F469192

General Info

Members Datasets Scaffolds Average Seq Length
612 228 1224 249

Family's Representative Sequence

Representative Sequence 3300049590|Ga0501074_0167527|Ga0501074_0167527_697_1530
Length 277
Sequence LGGRLRGAPFVLDRHVSAAYVRRVLFPYRAENETVRTPIITIALIAINVLVWMVVQRAGREPWVAATVCNLGLVPGELTLRASVGDSFPLGQGLSCVVDPGRAPEHILTSMFLHGGWMHLLGNMWFLWLFGNNIEDSMGRVRFVLFYLICGVAAAAGQVLSDPESIIPMVGASGAISGVMGAYIVLYPRVRVYTLVTFIFITSIALPAWVMLGYWMFLQVIGGFGASTEGGTAFWAHIGGFIAGVVLIKLFARSDYIARHRAHHWRPRRYGMQDHWR

Samples

Sample ID Description Type Environment
1 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
115 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
116 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
135 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
136 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
137 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
148 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
194 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
203 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
204 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
225 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
226 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.16
Nodule 0
Rhizoplane 0.82
Rhizosphere 98.69
Stem 0
Stem Tuber 0
Unclassified 13.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501074_0167527 3300049590 Bacteria 1568
2 JGI25405J52794_10033110 3300003911 Bacteria 1078
3 Ga0065704_10110844 3300005289 Bacteria 1971
4 Ga0065712_10000196 3300005290 Bacteria 21097
5 Ga0065712_10006875 3300005290 Bacteria 2499
6 Ga0065712_10100678 3300005290 Bacteria 2056
7 Ga0065715_10011932 3300005293 Bacteria 2916
8 Ga0065715_10016691 3300005293 Bacteria 2253
9 Ga0065715_10120344 3300005293 Unclassified 2260
10 Ga0065707_10004137 3300005295 Bacteria 3457
11 Ga0065707_10011428 3300005295 Bacteria 2789
12 Ga0065707_10096015 3300005295 Bacteria 3313
13 Ga0065707_10101981 3300005295 Bacteria 2834
14 Ga0065707_10185415 3300005295 Unclassified 1392
15 Ga0065707_10195917 3300005295 Bacteria 1335
16 Ga0070658_10134716 3300005327 Bacteria 2060
17 Ga0070676_10002244 3300005328 Bacteria 9862
18 Ga0070683_100070965 3300005329 Bacteria 3250
19 Ga0070670_100002623 3300005331 Bacteria 14850
20 Ga0070677_10230689 3300005333 Bacteria 909
21 Ga0070666_10010972 3300005335 Bacteria 5678
22 Ga0070666_10180716 3300005335 Unclassified 1479
23 Ga0070680_100005083 3300005336 Bacteria 9924
24 Ga0070680_100754674 3300005336 Bacteria 838
25 Ga0070660_100053963 3300005339 Bacteria 3101
26 Ga0070660_100253225 3300005339 Unclassified 1436
27 Ga0070660_100274581 3300005339 Unclassified 1378
28 Ga0070689_100120304 3300005340 Bacteria 2097
29 Ga0070689_100167877 3300005340 Bacteria 1777
30 Ga0070661_100447863 3300005344 Bacteria 1027
31 Ga0070668_100143070 3300005347 Bacteria 1929
32 Ga0070668_100292386 3300005347 Unclassified 1364
33 Ga0070675_100107279 3300005354 Bacteria 2358
34 Ga0070671_100075637 3300005355 Bacteria 2813
35 Ga0070671_100277649 3300005355 Unclassified 1424
36 Ga0070673_100320782 3300005364 Unclassified 1368
37 Ga0070688_100071399 3300005365 Bacteria 2223
38 Ga0070659_100129154 3300005366 Unclassified 2051
39 Ga0070709_10181590 3300005434 Bacteria 1478
40 Ga0070709_10438257 3300005434 Bacteria 982
41 Ga0070714_100173519 3300005435 Bacteria 1958
42 Ga0070705_100184297 3300005440 Bacteria 1417
43 Ga0070705_100557830 3300005440 Unclassified 879
44 Ga0070694_100191055 3300005444 Bacteria 1520
45 Ga0070708_100147178 3300005445 Bacteria 2188
46 Ga0070678_100112366 3300005456 Unclassified 2133
47 Ga0070678_100293068 3300005456 Bacteria 1380
48 Ga0070662_100045133 3300005457 Bacteria 3160
49 Ga0070662_100088524 3300005457 Bacteria 2320
50 Ga0070681_10006995 3300005458 Bacteria 10980
51 Ga0070706_100705506 3300005467 Bacteria 936
52 Ga0070679_100031218 3300005530 Bacteria 5262
53 Ga0070679_100078946 3300005530 Bacteria 3280
54 Ga0070679_100551951 3300005530 Bacteria 1096
55 Ga0070695_100110954 3300005545 Bacteria 1861
56 Ga0070695_100238077 3300005545 Bacteria 1319
57 Ga0070695_100277557 3300005545 Bacteria 1230
58 Ga0070696_100096230 3300005546 Bacteria 2116
59 Ga0070696_100153961 3300005546 Bacteria 1689
60 Ga0070693_100139402 3300005547 Unclassified 1525
61 Ga0070704_100002476 3300005549 Bacteria 10380
62 Ga0070704_100041931 3300005549 Bacteria 3163
63 Ga0070704_100247863 3300005549 Bacteria 1461
64 Ga0068855_100085684 3300005563 Bacteria 3644
65 Ga0070664_100005722 3300005564 Bacteria 10017
66 Ga0070664_100197404 3300005564 Bacteria 1794
67 Ga0070664_100711941 3300005564 Bacteria 936
68 Ga0068856_100198140 3300005614 Unclassified 2023
69 Ga0068859_100007047 3300005617 Bacteria 11418
70 Ga0068859_100266256 3300005617 Bacteria 1806
71 Ga0068859_100748083 3300005617 Bacteria 1066
72 Ga0068863_100177612 3300005841 Bacteria 2043
73 Ga0068863_100213433 3300005841 Bacteria 1859
74 Ga0068860_100033001 3300005843 Bacteria 4970
75 Ga0068860_100129048 3300005843 Bacteria 2425
76 Ga0081455_10001470 3300005937 Bacteria 29179
77 Ga0081455_10007638 3300005937 Bacteria 11357
78 Ga0081455_10034964 3300005937 Bacteria 4497
79 Ga0081455_10091715 3300005937 Bacteria 2460
80 Ga0081455_10092762 3300005937 Bacteria 2442
81 Ga0081538_10012960 3300005981 Bacteria 6638
82 Ga0081538_10026900 3300005981 Bacteria 4006
83 Ga0081538_10117866 3300005981 Bacteria 1284
84 Ga0081539_10122884 3300005985 Bacteria 1286
85 Ga0097621_100384681 3300006237 Unclassified 1254
86 Ga0068871_100796628 3300006358 Unclassified 871
87 Ga0075428_100008136 3300006844 Bacteria 11641
88 Ga0075428_100010231 3300006844 Bacteria 10418
89 Ga0075428_100070827 3300006844 Bacteria 3811
90 Ga0075428_100077583 3300006844 Bacteria 3626
91 Ga0075428_100157666 3300006844 Bacteria 2465
92 Ga0075428_100158814 3300006844 Bacteria 2454
93 Ga0075428_100180563 3300006844 Unclassified 2285
