F468875

General Info

Members Datasets Scaffolds Average Seq Length
609 224 609 264

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10069183|Ga0207708_100691832
Length 312
Sequence MKTFIVGDIHGRCAQLLNLLDLIPRDPSTDTLVFLGDLIDRGADAPGCVDHIMQMCRENPERVICLRGNHEQMMLDFLEGVSNIWLTPVVGGERTFEQYTHRSVRVESEQDLHEMRRTLEQAVPPEHIEFMQETPLYHEDEYAIYVHAGLDDGKHPRDSSPMSLLWMRDMDFYKNYHGKPCVFGHTPTPLLPLRGRLGRHGIYISNSAIGLDTGYNQQSPLSCLSLPDFSLYQTFADGREELIRGASLDGIGVRSLREIEAAGNDTFVANRLSARPNGRRSRRGXWTXGSMKPXXPNQAMASRKLAMNWKRE

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
184 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
185 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
186 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
187 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
191 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
192 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
193 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
194 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
195 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
199 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
200 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
201 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
202 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
203 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
204 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
205 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
206 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
207 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
208 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
209 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
210 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
211 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
212 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
213 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
214 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
218 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.3
Rhizosphere 97.21
Stem 0
Stem Tuber 0
Unclassified 0.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000010 3300002459 Bacteria 124816
2 JGI24751J29686_10000107 3300002459 Bacteria 44982
3 JGI25406J46586_10010797 3300003203 Unclassified 4030
4 rootL2_10218114 3300003322 Unclassified 2659
5 Ga0065714_10064435 3300005288 Bacteria 121919
6 Ga0065704_10002750 3300005289 Bacteria 5439
7 Ga0065704_10009222 3300005289 Bacteria 3045
8 Ga0065712_10000118 3300005290 Bacteria 121959
9 Ga0065712_10005981 3300005290 Bacteria 8451
10 Ga0065712_10072544 3300005290 Bacteria 4711
11 Ga0065712_10095833 3300005290 Bacteria 2205
12 Ga0065712_10238155 3300005290 Bacteria 992
13 Ga0065715_10003867 3300005293 Bacteria 5083
14 Ga0065715_10004377 3300005293 Bacteria 4513
15 Ga0065715_10009071 3300005293 Unclassified 4450
16 Ga0065715_10010548 3300005293 Bacteria 2905
17 Ga0065715_10093241 3300005293 Bacteria 4723
18 Ga0065715_10129902 3300005293 Bacteria 2036
19 Ga0065715_10143951 3300005293 Bacteria 1814
20 Ga0065715_10324146 3300005293 Unclassified 996
21 Ga0065707_10001813 3300005295 Bacteria 12883
22 Ga0065707_10004604 3300005295 Bacteria 4389
23 Ga0065707_10015527 3300005295 Bacteria 1798
24 Ga0070676_10052220 3300005328 Bacteria 2403
25 Ga0070690_100015318 3300005330 Unclassified 4571
