10032607
930 Ga0268265_10699702
931 Ga0268264_10000213
932 Ga0268264_10092173
933 Ga0268264_10395703
934 Ga0268264_10444476
935 Ga0265762_1002299
936 Ga0265767_100371
937 Ga0265760_10120721
938 Ga0307513_10078452
939 Ga0307513_10112553
940 Ga0307509_10000026
941 Ga0307408_100435700
942 Ga0307508_10022803
943 Ga0307508_10140460
944 Ga0307410_10208830
945 Ga0307410_10484871
946 Ga0307406_10942318
947 Ga0307412_10112823
948 Ga0307416_100218596
949 Ga0307416_100244606
950 Ga0307416_100367956
951 Ga0307415_101436210
952 Ga0373932_0044677
953 Ga0373939_0228812
954 Ga0373954_0253077
955 Ga0373956_0206198
956 Ga0373956_0359538
957 Ga0373960_0136757
958 Ga0373943_0079306
959 Ga0373931_0026179
960 Ga0373931_0083702
961 Ga0373935_0048884
962 Ga0373937_0004321
963 Ga0373937_0008337
964 Ga0373925_0050654
965 Ga0395900_0356167
966 Ga0395900_0527641
967 Ga0395898_0109345
968 Ga0395901_0188672
969 Ga0242419_003848
970 Ga0436361_0171979
971 Ga0436363_0286024
972 Ga0451802_1638322
973 Ga0450904_000207
974 Ga0466964_0207571
975 Ga0466971_0163175
976 Ga0466960_0281791
977 Ga0451576_0264344
978 Ga0466958_0001142
979 Ga0495617_001473
980 Ga0495627_001417
981 Ga0495592_0069966
982 Ga0495629_0122444
983 Ga0495651_0052233
984 Ga0495650_0074512
985 Ga0495650_0099659
986 Ga0495580_0081516
987 Ga0495580_0269540
988 Ga0495605_0002566
989 Ga0495605_0065834
990 Ga0495662_0123584
991 Ga0495584_0012836
992 Ga0495584_0063992
993 Ga0495584_0192536
994 Ga0495585_0000775
995 Ga0495585_0145532
996 Ga0495585_0379207
997 Ga0495596_0003663
998 Ga0495596_0034010
999 Ga0495596_0036403
1000 Ga0495596_0080314
1001 Ga0495607_0004445
1002 Ga0495607_0026763
1003 Ga0495583_0003742
1004 Ga0495583_0047308
1005 Ga0495583_0207339
1006 Ga0495606_0255753
1007 Ga0495610_0133102
1008 Ga0495616_0000665
1009 Ga0495616_0014589
1010 Ga0495616_0131508
1011 Ga0495616_0185850
1012 Ga0495618_0462143
1013 Ga0495628_0049921
1014 Ga0495628_0197847
1015 Ga0495631_0011775
1016 Ga0495631_0107514
1017 Ga0495632_0003555
1018 Ga0495637_0016013
1019 Ga0495643_0001205
1020 Ga0495643_0004052
1021 Ga0495648_0066518
1022 Ga0495642_0001343
1023 Ga0495642_0003053
1024 Ga0495642_0161866
1025 Ga0495652_0063358
1026 Ga0495654_0095724
1027 Ga0495654_0120106
1028 Ga0495640_0064841
1029 Ga0495640_0195623
1030 Ga0495587_0023785
1031 Ga0495609_0025910
1032 Ga0495609_0170309
1033 Ga0495597_0005559
1034 Ga0495597_0010931
1035 Ga0495597_0145492
1036 Ga0495622_0054660
1037 Ga0495622_0092829
1038 Ga0495633_0046518
1039 Ga0495656_0009418
1040 Ga0495668_0002311
1041 Ga0495668_0004149
1042 Ga0495634_0086363
1043 Ga0495611_0022249
1044 Ga0495611_0089864
1045 Ga0495611_0135596
1046 Ga0495625_0160716
1047 Ga0495625_0189151
1048 Ga0495661_0009965
1049 Ga0495661_0011037
1050 Ga0495661_0012955
1051 Ga0495661_0124717