94 Ga0075428_100370757 3300006844 Unclassified 1535
95 Ga0075428_100509674 3300006844 Bacteria 1287
96 Ga0075428_100588417 3300006844 Unclassified 1189
97 Ga0075430_100027122 3300006846 Bacteria 4869
98 Ga0075430_100036846 3300006846 Unclassified 4146
99 Ga0075430_100406242 3300006846 Bacteria 1124
100 Ga0075430_100626795 3300006846 Bacteria 887
101 Ga0075431_100040168 3300006847 Bacteria 4821
102 Ga0075431_100050135 3300006847 Bacteria 4304
103 Ga0075431_100066531 3300006847 Bacteria 3721
104 Ga0075431_100091334 3300006847 Bacteria 3143
105 Ga0075431_100202408 3300006847 Bacteria 2031
106 Ga0075431_100223085 3300006847 Bacteria 1922
107 Ga0075431_100387801 3300006847 Bacteria 1400
108 Ga0075431_100636516 3300006847 Bacteria 1048
109 Ga0075433_10008949 3300006852 Bacteria 7993
110 Ga0075433_10009432 3300006852 Bacteria 7801
111 Ga0075433_10032233 3300006852 Bacteria 4488
112 Ga0075433_10075318 3300006852 Bacteria 2970
113 Ga0075434_100013115 3300006871 Bacteria 7871
114 Ga0075434_100111333 3300006871 Bacteria 2749
115 Ga0075434_100125789 3300006871 Unclassified 2580
116 Ga0075434_100202492 3300006871 Bacteria 2005
117 Ga0075434_100386931 3300006871 Unclassified 1419
118 Ga0075434_100735305 3300006871 Bacteria 1004
119 Ga0075429_100008815 3300006880 Bacteria 8770
120 Ga0075429_100160631 3300006880 Unclassified 1968
121 Ga0075429_100177685 3300006880 Unclassified 1865
122 Ga0075429_100551861 3300006880 Bacteria 1010
123 Ga0075436_100008033 3300006914 Bacteria 7224
124 Ga0097620_100007047 3300006931 Bacteria 11418
125 Ga0097620_100266252 3300006931 Bacteria 1806
126 Ga0097620_100748094 3300006931 Bacteria 1066
127 Ga0075435_100018855 3300007076 Bacteria 5258
128 Ga0111539_10013731 3300009094 Bacteria 10118
129 Ga0111539_10023421 3300009094 Bacteria 7587
130 Ga0111539_10120233 3300009094 Bacteria 3078
131 Ga0111539_10262968 3300009094 Bacteria 2008
132 Ga0111539_10287631 3300009094 Bacteria 1913
133 Ga0111539_10434136 3300009094 Bacteria 1529
134 Ga0111539_10504167 3300009094 Bacteria 1410
135 Ga0111539_10561030 3300009094 Bacteria 1330
136 Ga0111539_10832440 3300009094 Unclassified 1074
137 Ga0105245_10591674 3300009098 Bacteria 1135
138 Ga0114129_10000323 3300009147 Bacteria 56097
139 Ga0114129_10008096 3300009147 Bacteria 14978
140 Ga0114129_10071553 3300009147 Bacteria 4836
141 Ga0114129_10113588 3300009147 Bacteria 3735
142 Ga0114129_10158035 3300009147 Bacteria 3099
143 Ga0114129_10160530 3300009147 Unclassified 3071
144 Ga0114129_10638461 3300009147 Bacteria 1375
145 Ga0114129_10787483 3300009147 Unclassified 1214
146 Ga0105237_10224035 3300009545 Bacteria 1881
147 Ga0105238_10627825 3300009551 Bacteria 1084
148 Ga0105249_10086082 3300009553 Unclassified 2930
149 Ga0105239_10236462 3300010375 Unclassified 2050
150 Ga0157374_10277353 3300013296 Unclassified 1654
151 Ga0157374_10330847 3300013296 Bacteria 1511
152 Ga0157378_10185579 3300013297 Bacteria 1959
153 Ga0157378_10334681 3300013297 Unclassified 1474
154 Ga0157378_10665937 3300013297 Bacteria 1058
155 Ga0163162_10635140 3300013306 Unclassified 1192
156 Ga0157372_11035535 3300013307 Bacteria 950
157 Ga0163163_10130343 3300014325 Bacteria 2555
158 Ga0163163_10383166 3300014325 Bacteria 1464
159 Ga0163163_10558152 3300014325 Bacteria 1208
160 Ga0157380_10011160 3300014326 Bacteria 6483
161 Ga0157376_10339505 3300014969 Bacteria 1434
162 Ga0163161_10112922 3300017792 Bacteria 2033
163 Ga0207697_10004281 3300025315 Bacteria 6846
164 Ga0207682_10150714 3300025893 Unclassified 1049
165 Ga0207680_10097465 3300025903 Unclassified 1883
166 Ga0207699_10068257 3300025906 Bacteria 2165
167 Ga0207699_10471697 3300025906 Bacteria 903
168 Ga0207645_10112921 3300025907 Bacteria 1760
169 Ga0207705_10416090 3300025909 Unclassified 1040
170 Ga0207684_10167593 3300025910 Unclassified 1893
171 Ga0207707_10179260 3300025912 Bacteria 1850
172 Ga0207707_10227406 3300025912 Unclassified 1623
173 Ga0207671_10422213 3300025914 Unclassified 1061
174 Ga0207660_10233358 3300025917 Bacteria 1447
175 Ga0207649_10117114 3300025920 Bacteria 1790
176 Ga0207652_10097876 3300025921 Unclassified 2587
177 Ga0207650_10002858 3300025925 Bacteria 11921
178 Ga0207659_10052790 3300025926 Bacteria 2897
179 Ga0207659_10334923 3300025926 Unclassified 1252
180 Ga0207659_10342108 3300025926 Bacteria 1239
181 Ga0207687_10085494 3300025927 Bacteria 2288
182 Ga0207664_10259298 3300025929 Bacteria 1520
183 Ga0207644_10156366 3300025931 Unclassified 1768
184 Ga0207690_10005633 3300025932 Bacteria 7402
185 Ga0207706_10280927 3300025933 Unclassified 1452
186 Ga0207670_10366499 3300025936 Bacteria 1144
187 Ga0207704_10476825 3300025938 Unclassified 1001
188 Ga0207661_10136079 3300025944 Bacteria 2110
189 Ga0207661_10222789 3300025944 Bacteria 1668
190 Ga0207679_10005377 3300025945 Bacteria 8027
191 Ga0207679_10216385 3300025945 Bacteria 1610
192 Ga0207679_10445533 3300025945 Bacteria 1147
193 Ga0207667_10407380 3300025949 Unclassified 1384
194 Ga0207640_10392248 3300025981 Unclassified 1128
195 Ga0207639_10093074 3300026041 Bacteria 2416
196 Ga0207678_10115358 3300026067 Bacteria 2291
197 Ga0207708_10418005 3300026075 Bacteria 1111
198 Ga0207641_10314676 3300026088 Unclassified 1483
199 Ga0207641_10375940 3300026088 Bacteria 1359
200 Ga0207675_100332527 3300026118 Bacteria 1485
201 Ga0207675_100449364 3300026118 Unclassified 1277
202 Ga0207675_100704704 3300026118 Unclassified 1019
203 Ga0207683_10004154 3300026121 Bacteria 12535
204 Ga0207683_10148233 3300026121 Bacteria 2117
205 Ga0209973_1009944 3300027252 Bacteria 1117
206 Ga0209981_1020299 3300027378 Bacteria 947
207 Ga0210000_1002752 3300027462 Bacteria 2510
208 Ga0209995_1008619 3300027471 Bacteria 1646
209 Ga0209971_1006834 3300027682 Bacteria 2704
210 Ga0209974_10021947 3300027876 Bacteria 2113
211 Ga0209974_10026970 3300027876 Bacteria 1901
212 Ga0207428_10011184 3300027907 Bacteria 7960