26 Ga0070690_100024037 3300005330 Bacteria 3745
27 Ga0070690_100040830 3300005330 Bacteria 2936
28 Ga0070690_100077735 3300005330 Bacteria 2167
29 Ga0070670_100000172 3300005331 Bacteria 58670
30 Ga0070670_100003381 3300005331 Bacteria 13219
31 Ga0070670_100069256 3300005331 Bacteria 3029
32 Ga0070670_100189407 3300005331 Bacteria 1787
33 Ga0070670_100304390 3300005331 Bacteria 1395
34 Ga0070670_100799854 3300005331 Unclassified 851
35 Ga0070677_10095430 3300005333 Bacteria 1301
36 Ga0068869_100005023 3300005334 Bacteria 8287
37 Ga0068869_100007207 3300005334 Bacteria 7090
38 Ga0068869_100012403 3300005334 Bacteria 5632
39 Ga0068869_100123258 3300005334 Unclassified 1985
40 Ga0070666_10038653 3300005335 Bacteria 3177
41 Ga0070666_10091081 3300005335 Bacteria 2095
42 Ga0070680_100002492 3300005336 Bacteria 13645
43 Ga0070680_100179214 3300005336 Unclassified 1785
44 Ga0070682_100000051 3300005337 Bacteria 123476
45 Ga0070682_100125859 3300005337 Unclassified 1727
46 Ga0068868_100020497 3300005338 Bacteria 4970
47 Ga0068868_100033404 3300005338 Unclassified 3965
48 Ga0070689_100003649 3300005340 Bacteria 10271
49 Ga0070689_100027931 3300005340 Bacteria 4260
50 Ga0070689_100055572 3300005340 Bacteria 3068
51 Ga0070689_100253491 3300005340 Bacteria 1453
52 Ga0070687_100016661 3300005343 Bacteria 3359
53 Ga0070687_100221796 3300005343 Unclassified 1158
54 Ga0070692_10057277 3300005345 Bacteria 2043
55 Ga0070669_100000729 3300005353 Bacteria 23953
56 Ga0070669_100005681 3300005353 Bacteria 8998
57 Ga0070669_100035821 3300005353 Bacteria 3595
58 Ga0070669_100117377 3300005353 Unclassified 2026
59 Ga0070675_100112321 3300005354 Bacteria 2307
60 Ga0070671_100004322 3300005355 Bacteria 11240
61 Ga0070671_100207830 3300005355 Unclassified 1660
62 Ga0070671_100290318 3300005355 Bacteria 1392
63 Ga0070673_100034361 3300005364 Bacteria 3836
64 Ga0070673_100238556 3300005364 Bacteria 1580
65 Ga0070673_100518186 3300005364 Unclassified 1080
66 Ga0070688_100023415 3300005365 Unclassified 3632
67 Ga0070688_100033712 3300005365 Bacteria 3096
68 Ga0070688_100295301 3300005365 Bacteria 1169
69 Ga0070659_100001984 3300005366 Bacteria 14620
70 Ga0070667_100036944 3300005367 Bacteria 4095
71 Ga0070667_100052670 3300005367 Bacteria 3435
72 Ga0070703_10007901 3300005406 Unclassified 2992
73 Ga0070701_10024086 3300005438 Bacteria 2941
74 Ga0070701_10115019 3300005438 Unclassified 1508
75 Ga0070701_10247297 3300005438 Unclassified 1075
76 Ga0070705_100005490 3300005440 Bacteria 6180
77 Ga0070700_100004485 3300005441 Bacteria 7296
78 Ga0070694_100025408 3300005444 Bacteria 3831
79 Ga0070694_100034268 3300005444 Bacteria 3347
80 Ga0070694_100042879 3300005444 Bacteria 3023
81 Ga0070694_100233712 3300005444 Bacteria 1384
82 Ga0070694_100287270 3300005444 Bacteria 1256
83 Ga0070694_100412955 3300005444 Bacteria 1059
84 Ga0070708_100005104 3300005445 Bacteria 10394
85 Ga0070708_100150793 3300005445 Bacteria 2162
86 Ga0070678_100070475 3300005456 Bacteria 2613
87 Ga0070662_100065723 3300005457 Bacteria 2659
88 Ga0070662_100089204 3300005457 Unclassified 2313
89 Ga0070662_100243556 3300005457 Unclassified 1443
90 Ga0070662_100408673 3300005457 Bacteria 1121
91 Ga0070681_10000475 3300005458 Bacteria 32749
92 Ga0070681_10006749 3300005458 Bacteria 11174
93 Ga0070681_10008066 3300005458 Bacteria 10307
94 Ga0068867_100035843 3300005459 Bacteria 3600