1052 Ga0495661_0159139
1053 Ga0495588_0096786
1054 Ga0495599_0161212
1055 Ga0495599_0179016
1056 Ga0495623_0089606
1057 Ga0495669_0001151
1058 Ga0495669_0091110
1059 Ga0495624_0242595
1060 Ga0495670_0007522
1061 Ga0495670_0042864
1062 Ga0495670_0145681
1063 Ga0495670_0160368
1064 Ga0495671_0003065
1065 Ga0495671_0166705
1066 Ga0495649_0256858
1067 Ga0495589_0001109
1068 Ga0495589_0235155
1069 Ga0495660_0050502
1070 Ga0495581_0193828
1071 Ga0495581_0268559
1072 Ga0495604_0375352
1073 Ga0495674_0120258
1074 Ga0495674_0221755
1075 Ga0495674_0262662
1076 Ga0495672_0055955
1077 Ga0495672_0057750
1078 Ga0495672_0062830
1079 Ga0495676_0007156
1080 Ga0495687_004013
1081 Ga0495677_0016053
1082 Ga0495677_0030028
1083 Ga0495677_0036894
1084 Ga0495681_0003176
1085 Ga0495684_0425163
1086 Ga0495602_0066759
1087 Ga0495602_0102839
1088 Ga0495615_0023201
1089 Ga0495626_0010592
1090 Ga0495626_0029091
1091 Ga0495626_0062769
1092 Ga0495626_0082986
1093 Ga0495626_0117182
1094 Ga0496100_0979667
1095 Ga0496102_0003105
1096 Ga0496102_0513016
1097 Ga0496103_0037505
1098 Ga0496103_0110766
1099 Ga0496104_0234417
1100 Ga0496104_0767558
1101 Ga0496106_0051884
1102 Ga0496107_0254004
1103 Ga0496108_0172152
1104 Ga0496109_0546809
1105 Ga0496110_0014219
1106 Ga0496112_0064550
1107 Ga0496112_0217832
1108 Ga0496113_0087015
1109 Ga0496113_0100222
1110 Ga0496113_0700767
1111 Ga0496114_0004430
1112 Ga0496114_0072593
1113 Ga0496115_0287230
1114 Ga0496115_0327385
1115 Ga0496115_0569738
1116 Ga0496116_0022407
1117 Ga0496117_0000155
1118 Ga0496118_0000066
1119 Ga0496119_0029988
1120 Ga0496120_0036176
1121 Ga0496121_0224672
1122 Ga0496121_0282089
1123 Ga0496124_0039210
1124 Ga0496125_0007912
1125 Ga0496125_0017446
1126 Ga0496126_0008998
1127 Ga0501034_0856881
1128 Ga0501036_0371583
1129 Ga0501036_0667708
1130 Ga0501037_0686984
1131 Ga0501038_0277462
1132 Ga0501038_0634149
1133 Ga0501043_0418421
1134 Ga0501046_0159380
1135 Ga0501046_0208143
1136 Ga0501047_0015416
1137 Ga0501048_0284847
1138 Ga0501067_0045099
1139 Ga0501068_0003560
1140 Ga0501068_0323230
1141 Ga0501070_0025942
1142 Ga0501070_0626413
1143 Ga0501071_0217632
1144 Ga0501073_0069109
1145 Ga0501073_0203398
1146 Ga0501075_0046292
1147 Ga0501075_0429999
1148 Ga0501076_0277357
1149 Ga0501077_0010615
1150 Ga0501080_0005002
1151 Ga0501083_0012278
1152 Ga0501035_0181732
1153 Ga0501044_0033312
1154 Ga0501044_0066855
1155 Ga0501044_0155186
1156 nmdc:mga05p37_191298_c1
1157 nmdc:mga05p37_424653_c1
1158 nmdc:mga09592_153751_c1
1159 nmdc:mga0qj67_93078_c1
1160 nmdc:mga06r32_152130_c1
1161 nmdc:mga06r32_215477_c1
1162 nmdc:mga06r32_785477_c1
1163 nmdc:mga06r32_871299_c1
1164 nmdc:mga08y16_26_c1
1165 nmdc:mga08y16_339432_c1
1166 nmdc:mga08y16_71915_c1
1167 nmdc:mga0n895_289461_c1
1168 nmdc:mga0n895_58048_c1