213 Ga0207428_10025257 3300027907 Bacteria 4974
214 Ga0268264_10105713 3300028381 Bacteria 2456
215 Ga0268264_10536873 3300028381 Unclassified 1145
216 Ga0265336_10007772 3300028666 Bacteria 3800
217 Ga0265338_10001115 3300028800 Bacteria 44587
218 Ga0307511_10022420 3300030521 Bacteria 5917
219 Ga0265328_10000280 3300031239 Bacteria 23796
220 Ga0265320_10002363 3300031240 Bacteria 13201
221 Ga0265339_10010416 3300031249 Bacteria 5776
222 Ga0265339_10084261 3300031249 Bacteria 1675
223 Ga0307408_100103980 3300031548 Bacteria 2169
224 Ga0265314_10030286 3300031711 Bacteria 4007
225 Ga0265342_10000065 3300031712 Bacteria 112156
226 Ga0265342_10007901 3300031712 Bacteria 7712
227 Ga0307405_10076159 3300031731 Bacteria 2176
228 Ga0307405_10192517 3300031731 Unclassified 1474
229 Ga0307413_10112552 3300031824 Bacteria 1825
230 Ga0307413_10128292 3300031824 Bacteria 1731
231 Ga0307413_10360854 3300031824 Bacteria 1125
232 Ga0307410_10018740 3300031852 Bacteria 4190
233 Ga0307406_10051753 3300031901 Bacteria 2609
234 Ga0307406_10235341 3300031901 Bacteria 1370
235 Ga0307407_10068718 3300031903 Bacteria 2100
236 Ga0307407_10477414 3300031903 Unclassified 910
237 Ga0307412_10022370 3300031911 Bacteria 3875
238 Ga0307409_100122484 3300031995 Bacteria 2205
239 Ga0307409_100162287 3300031995 Bacteria 1956
240 Ga0307409_100168814 3300031995 Bacteria 1923
241 Ga0307409_100369696 3300031995 Bacteria 1359
242 Ga0307416_100021233 3300032002 Bacteria 4656
243 Ga0307416_100044932 3300032002 Bacteria 3473
244 Ga0307416_100280525 3300032002 Bacteria 1642
245 Ga0307416_100313323 3300032002 Unclassified 1567
246 Ga0307416_100408541 3300032002 Bacteria 1398
247 Ga0307416_100543308 3300032002 Bacteria 1234
248 Ga0307416_100649479 3300032002 Unclassified 1139
249 Ga0307416_100701495 3300032002 Bacteria 1101
250 Ga0307414_10000930 3300032004 Bacteria 14982
251 Ga0307414_10027346 3300032004 Bacteria 3685
252 Ga0307414_10498583 3300032004 Bacteria 1077
253 Ga0307411_10114285 3300032005 Bacteria 1939
254 Ga0307411_10262097 3300032005 Unclassified 1365
255 Ga0307415_100002926 3300032126 Bacteria 8565
256 Ga0307415_100076787 3300032126 Bacteria 2369
257 Ga0307415_100097661 3300032126 Bacteria 2145
258 Ga0307415_100104235 3300032126 Bacteria 2089
259 Ga0373956_0155680 3300035119 Bacteria 1076
260 Ga0373933_0000801 3300035724 Bacteria 19152
261 Ga0373937_0007263 3300036401 Bacteria 9589
262 Ga0373937_0007632 3300036401 Bacteria 9371
263 Ga0373937_0022832 3300036401 Bacteria 5628
264 Ga0439461_0006618 3300041410 Bacteria 2024
265 Ga0451853_0743606 3300041512 Bacteria 4519
266 Ga0439441_021580 3300042001 Bacteria 1190
267 Ga0439450_065172 3300042008 Bacteria 886
268 Ga0439455_0044768 3300042012 Unclassified 1142
269 Ga0439462_0041725 3300042015 Bacteria 1225
270 Ga0439446_0010305 3300042156 Bacteria 2516
271 Ga0439434_0005005 3300042435 Bacteria 3874
272 Ga0439434_0050502 3300042435 Bacteria 1289
273 Ga0439435_0014150 3300042436 Bacteria 1968
274 Ga0451577_0169005 3300042876 Bacteria 1970
275 Ga0453683_0223823 3300044673 Bacteria 1197
276 Ga0453684_0087279 3300044712 Unclassified 3867
277 Ga0451576_0006395 3300045051 Bacteria 14461
278 Ga0451576_0806836 3300045051 Bacteria 985
279 Ga0495603_0284984 3300046455 Bacteria 949
280 Ga0495629_0117730 3300046459 Bacteria 1851
281 Ga0495580_0000916 3300046472 Bacteria 25723
282 Ga0495580_0042927 3300046472 Bacteria 3219
283 Ga0495582_0065054 3300046473 Bacteria 2014
284 Ga0495639_0077970 3300046475 Bacteria 1539
285 Ga0495662_0099327 3300046476 Bacteria 1423
286 Ga0495664_0065345 3300046477 Bacteria 2169
287 Ga0495594_0057778 3300046499 Bacteria 2142
288 Ga0495608_0611736 3300046511 Bacteria 653
289 Ga0495618_0096705 3300046514 Bacteria 1888
290 Ga0495630_0142246 3300046517 Bacteria 1824
291 Ga0495643_0020917 3300046522 Bacteria 3764
292 Ga0495666_0014534 3300046526 Bacteria 3920
293 Ga0495640_0142025 3300046533 Bacteria 1547
294 Ga0495586_0002976 3300046535 Bacteria 9129
295 Ga0495598_0069761 3300046537 Archaea 1104
296 Ga0495667_0358716 3300046559 Bacteria 920
297 Ga0495634_0003467 3300046642 Bacteria 12632
298 Ga0495657_0327733 3300046675 Bacteria 909
299 Ga0495647_0007576 3300046681 Bacteria 3643
300 Ga0495658_0005220 3300046683 Bacteria 6388
301 Ga0495613_0103658 3300046689 Bacteria 2054
302 Ga0495624_0055739 3300046690 Bacteria 2489
303 Ga0495676_0102446 3300047321 Bacteria 2115
304 Ga0495680_0003966 3300047322 Bacteria 14313
305 Ga0495680_0441488 3300047322 Bacteria 892
306 Ga0496108_0174392 3300048911 Bacteria 1861
307 Ga0496108_0415595 3300048911 Unclassified 1175
308 Ga0496111_0361129 3300048914 Bacteria 1075
309 Ga0496112_0095375 3300048915 Bacteria 2945
310 Ga0496114_0426116 3300048917 Bacteria 1175
311 Ga0501303_011517 3300049526 Unclassified 842
312 Ga0501031_0006811 3300049568 Bacteria 7457
313 Ga0501031_0214096 3300049568 Bacteria 1255
314 Ga0501031_0247208 3300049568 Bacteria 1159
315 Ga0501031_0417961 3300049568 Bacteria 867
316 Ga0501032_0003055 3300049569 Bacteria 12964
317 Ga0501032_0016060 3300049569 Bacteria 5270
318 Ga0501032_0232314 3300049569 Bacteria 1199
319 Ga0501032_0404970 3300049569 Bacteria 876
320 Ga0501033_0008476 3300049570 Bacteria 7958
321 Ga0501033_0016105 3300049570 Bacteria 5661
322 Ga0501033_0265018 3300049570 Bacteria 1215
323 Ga0501034_0001012 3300049571 Bacteria 40282
324 Ga0501034_0048208 3300049571 Bacteria 4300
325 Ga0501034_0054352 3300049571 Bacteria 4031
326 Ga0501034_0065077 3300049571 Bacteria 3658
327 Ga0501034_0102559 3300049571 Bacteria 2854
328 Ga0501034_0607701 3300049571 Bacteria 998
329 Ga0501036_0005831 3300049572 Bacteria 9972
330 Ga0501036_0033333 3300049572 Bacteria 4356
331 Ga0501036_0208917 3300049572 Bacteria 1640
332 Ga0501036_0295794 3300049572 Unclassified 1354
333 Ga0501036_0307278 3300049572 Unclassified 1326
334 Ga0501036_0445862 3300049572 Bacteria 1078