95 Ga0068867_100208234 3300005459 Unclassified 1569
96 Ga0068867_100438454 3300005459 Bacteria 1110
97 Ga0070706_100000097 3300005467 Bacteria 106315
98 Ga0070706_100008151 3300005467 Bacteria 9773
99 Ga0070706_100038071 3300005467 Bacteria 4441
100 Ga0070707_100014181 3300005468 Bacteria 7468
101 Ga0070707_100051115 3300005468 Bacteria 3962
102 Ga0070707_100067939 3300005468 Bacteria 3429
103 Ga0070707_100462308 3300005468 Bacteria 1230
104 Ga0070698_100000741 3300005471 Bacteria 35145
105 Ga0070698_100008518 3300005471 Bacteria 11068
106 Ga0070698_100012607 3300005471 Bacteria 8952
107 Ga0070698_100018959 3300005471 Bacteria 7238
108 Ga0070698_100054512 3300005471 Bacteria 4058
109 Ga0070698_100140077 3300005471 Bacteria 2371
110 Ga0070698_100585125 3300005471 Bacteria 1056
111 Ga0070699_100019519 3300005518 Bacteria 5838
112 Ga0070699_100048347 3300005518 Bacteria 3681
113 Ga0070699_100538633 3300005518 Unclassified 1062
114 Ga0070699_100623576 3300005518 Bacteria 984
115 Ga0070679_100000307 3300005530 Bacteria 41692
116 Ga0070679_100020664 3300005530 Bacteria 6422
117 Ga0070684_100476450 3300005535 Bacteria 1155
118 Ga0070697_100000176 3300005536 Bacteria 52306
119 Ga0070697_100001824 3300005536 Bacteria 16279
120 Ga0070697_100003300 3300005536 Bacteria 12397
121 Ga0070697_100062956 3300005536 Bacteria 3029
122 Ga0070697_100093480 3300005536 Bacteria 2490
123 Ga0070697_100298306 3300005536 Bacteria 1385
124 Ga0070697_100416902 3300005536 Bacteria 1167
125 Ga0070697_100495410 3300005536 Unclassified 1068
126 Ga0068853_100021562 3300005539 Bacteria 5373
127 Ga0068853_100022682 3300005539 Bacteria 5247
128 Ga0070672_100010434 3300005543 Bacteria 6446
129 Ga0070672_100018427 3300005543 Bacteria 5048
130 Ga0070672_100219260 3300005543 Bacteria 1595
131 Ga0070686_100002923 3300005544 Bacteria 9380
132 Ga0070686_100016272 3300005544 Bacteria 4322
133 Ga0070695_100020382 3300005545 Bacteria 4049
134 Ga0070695_100033141 3300005545 Bacteria 3231
135 Ga0070695_100164932 3300005545 Bacteria 1558
136 Ga0070695_100539058 3300005545 Unclassified 908
137 Ga0070696_100011221 3300005546 Bacteria 5998
138 Ga0070696_100030850 3300005546 Bacteria 3671
139 Ga0070696_100034818 3300005546 Unclassified 3466
140 Ga0070696_100038428 3300005546 Bacteria 3303
141 Ga0070696_100116105 3300005546 Bacteria 1933
142 Ga0070696_100148973 3300005546 Bacteria 1716
143 Ga0070696_100173594 3300005546 Bacteria 1595
144 Ga0070696_100193537 3300005546 Bacteria 1514
145 Ga0070696_100252713 3300005546 Unclassified 1334
146 Ga0070696_100486320 3300005546 Unclassified 980
147 Ga0070693_100033959 3300005547 Bacteria 2820
148 Ga0070693_100097113 3300005547 Bacteria 1787
149 Ga0070693_100097213 3300005547 Unclassified 1787
150 Ga0070693_100137430 3300005547 Bacteria 1534
151 Ga0070665_100245418 3300005548 Bacteria 1791
152 Ga0070704_100050453 3300005549 Unclassified 2925
153 Ga0070704_100072147 3300005549 Bacteria 2511
154 Ga0070704_100079533 3300005549 Bacteria 2409
155 Ga0070704_100121923 3300005549 Bacteria 2005
156 Ga0070704_100147629 3300005549 Bacteria 1845
157 Ga0070704_100158231 3300005549 Unclassified 1789
158 Ga0070704_100272993 3300005549 Unclassified 1398
159 Ga0068855_100696091 3300005563 Bacteria 1088
160 Ga0070664_100002835 3300005564 Bacteria 14023
161 Ga0070664_100209203 3300005564 Bacteria 1743
162 Ga0070664_100484937 3300005564 Bacteria 1138