1169 nmdc:mga0rr50_169230_c1
1170 nmdc:mga0rr50_334321_c1
1171 nmdc:mga08x19_265403_c1
1172 nmdc:mga08x19_61466_c1
1173 nmdc:mga08x19_79989_c1
1174 nmdc:mga0a205_47420_c1
1175 Ga0495601_0020516
1176 Ga0495601_0132853
1177 Ga0495612_0040285
1178 Ga0495595_0112578
1179 Ga0495619_0237768
1180 Ga0500644_0095669
1181 Ga0500647_0032684
1182 Ga0500583_0022400
1183 Ga0500583_0119315
1184 Ga0500566_0001563
1185 Ga0500566_0005151
1186 Ga0500640_006117
1187 Ga0500641_0287068
1188 Ga0500554_000195
1189 Ga0500554_018540
1190 Ga0500556_0109266
1191 Ga0500562_020784
1192 Ga0500572_003034
1193 Ga0500595_000381
1194 Ga0500595_045322
1195 Ga0500597_006548
1196 Ga0500597_081860
1197 Ga0500614_000293
1198 Ga0500614_019556
1199 Ga0500614_161702
1200 Ga0500617_077922
1201 Ga0500642_0063389
1202 Ga0500658_0016366
1203 Ga0500658_0046676
1204 Ga0500559_0026585
1205 Ga0500564_027982
1206 Ga0500577_0378875
1207 Ga0500585_062316
1208 Ga0500585_189319
1209 Ga0500588_0005882
1210 Ga0500603_012682
1211 Ga0500616_0000030
1212 Ga0500633_0066439
1213 Ga0500638_079925
1214 Ga0500636_0293026
1215 Ga0500576_088160
1216 Ga0500601_011578
1217 Ga0501084_0887713
1218 Ga0590071_007065
1219 Ga0590077_021723
1220 Ga0587082_038120
1221 Ga0587088_077231
1222 Ga0587092_031669
1223 Ga0587067_092321
1224 Ga0587107_062877
1225 Ga0501082_0208927
1226 Ga0530510_0385917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

54

147

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.9883 3 188
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.9627 3 188
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7843 22 170
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7291 24 165
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7149 22 170
ID Description Score Start End Superfamily
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.9905 3 188 3.90.1590.10
1xa8D00 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.9647 3 188 3.90.1590.10
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.7429 24 166 3.90.1590.10
3facD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7007 24 166 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.6998 24 166 3.90.1590.10
ID Description Score Start End GO Terms
AF-Q1ZSL8-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.-.-) 0.9975 90 185 GO:0016846
GO:0046872
AF-A0A4Q0QI08-F1-model_v4 Glutathione-dependent formaldehyde-activating protein 0.9967 79 186 GO:0016846
GO:0046872
AF-A0A523PIR7-F1-model_v4 S-(hydroxymethyl)glutathione synthase (EC 4.4.1.22) 0.9962 2 163 GO:0008270
GO:0046294
GO:0051907
AF-F0C8V4-F1-model_v4 deleted 0.9962 67 188
AF-A6FDY1-F1-model_v4 Glutathione-dependent formaldehyde-activating enzyme (EC 4.4.1.22) (S-(hydroxymethyl)glutathione synthase) 0.9957 3 184 GO:0008270
GO:0046294
GO:0051907

Map