335 Ga0501036_0590202 3300049572 Bacteria 922
336 Ga0501037_0021045 3300049573 Bacteria 4819
337 Ga0501037_0036555 3300049573 Bacteria 3619
338 Ga0501037_0166518 3300049573 Bacteria 1569
339 Ga0501037_0508693 3300049573 Bacteria 816
340 Ga0501038_0003218 3300049574 Bacteria 15235
341 Ga0501038_0051576 3300049574 Bacteria 3549
342 Ga0501038_0057810 3300049574 Bacteria 3328
343 Ga0501038_0148222 3300049574 Bacteria 1914
344 Ga0501038_0308124 3300049574 Bacteria 1241
345 Ga0501038_0407678 3300049574 Unclassified 1051
346 Ga0501038_0428465 3300049574 Bacteria 1020
347 Ga0501039_0002710 3300049575 Bacteria 13218
348 Ga0501039_0015383 3300049575 Bacteria 5856
349 Ga0501039_0024288 3300049575 Bacteria 4654
350 Ga0501039_0054204 3300049575 Bacteria 3104
351 Ga0501039_0091369 3300049575 Bacteria 2372
352 Ga0501039_0118446 3300049575 Bacteria 2074
353 Ga0501039_0274143 3300049575 Bacteria 1326
354 Ga0501040_0007754 3300049576 Bacteria 6948
355 Ga0501040_0083749 3300049576 Bacteria 2212
356 Ga0501040_0094372 3300049576 Bacteria 2081
357 Ga0501040_0226454 3300049576 Bacteria 1331
358 Ga0501040_0317905 3300049576 Bacteria 1113
359 Ga0501040_0374928 3300049576 Bacteria 1020
360 Ga0501041_0010025 3300049577 Bacteria 5583
361 Ga0501041_0013629 3300049577 Bacteria 4821
362 Ga0501041_0018360 3300049577 Bacteria 4168
363 Ga0501041_0022498 3300049577 Bacteria 3774
364 Ga0501041_0037414 3300049577 Unclassified 2941
365 Ga0501041_0054331 3300049577 Bacteria 2443
366 Ga0501041_0063746 3300049577 Bacteria 2256
367 Ga0501042_0010986 3300049578 Bacteria 6094
368 Ga0501042_0090946 3300049578 Bacteria 2190
369 Ga0501042_0102676 3300049578 Bacteria 2057
370 Ga0501042_0176895 3300049578 Bacteria 1539
371 Ga0501042_0178645 3300049578 Bacteria 1531
372 Ga0501042_0187067 3300049578 Bacteria 1494
373 Ga0501042_0202508 3300049578 Bacteria 1431
374 Ga0501042_0217030 3300049578 Bacteria 1380
375 Ga0501042_0565528 3300049578 Bacteria 826
376 Ga0501043_0000717 3300049579 Bacteria 29385
377 Ga0501043_0006508 3300049579 Bacteria 9373
378 Ga0501043_0060038 3300049579 Bacteria 2984
379 Ga0501043_0061047 3300049579 Bacteria 2960
380 Ga0501043_0103346 3300049579 Bacteria 2239
381 Ga0501046_0003103 3300049580 Bacteria 15326
382 Ga0501046_0025926 3300049580 Bacteria 4791
383 Ga0501046_0046987 3300049580 Bacteria 3424
384 Ga0501046_0069443 3300049580 Bacteria 2741
385 Ga0501046_0082419 3300049580 Bacteria 2484
386 Ga0501046_0091742 3300049580 Bacteria 2336
387 Ga0501046_0172898 3300049580 Bacteria 1620
388 Ga0501046_0189701 3300049580 Bacteria 1534
389 Ga0501046_0190593 3300049580 Bacteria 1529
390 Ga0501047_0003522 3300049581 Bacteria 14777
391 Ga0501047_0005715 3300049581 Bacteria 11705
392 Ga0501047_0386718 3300049581 Bacteria 1233
393 Ga0501047_0386878 3300049581 Bacteria 1232
394 Ga0501048_0000457 3300049582 Bacteria 28577
395 Ga0501048_0066647 3300049582 Bacteria 2545
396 Ga0501048_0067850 3300049582 Bacteria 2520
397 Ga0501048_0167604 3300049582 Bacteria 1555
398 Ga0501048_0206734 3300049582 Bacteria 1392
399 Ga0501048_0214340 3300049582 Bacteria 1365
400 Ga0501048_0286044 3300049582 Bacteria 1172
401 Ga0501067_0011735 3300049583 Bacteria 4854
402 Ga0501067_0029484 3300049583 Bacteria 3041
403 Ga0501067_0087898 3300049583 Bacteria 1724
404 Ga0501067_0189864 3300049583 Bacteria 1144
405 Ga0501068_0000248 3300049584 Bacteria 26557
406 Ga0501068_0030567 3300049584 Bacteria 3196
407 Ga0501068_0033677 3300049584 Bacteria 3051
408 Ga0501068_0044848 3300049584 Bacteria 2664
409 Ga0501068_0169675 3300049584 Bacteria 1377
410 Ga0501068_0186476 3300049584 Bacteria 1313
411 Ga0501068_0269824 3300049584 Bacteria 1086
412 Ga0501069_0001071 3300049585 Bacteria 13150
413 Ga0501069_0018462 3300049585 Bacteria 3764
414 Ga0501069_0034329 3300049585 Bacteria 2794
415 Ga0501070_0018171 3300049586 Bacteria 5898
416 Ga0501070_0043601 3300049586 Bacteria 3732
417 Ga0501070_0094637 3300049586 Bacteria 2472
418 Ga0501071_0000456 3300049587 Bacteria 20604
419 Ga0501071_0003473 3300049587 Bacteria 9845
420 Ga0501071_0017210 3300049587 Bacteria 4983
421 Ga0501071_0020252 3300049587 Bacteria 4621
422 Ga0501071_0106184 3300049587 Unclassified 2073
423 Ga0501071_0126858 3300049587 Bacteria 1894
424 Ga0501071_0136319 3300049587 Bacteria 1826
425 Ga0501072_0001597 3300049588 Bacteria 16937
426 Ga0501072_0021559 3300049588 Bacteria 4997
427 Ga0501072_0046461 3300049588 Bacteria 3417
428 Ga0501072_0091378 3300049588 Bacteria 2417
429 Ga0501072_0157374 3300049588 Bacteria 1812
430 Ga0501072_0218080 3300049588 Unclassified 1520
431 Ga0501072_0350359 3300049588 Unclassified 1172
432 Ga0501072_0686468 3300049588 Bacteria 805
433 Ga0501073_0037750 3300049589 Bacteria 3429
434 Ga0501073_0061726 3300049589 Bacteria 2615
435 Ga0501073_0069211 3300049589 Bacteria 2459
436 Ga0501073_0121598 3300049589 Bacteria 1809
437 Ga0501073_0198794 3300049589 Bacteria 1386
438 Ga0501074_0000951 3300049590 Bacteria 18707
439 Ga0501074_0134603 3300049590 Bacteria 1768
440 Ga0501074_0225513 3300049590 Bacteria 1334
441 Ga0501074_0347624 3300049590 Bacteria 1052
442 Ga0501075_0011582 3300049591 Bacteria 6245
443 Ga0501075_0021467 3300049591 Bacteria 4707
444 Ga0501075_0033311 3300049591 Unclassified 3833
445 Ga0501075_0051111 3300049591 Bacteria 3107
446 Ga0501075_0084093 3300049591 Bacteria 2410
447 Ga0501075_0084884 3300049591 Bacteria 2398
448 Ga0501075_0108052 3300049591 Bacteria 2115
449 Ga0501075_0175105 3300049591 Bacteria 1637
450 Ga0501075_0182265 3300049591 Bacteria 1602
451 Ga0501075_0195563 3300049591 Bacteria 1542
452 Ga0501075_0267828 3300049591 Bacteria 1302
453 Ga0501075_0352025 3300049591 Bacteria 1122
454 Ga0501076_0000489 3300049592 Bacteria 24947
455 Ga0501076_0026799 3300049592 Bacteria 4467
456 Ga0501076_0036161 3300049592 Bacteria 3868
457 Ga0501076_0043942 3300049592 Bacteria 3522
458 Ga0501076_0085131 3300049592 Bacteria 2540
459 Ga0501076_0088344 3300049592 Bacteria 2491
460 Ga0501076_0138599 3300049592 Bacteria 1976
461 Ga0501076_0146714 3300049592 Bacteria 1918
462 Ga0501076_0202110 3300049592 Bacteria 1623
463 Ga0501076_0306160 3300049592 Unclassified 1303
464 Ga0501076_0384077 3300049592 Bacteria 1154
465 Ga0501076_0508532 3300049592 Bacteria 993
466 Ga0501077_0000456 3300049593 Bacteria 24833
467 Ga0501077_0008346 3300049593 Bacteria 6410
468 Ga0501077_0014097 3300049593 Bacteria 5014
469 Ga0501077_0086919 3300049593 Bacteria 1982
470 Ga0501077_0107260 3300049593 Bacteria 1770
471 Ga0501077_0108063 3300049593 Bacteria 1762
472 Ga0501077_0125485 3300049593 Bacteria 1627
473 Ga0501077_0145601 3300049593 Bacteria 1503
474 Ga0501077_0197090 3300049593 Bacteria 1279
475 Ga0501077_0316782 3300049593 Bacteria 994
476 Ga0501233_022605 3300049668 Bacteria 1360
477 Ga0501249_014745 3300049679 Bacteria 1667
478 Ga0501079_0000036 3300049741 Bacteria 57722
479 Ga0501079_0002639 3300049741 Bacteria 13049
480 Ga0501079_0010898 3300049741 Bacteria 6924
481 Ga0501079_0011187 3300049741 Bacteria 6846
482 Ga0501079_0029212 3300049741 Bacteria 4232
483 Ga0501079_0031177 3300049741 Bacteria 4097
484 Ga0501079_0053830 3300049741 Bacteria 3104
485 Ga0501079_0177096 3300049741 Bacteria 1663
486 Ga0501079_0187640 3300049741 Bacteria 1614
487 Ga0501079_0396222 3300049741 Unclassified 1083
488 Ga0501080_0000401 3300049742 Bacteria 33489
489 Ga0501080_0011353 3300049742 Bacteria 8156
490 Ga0501080_0026347 3300049742 Bacteria 5402
491 Ga0501080_0079362 3300049742 Bacteria 3051
492 Ga0501080_0087464 3300049742 Bacteria 2895
493 Ga0501080_0166328 3300049742 Bacteria 2035
494 Ga0501080_0326608 3300049742 Bacteria 1388
495 Ga0501080_0697565 3300049742 Bacteria 895
496 Ga0501080_0790800 3300049742 Bacteria 832
497 Ga0501081_0001211 3300049743 Bacteria 15691
498 Ga0501081_0007558 3300049743 Bacteria 7048
499 Ga0501081_0089326 3300049743 Bacteria 2165
500 Ga0501081_0182672 3300049743 Bacteria 1517
501 Ga0501081_0194012 3300049743 Bacteria 1471
502 Ga0501081_0300777 3300049743 Bacteria 1177
503 Ga0501081_0313482 3300049743 Bacteria 1152
504 Ga0501083_0000424 3300049744 Bacteria 27147
505 Ga0501083_0001700 3300049744 Bacteria 14998
506 Ga0501083_0048869 3300049744 Bacteria 2854
507 Ga0501083_0052456 3300049744 Bacteria 2740
508 Ga0501035_0033023 3300049822 Bacteria 4706
509 Ga0501035_0038384 3300049822 Bacteria 4336
510 Ga0501035_0165673 3300049822 Bacteria 1911
511 Ga0501044_0002281 3300049823 Bacteria 21863
512 Ga0501044_0046926 3300049823 Bacteria 4470
513 Ga0501045_0000013 3300049824 Bacteria 73989
514 Ga0501045_0008280 3300049824 Bacteria 7240
515 Ga0501045_0010660 3300049824 Bacteria 6442
516 Ga0501045_0012773 3300049824 Bacteria 5918
517 Ga0501045_0220761 3300049824 Bacteria 1411
518 Ga0501045_0350133 3300049824 Bacteria 1099
519 Ga0501045_0419559 3300049824 Bacteria 995
520 nmdc:mga05p37_1146814_c1 3300050507 Bacteria 809
521 nmdc:mga05p37_148004_c1 3300050507 Bacteria 2874
522 nmdc:mga05p37_1_c1 3300050507 Bacteria 177088
523 nmdc:mga05p37_207040_c1 3300050507 Bacteria 2373
524 nmdc:mga05p37_268566_c1 3300050507 Bacteria 2039
525 nmdc:mga05p37_35205_c1 3300050507 Bacteria 6138
526 nmdc:mga05p37_41809_c1 3300050507 Bacteria 5629
527 nmdc:mga05p37_7551_c1 3300050507 Bacteria 12171
528 nmdc:mga05p37_96622_c1 3300050507 Unclassified 3640
529 nmdc:mga09592_113902_c1 3300050508 Bacteria 2321
530 nmdc:mga09592_183341_c1 3300050508 Bacteria 1811
531 nmdc:mga09592_22766_c1 3300050508 Bacteria 5170
532 nmdc:mga09592_233760_c1 3300050508 Unclassified 1593
533 nmdc:mga09592_32055_c1 3300050508 Bacteria 4380
534 nmdc:mga0qj67_108470_c1 3300050509 Unclassified 2240
535 nmdc:mga0qj67_484789_c1 3300050509 Bacteria 994
536 nmdc:mga0qj67_603889_c1 3300050509 Bacteria 877
537 nmdc:mga0qj67_67285_c1 3300050509 Bacteria 2854
538 nmdc:mga06r32_123046_c1 3300050510 Bacteria 2560
539 nmdc:mga06r32_204655_c1 3300050510 Bacteria 1961
540 nmdc:mga06r32_336401_c1 3300050510 Unclassified 1495
541 nmdc:mga06r32_419690_c1 3300050510 Bacteria 1319
542 nmdc:mga06r32_438404_c1 3300050510 Bacteria 1286
543 nmdc:mga08y16_104303_c1 3300050511 Bacteria 2951
544 nmdc:mga08y16_25044_c1 3300050511 Bacteria 6295
545 nmdc:mga08y16_370898_c1 3300050511 Bacteria 1468
546 nmdc:mga08y16_53375_c1 3300050511 Bacteria 4226
547 nmdc:mga08y16_66924_c1 3300050511 Bacteria 3749
548 nmdc:mga08y16_69878_c1 3300050511 Bacteria 3660
549 nmdc:mga0n895_141183_c1 3300050512 Bacteria 2437
550 nmdc:mga0n895_173284_c1 3300050512 Unclassified 2189
551 nmdc:mga0n895_277401_c1 3300050512 Unclassified 1700
552 nmdc:mga0n895_308603_c1 3300050512 Bacteria 1604
553 nmdc:mga0n895_531912_c1 3300050512 Bacteria 1182
554 nmdc:mga0n895_922275_c1 3300050512 Bacteria 858
555 nmdc:mga0n895_9686_c1 3300050512 Bacteria 8451
556 nmdc:mga0rr50_10073_c1 3300050513 Bacteria 5981
557 nmdc:mga0rr50_105506_c1 3300050513 Unclassified 2222
558 nmdc:mga0rr50_45354_c1 3300050513 Bacteria 3230
559 nmdc:mga08x19_479916_c1 3300050514 Unclassified 876
560 nmdc:mga08x19_66613_c1 3300050514 Bacteria 2341
561 nmdc:mga0a205_11100_c1 3300050515 Bacteria 8289
562 nmdc:mga0a205_12371_c1 3300050515 Bacteria 2772
563 nmdc:mga0a205_207340_c1 3300050515 Unclassified 1849
564 nmdc:mga0a205_373523_c1 3300050515 Bacteria 1292
565 nmdc:mga0a205_40224_c1 3300050515 Bacteria 4500
566 nmdc:mga0a205_436655_c1 3300050515 Unclassified 1170
567 nmdc:mga0a205_47698_c2 3300050515 Bacteria 3772
568 nmdc:mga0a205_505374_c1 3300050515 Bacteria 1065
569 Ga0495619_0057969 3300053085 Bacteria 2570
570 Ga0500568_0001593 3300053139 Bacteria 14352
571 Ga0501084_0000346 3300054114 Bacteria 35396
572 Ga0501084_0016165 3300054114 Bacteria 6196
573 Ga0501084_0049172 3300054114 Bacteria 3529
574 Ga0501084_0056645 3300054114 Bacteria 3279
575 Ga0501084_0148732 3300054114 Bacteria 1973
576 Ga0501084_0215574 3300054114 Bacteria 1620
577 Ga0501084_0249188 3300054114 Bacteria 1499
578 Ga0501084_0321955 3300054114 Unclassified 1306
579 Ga0501084_0511590 3300054114 Bacteria 1015
580 Ga0501084_0740236 3300054114 Bacteria 828
581 Ga0590071_000409 3300059421 Bacteria 12630
582 Ga0590071_002971 3300059421 Bacteria 4212
583 Ga0590074_000149 3300059423 Bacteria 8354
584 Ga0590075_012009 3300059424 Bacteria 2100
585 Ga0590075_055439 3300059424 Bacteria 1018
586 Ga0590077_001239 3300059426 Bacteria 6130
587 Ga0590077_002615 3300059426 Bacteria 3815
588 Ga0501082_0006030 3300060353 Bacteria 10513
589 Ga0501082_0012514 3300060353 Bacteria 7289
590 Ga0501082_0014133 3300060353 Bacteria 6869
591 Ga0501082_0017363 3300060353 Bacteria 6199
592 Ga0501082_0027607 3300060353 Bacteria 4886
593 Ga0501082_0045543 3300060353 Bacteria 3783
594 Ga0501082_0053842 3300060353 Bacteria 3468
595 Ga0501082_0172396 3300060353 Bacteria 1881
596 Ga0501082_0222493 3300060353 Bacteria 1642
597 Ga0501082_0278179 3300060353 Bacteria 1457
598 Ga0501082_0320255 3300060353 Bacteria 1351
599 Ga0501082_0359629 3300060353 Bacteria 1270
600 Ga0501082_0411520 3300060353 Bacteria 1180
601 Ga0501082_0413496 3300060353 Bacteria 1177
602 Ga0501082_0460798 3300060353 Bacteria 1111
603 Ga0530510_0010309 3300061734 Bacteria 6549
604 Ga0530510_0021449 3300061734 Bacteria 4595
605 Ga0530510_0022416 3300061734 Bacteria 4499
606 Ga0530510_0032010 3300061734 Bacteria 3781
607 Ga0530510_0060079 3300061734 Unclassified 2751
608 Ga0530510_0075137 3300061734 Bacteria 2454
609 Ga0530510_0081113 3300061734 Bacteria 2361
610 Ga0530510_0103427 3300061734 Bacteria 2083
611 Ga0530510_0129419 3300061734 Bacteria 1856
612 Ga0530510_0324043 3300061734 Unclassified 1155
613 Ga0501074_0167527
614 JGI25405J52794_10033110
615 Ga0065704_10110844
616 Ga0065712_10000196
617 Ga0065712_10006875
618 Ga0065712_10100678
619 Ga0065715_10011932
620 Ga0065715_10016691
621 Ga0065715_10120344
622 Ga0065707_10004137
623 Ga0065707_10011428
624 Ga0065707_10096015
625 Ga0065707_10101981
626 Ga0065707_10185415
627 Ga0065707_10195917
628 Ga0070658_10134716
629 Ga0070676_10002244
630 Ga0070683_100070965
631 Ga0070670_100002623
632 Ga0070677_10230689
633 Ga0070666_10010972
634 Ga0070666_10180716
635 Ga0070680_100005083
636 Ga0070680_100754674
637 Ga0070660_100053963
638 Ga0070660_100253225
639 Ga0070660_100274581
640 Ga0070689_100120304
641 Ga0070689_100167877
642 Ga0070661_100447863
643 Ga0070668_100143070
644 Ga0070668_100292386
645 Ga0070675_100107279
646 Ga0070671_100075637
647 Ga0070671_100277649
648 Ga0070673_100320782
649 Ga0070688_100071399
650 Ga0070659_100129154
651 Ga0070709_10181590
652 Ga0070709_10438257
653 Ga0070714_100173519
654 Ga0070705_100184297
655 Ga0070705_100557830
656 Ga0070694_100191055
657 Ga0070708_100147178
658 Ga0070678_100112366
659 Ga0070678_100293068
660 Ga0070662_100045133
661 Ga0070662_100088524
662 Ga0070681_10006995
663 Ga0070706_100705506
664 Ga0070679_100031218
665 Ga0070679_100078946
666 Ga0070679_100551951
667 Ga0070695_100110954
668 Ga0070695_100238077
669 Ga0070695_100277557
670 Ga0070696_100096230
671 Ga0070696_100153961
672 Ga0070693_100139402
673 Ga0070704_100002476
674 Ga0070704_100041931
675 Ga0070704_100247863
676 Ga0068855_100085684
677 Ga0070664_100005722
678 Ga0070664_100197404
679 Ga0070664_100711941
680 Ga0068856_100198140
681 Ga0068859_100007047
682 Ga0068859_100266256
683 Ga0068859_100748083
684 Ga0068863_100177612
685 Ga0068863_100213433
686 Ga0068860_100033001
687 Ga0068860_100129048
688 Ga0081455_10001470
689 Ga0081455_10007638
690 Ga0081455_10034964
691 Ga0081455_10091715
692 Ga0081455_10092762
693 Ga0081538_10012960
694 Ga0081538_10026900
695 Ga0081538_10117866
696 Ga0081539_10122884
697 Ga0097621_100384681
698 Ga0068871_100796628
699 Ga0075428_100008136
700 Ga0075428_100010231
701 Ga0075428_100070827
702 Ga0075428_100077583
703 Ga0075428_100157666
704 Ga0075428_100158814
705 Ga0075428_100180563
706 Ga0075428_100370757
707 Ga0075428_100509674
708 Ga0075428_100588417
709 Ga0075430_100027122
710 Ga0075430_100036846
711 Ga0075430_100406242
712 Ga0075430_100626795
713 Ga0075431_100040168
714 Ga0075431_100050135
715 Ga0075431_100066531
716 Ga0075431_100091334
717 Ga0075431_100202408
718 Ga0075431_100223085
719 Ga0075431_100387801
720 Ga0075431_100636516
721 Ga0075433_10008949
722 Ga0075433_10009432
723 Ga0075433_10032233
724 Ga0075433_10075318
725 Ga0075434_100013115
726 Ga0075434_100111333
727 Ga0075434_100125789
728 Ga0075434_100202492
729 Ga0075434_100386931
730 Ga0075434_100735305
731 Ga0075429_100008815
732 Ga0075429_100160631
733 Ga0075429_100177685
734 Ga0075429_100551861
735 Ga0075436_100008033
736 Ga0097620_100007047
737 Ga0097620_100266252
738 Ga0097620_100748094
739 Ga0075435_100018855
740 Ga0111539_10013731
741 Ga0111539_10023421
742 Ga0111539_10120233
743 Ga0111539_10262968
744 Ga0111539_10287631
745 Ga0111539_10434136
746 Ga0111539_10504167
747 Ga0111539_10561030
748 Ga0111539_10832440
749 Ga0105245_10591674
750 Ga0114129_10000323
751 Ga0114129_10008096
752 Ga0114129_10071553
753 Ga0114129_10113588
754 Ga0114129_10158035
755 Ga0114129_10160530
756 Ga0114129_10638461
757 Ga0114129_10787483
758 Ga0105237_10224035
759 Ga0105238_10627825
760 Ga0105249_10086082
761 Ga0105239_10236462
762 Ga0157374_10277353
763 Ga0157374_10330847
764 Ga0157378_10185579
765 Ga0157378_10334681
766 Ga0157378_10665937
767 Ga0163162_10635140
768 Ga0157372_11035535
769 Ga0163163_10130343
770 Ga0163163_10383166
771 Ga0163163_10558152
772 Ga0157380_10011160
773 Ga0157376_10339505
774 Ga0163161_10112922
775 Ga0207697_10004281
776 Ga0207682_10150714
777 Ga0207680_10097465
778 Ga0207699_10068257
779 Ga0207699_10471697
780 Ga0207645_10112921
781 Ga0207705_10416090
782 Ga0207684_10167593
783 Ga0207707_10179260
784 Ga0207707_10227406
785 Ga0207671_10422213
786 Ga0207660_10233358
787 Ga0207649_10117114
788 Ga0207652_10097876
789 Ga0207650_10002858
790 Ga0207659_10052790
791 Ga0207659_10334923
792 Ga0207659_10342108
793 Ga0207687_10085494
794 Ga0207664_10259298
795 Ga0207644_10156366
796 Ga0207690_10005633
797 Ga0207706_10280927
798 Ga0207670_10366499
799 Ga0207704_10476825
800 Ga0207661_10136079
801 Ga0207661_10222789
802 Ga0207679_10005377
803 Ga0207679_10216385
804 Ga0207679_10445533
805 Ga0207667_10407380
806 Ga0207640_10392248
807 Ga0207639_10093074
808 Ga0207678_10115358
809 Ga0207708_10418005
810 Ga0207641_10314676
811 Ga0207641_10375940
812 Ga0207675_100332527
813 Ga0207675_100449364
814 Ga0207675_100704704
815 Ga0207683_10004154
816 Ga0207683_10148233
817 Ga0209973_1009944
818 Ga0209981_1020299
819 Ga0210000_1002752
820 Ga0209995_1008619
821 Ga0209971_1006834
822 Ga0209974_10021947
823 Ga0209974_10026970
824 Ga0207428_10011184
825 Ga0207428_10025257
826 Ga0268264_10105713
827 Ga0268264_10536873
828 Ga0265336_10007772
829 Ga0265338_10001115
830 Ga0307511_10022420
831 Ga0265328_10000280
832 Ga0265320_10002363
833 Ga0265339_10010416
834 Ga0265339_10084261
835 Ga0307408_100103980
836 Ga0265314_10030286
837 Ga0265342_10000065
838 Ga0265342_10007901
839 Ga0307405_10076159
840 Ga0307405_10192517
841 Ga0307413_10112552
842 Ga0307413_10128292
843 Ga0307413_10360854
844 Ga0307410_10018740
845 Ga0307406_10051753
846 Ga0307406_10235341
847 Ga0307407_10068718
848 Ga0307407_10477414
849 Ga0307412_10022370
850 Ga0307409_100122484
851 Ga0307409_100162287
852 Ga0307409_100168814
853 Ga0307409_100369696
854 Ga0307416_100021233
855 Ga0307416_100044932
856 Ga0307416_100280525
857 Ga0307416_100313323
858 Ga0307416_100408541
859 Ga0307416_100543308
860 Ga0307416_100649479
861 Ga0307416_100701495
862 Ga0307414_10000930
863 Ga0307414_10027346
864 Ga0307414_10498583
865 Ga0307411_10114285
866 Ga0307411_10262097
867 Ga0307415_100002926
868 Ga0307415_100076787
869 Ga0307415_100097661
870 Ga0307415_100104235
871 Ga0373956_0155680
872 Ga0373933_0000801
873 Ga0373937_0007263
874 Ga0373937_0007632
875 Ga0373937_0022832
876 Ga0439461_0006618
877 Ga0451853_0743606
878 Ga0439441_021580
879 Ga0439450_065172
880 Ga0439455_0044768
881 Ga0439462_0041725
882 Ga0439446_0010305
883 Ga0439434_0005005
884 Ga0439434_0050502
885 Ga0439435_0014150
886 Ga0451577_0169005
887 Ga0453683_0223823
888 Ga0453684_0087279
889 Ga0451576_0006395
890 Ga0451576_0806836
891 Ga0495603_0284984
892 Ga0495629_0117730
893 Ga0495580_0000916
894 Ga0495580_0042927
895 Ga0495582_0065054
896 Ga0495639_0077970
897 Ga0495662_0099327
898 Ga0495664_0065345
899 Ga0495594_0057778
900 Ga0495608_0611736
901 Ga0495618_0096705
902 Ga0495630_0142246
903 Ga0495643_0020917
904 Ga0495666_0014534
905 Ga0495640_0142025
906 Ga0495586_0002976
907 Ga0495598_0069761
908 Ga0495667_0358716
909 Ga0495634_0003467
910 Ga0495657_0327733
911 Ga0495647_0007576
912 Ga0495658_0005220
913 Ga0495613_0103658
914 Ga0495624_0055739
915 Ga0495676_0102446
916 Ga0495680_0003966
917 Ga0495680_0441488
918 Ga0496108_0174392
919 Ga0496108_0415595
920 Ga0496111_0361129
921 Ga0496112_0095375
922 Ga0496114_0426116
923 Ga0501303_011517
924 Ga0501031_0006811
925 Ga0501031_0214096
926 Ga0501031_0247208
927 Ga0501031_0417961
928 Ga0501032_0003055
929 Ga0501032_0016060
930 Ga0501032_0232314
931 Ga0501032_0404970
932 Ga0501033_0008476
933 Ga0501033_0016105
934 Ga0501033_0265018
935 Ga0501034_0001012
936 Ga0501034_0048208
937 Ga0501034_0054352
938 Ga0501034_0065077
939 Ga0501034_0102559
940 Ga0501034_0607701
941 Ga0501036_0005831
942 Ga0501036_0033333
943 Ga0501036_0208917
944 Ga0501036_0295794
945 Ga0501036_0307278
946 Ga0501036_0445862
947 Ga0501036_0590202
948 Ga0501037_0021045
949 Ga0501037_0036555
950 Ga0501037_0166518
951 Ga0501037_0508693
952 Ga0501038_0003218
953 Ga0501038_0051576
954 Ga0501038_0057810
955 Ga0501038_0148222
956 Ga0501038_0308124
957 Ga0501038_0407678
958 Ga0501038_0428465
959 Ga0501039_0002710
960 Ga0501039_0015383
961 Ga0501039_0024288
962 Ga0501039_0054204
963 Ga0501039_0091369
964 Ga0501039_0118446
965 Ga0501039_0274143
966 Ga0501040_0007754
967 Ga0501040_0083749
968 Ga0501040_0094372
969 Ga0501040_0226454
970 Ga0501040_0317905
971 Ga0501040_0374928
972 Ga0501041_0010025
973 Ga0501041_0013629
974 Ga0501041_0018360
975 Ga0501041_0022498
976 Ga0501041_0037414
977 Ga0501041_0054331
978 Ga0501041_0063746
979 Ga0501042_0010986
980 Ga0501042_0090946
981 Ga0501042_0102676
982 Ga0501042_0176895
983 Ga0501042_0178645
984 Ga0501042_0187067
985 Ga0501042_0202508
986 Ga0501042_0217030
987 Ga0501042_0565528
988 Ga0501043_0000717
989 Ga0501043_0006508
990 Ga0501043_0060038
991 Ga0501043_0061047
992 Ga0501043_0103346
993 Ga0501046_0003103
994 Ga0501046_0025926
995 Ga0501046_0046987
996 Ga0501046_0069443
997 Ga0501046_0082419
998 Ga0501046_0091742
999 Ga0501046_0172898
1000 Ga0501046_0189701
1001 Ga0501046_0190593
1002 Ga0501047_0003522
1003 Ga0501047_0005715
1004 Ga0501047_0386718
1005 Ga0501047_0386878
1006 Ga0501048_0000457
1007 Ga0501048_0066647
1008 Ga0501048_0067850
1009 Ga0501048_0167604
1010 Ga0501048_0206734
1011 Ga0501048_0214340
1012 Ga0501048_0286044
1013 Ga0501067_0011735
1014 Ga0501067_0029484
1015 Ga0501067_0087898
1016 Ga0501067_0189864
1017 Ga0501068_0000248
1018 Ga0501068_0030567
1019 Ga0501068_0033677
1020 Ga0501068_0044848
1021 Ga0501068_0169675
1022 Ga0501068_0186476
1023 Ga0501068_0269824
1024 Ga0501069_0001071
1025 Ga0501069_0018462
1026 Ga0501069_0034329
1027 Ga0501070_0018171
1028 Ga0501070_0043601
1029 Ga0501070_0094637
1030 Ga0501071_0000456
1031 Ga0501071_0003473
1032 Ga0501071_0017210
1033 Ga0501071_0020252
1034 Ga0501071_0106184
1035 Ga0501071_0126858
1036 Ga0501071_0136319
1037 Ga0501072_0001597
1038 Ga0501072_0021559
1039 Ga0501072_0046461
1040 Ga0501072_0091378
1041 Ga0501072_0157374
1042 Ga0501072_0218080
1043 Ga0501072_0350359
1044 Ga0501072_0686468
1045 Ga0501073_0037750
1046 Ga0501073_0061726
1047 Ga0501073_0069211
1048 Ga0501073_0121598
1049 Ga0501073_0198794
1050 Ga0501074_0000951
1051 Ga0501074_0134603
1052 Ga0501074_0225513
1053 Ga0501074_0347624
1054 Ga0501075_0011582
1055 Ga0501075_0021467
1056 Ga0501075_0033311
1057 Ga0501075_0051111
1058 Ga0501075_0084093
1059 Ga0501075_0084884
1060 Ga0501075_0108052
1061 Ga0501075_0175105
1062 Ga0501075_0182265
1063 Ga0501075_0195563
1064 Ga0501075_0267828
1065 Ga0501075_0352025
1066 Ga0501076_0000489
1067 Ga0501076_0026799
1068 Ga0501076_0036161
1069 Ga0501076_0043942
1070 Ga0501076_0085131
1071 Ga0501076_0088344
1072 Ga0501076_0138599
1073 Ga0501076_0146714
1074 Ga0501076_0202110
1075 Ga0501076_0306160
1076 Ga0501076_0384077
1077 Ga0501076_0508532
1078 Ga0501077_0000456
1079 Ga0501077_0008346
1080 Ga0501077_0014097
1081 Ga0501077_0086919
1082 Ga0501077_0107260
1083 Ga0501077_0108063
1084 Ga0501077_0125485
1085 Ga0501077_0145601
1086 Ga0501077_0197090
1087 Ga0501077_0316782
1088 Ga0501233_022605
1089 Ga0501249_014745
1090 Ga0501079_0000036
1091 Ga0501079_0002639
1092 Ga0501079_0010898
1093 Ga0501079_0011187
1094 Ga0501079_0029212
1095 Ga0501079_0031177
1096 Ga0501079_0053830
1097 Ga0501079_0177096
1098 Ga0501079_0187640
1099 Ga0501079_0396222
1100 Ga0501080_0000401
1101 Ga0501080_0011353
1102 Ga0501080_0026347
1103 Ga0501080_0079362
1104 Ga0501080_0087464
1105 Ga0501080_0166328
1106 Ga0501080_0326608
1107 Ga0501080_0697565
1108 Ga0501080_0790800
1109 Ga0501081_0001211
1110 Ga0501081_0007558
1111 Ga0501081_0089326
1112 Ga0501081_0182672
1113 Ga0501081_0194012
1114 Ga0501081_0300777
1115 Ga0501081_0313482
1116 Ga0501083_0000424
1117 Ga0501083_0001700
1118 Ga0501083_0048869
1119 Ga0501083_0052456
1120 Ga0501035_0033023
1121 Ga0501035_0038384
1122 Ga0501035_0165673
1123 Ga0501044_0002281
1124 Ga0501044_0046926
1125 Ga0501045_0000013
1126 Ga0501045_0008280
1127 Ga0501045_0010660
1128 Ga0501045_0012773
1129 Ga0501045_0220761
1130 Ga0501045_0350133
1131 Ga0501045_0419559
1132 nmdc:mga05p37_1146814_c1
1133 nmdc:mga05p37_148004_c1
1134 nmdc:mga05p37_1_c1
1135 nmdc:mga05p37_207040_c1
1136 nmdc:mga05p37_268566_c1
1137 nmdc:mga05p37_35205_c1
1138 nmdc:mga05p37_41809_c1
1139 nmdc:mga05p37_7551_c1
1140 nmdc:mga05p37_96622_c1
1141 nmdc:mga09592_113902_c1
1142 nmdc:mga09592_183341_c1
1143 nmdc:mga09592_22766_c1
1144 nmdc:mga09592_233760_c1
1145 nmdc:mga09592_32055_c1
1146 nmdc:mga0qj67_108470_c1
1147 nmdc:mga0qj67_484789_c1
1148 nmdc:mga0qj67_603889_c1
1149 nmdc:mga0qj67_67285_c1
1150 nmdc:mga06r32_123046_c1
1151 nmdc:mga06r32_204655_c1
1152 nmdc:mga06r32_336401_c1
1153 nmdc:mga06r32_419690_c1
1154 nmdc:mga06r32_438404_c1
1155 nmdc:mga08y16_104303_c1
1156 nmdc:mga08y16_25044_c1
1157 nmdc:mga08y16_370898_c1
1158 nmdc:mga08y16_53375_c1
1159 nmdc:mga08y16_66924_c1
1160 nmdc:mga08y16_69878_c1
1161 nmdc:mga0n895_141183_c1
1162 nmdc:mga0n895_173284_c1
1163 nmdc:mga0n895_277401_c1
1164 nmdc:mga0n895_308603_c1
1165 nmdc:mga0n895_531912_c1
1166 nmdc:mga0n895_922275_c1
1167 nmdc:mga0n895_9686_c1
1168 nmdc:mga0rr50_10073_c1
1169 nmdc:mga0rr50_105506_c1
1170 nmdc:mga0rr50_45354_c1
1171 nmdc:mga08x19_479916_c1
1172 nmdc:mga08x19_66613_c1
1173 nmdc:mga0a205_11100_c1
1174 nmdc:mga0a205_12371_c1
1175 nmdc:mga0a205_207340_c1
1176 nmdc:mga0a205_373523_c1
1177 nmdc:mga0a205_40224_c1
1178 nmdc:mga0a205_436655_c1
1179 nmdc:mga0a205_47698_c2
1180 nmdc:mga0a205_505374_c1
1181 Ga0495619_0057969
1182 Ga0500568_0001593
1183 Ga0501084_0000346
1184 Ga0501084_0016165
1185 Ga0501084_0049172
1186 Ga0501084_0056645
1187 Ga0501084_0148732
1188 Ga0501084_0215574
1189 Ga0501084_0249188
1190 Ga0501084_0321955
1191 Ga0501084_0511590
1192 Ga0501084_0740236
1193 Ga0590071_000409
1194 Ga0590071_002971
1195 Ga0590074_000149
1196 Ga0590075_012009
1197 Ga0590075_055439
1198 Ga0590077_001239
1199 Ga0590077_002615
1200 Ga0501082_0006030
1201 Ga0501082_0012514
1202 Ga0501082_0014133
1203 Ga0501082_0017363
1204 Ga0501082_0027607
1205 Ga0501082_0045543
1206 Ga0501082_0053842
1207 Ga0501082_0172396
1208 Ga0501082_0222493
1209 Ga0501082_0278179
1210 Ga0501082_0320255
1211 Ga0501082_0359629
1212 Ga0501082_0411520
1213 Ga0501082_0413496
1214 Ga0501082_0460798
1215 Ga0530510_0010309
1216 Ga0530510_0021449
1217 Ga0530510_0022416
1218 Ga0530510_0032010
1219 Ga0530510_0060079
1220 Ga0530510_0075137
1221 Ga0530510_0081113
1222 Ga0530510_0103427
1223 Ga0530510_0129419
1224 Ga0530510_0324043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

102

254

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pju-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7667 13 229
6pju-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7463 13 229
6pjq-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7427 12 229
6pj8-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7291 12 229
6pj9-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7244 13 237
ID Description Score Start End Superfamily
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8528 13 232 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8258 13 232 1.20.1540.10
af_F1R9M8_118_305_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8025 13 228 1.20.1540.10
af_Q54NX5_136_340_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.802 14 229 1.20.1540.10
af_A0A6V7QZA6_121_312_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.7923 17 227 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A7C3R9S1-F1-model_v4 Rhomboid family intramembrane serine protease 0.9623 1 198 GO:0004252
GO:0006508
GO:0016020
AF-A0A1F2WDI7-F1-model_v4 Rhomboid family intramembrane serine protease 0.9584 1 202 GO:0004252
GO:0006508
GO:0016020
AF-A0A2V7JZV8-F1-model_v4 Rhomboid family intramembrane serine protease 0.9507 15 247 GO:0004252
GO:0006508
GO:0016020
AF-A0A2V7JVK1-F1-model_v4 Rhomboid family intramembrane serine protease 0.9499 1 232 GO:0004252
GO:0006508
GO:0016020
AF-A0A3B0YYD5-F1-model_v4 FIG056164: rhomboid family serine protease 0.9462 91 233 GO:0004252
GO:0006508
GO:0016020

Map