163 Ga0068857_100006192 3300005577 Bacteria 10227
164 Ga0068854_100166459 3300005578 Bacteria 1712
165 Ga0068854_100245768 3300005578 Bacteria 1427
166 Ga0068854_100461253 3300005578 Bacteria 1063
167 Ga0068856_100008247 3300005614 Bacteria 10157
168 Ga0070702_100002632 3300005615 Bacteria 7825
169 Ga0070702_100030226 3300005615 Bacteria 2951
170 Ga0068859_100000232 3300005617 Bacteria 54896
171 Ga0068859_100023785 3300005617 Bacteria 6149
172 Ga0068859_100055373 3300005617 Bacteria 3991
173 Ga0068859_100057843 3300005617 Bacteria 3905
174 Ga0068859_100072712 3300005617 Bacteria 3475
175 Ga0068859_100085575 3300005617 Bacteria 3198
176 Ga0068859_100156331 3300005617 Bacteria 2357
177 Ga0068859_100508451 3300005617 Unclassified 1300
178 Ga0068859_100614479 3300005617 Bacteria 1180
179 Ga0068859_100875917 3300005617 Unclassified 983
180 Ga0068864_100009246 3300005618 Bacteria 8127
181 Ga0068864_100020729 3300005618 Bacteria 5501
182 Ga0068864_100079899 3300005618 Bacteria 2864
183 Ga0068864_100100567 3300005618 Bacteria 2563
184 Ga0068864_100243304 3300005618 Bacteria 1667
185 Ga0068864_100575878 3300005618 Bacteria 1090
186 Ga0068861_100013443 3300005719 Bacteria 5730
187 Ga0068861_100029701 3300005719 Bacteria 4000
188 Ga0068861_100101313 3300005719 Unclassified 2291
189 Ga0068861_100190488 3300005719 Bacteria 1714
190 Ga0068870_10003233 3300005840 Bacteria 6880
191 Ga0068870_10024721 3300005840 Bacteria 2974
192 Ga0068870_10063146 3300005840 Bacteria 1997
193 Ga0068870_10098885 3300005840 Bacteria 1645
194 Ga0068870_10135203 3300005840 Unclassified 1436
195 Ga0068863_100143469 3300005841 Bacteria 2283
196 Ga0068863_100150383 3300005841 Bacteria 2227
197 Ga0068863_100161410 3300005841 Bacteria 2147
198 Ga0068863_100225007 3300005841 Bacteria 1808
199 Ga0068863_100238361 3300005841 Bacteria 1756
200 Ga0068863_100273511 3300005841 Bacteria 1635
201 Ga0068863_100434115 3300005841 Bacteria 1287
202 Ga0068863_100817221 3300005841 Bacteria 930
203 Ga0068858_100192230 3300005842 Bacteria 1928
204 Ga0068858_100736698 3300005842 Bacteria 960
205 Ga0068860_100031710 3300005843 Bacteria 5080
206 Ga0068860_100033016 3300005843 Bacteria 4969
207 Ga0068860_100060719 3300005843 Bacteria 3592
208 Ga0068860_100076357 3300005843 Bacteria 3186
209 Ga0068860_100144474 3300005843 Bacteria 2288
210 Ga0068860_100258035 3300005843 Bacteria 1698
211 Ga0068860_100398837 3300005843 Bacteria 1361
212 Ga0068862_100025178 3300005844 Bacteria 4995
213 Ga0068862_100154453 3300005844 Unclassified 2045
214 Ga0068862_100483364 3300005844 Bacteria 1173
215 Ga0081540_1095004 3300005983 Bacteria 1300
216 Ga0081539_10000067 3300005985 Bacteria 246361
217 Ga0081539_10003247 3300005985 Bacteria 20448
218 Ga0070715_10000056 3300006163 Bacteria 41126
219 Ga0097621_100001354 3300006237 Bacteria 16867
220 Ga0097621_100003566 3300006237 Bacteria 10754
221 Ga0097621_100010030 3300006237 Bacteria 6907
222 Ga0097621_100118625 3300006237 Bacteria 2243
223 Ga0097621_100590081 3300006237 Bacteria 1015
224 Ga0068871_100003147 3300006358 Bacteria 11329
225 Ga0068871_100022903 3300006358 Bacteria 4822
226 Ga0068871_100163472 3300006358 Bacteria 1905
227 Ga0075428_100255697 3300006844 Bacteria 1887
228 Ga0075428_100516526 3300006844 Unclassified 1278
229 Ga0075430_100014662 3300006846 Bacteria 6678
230 Ga0075430_100112866 3300006846 Unclassified 2266
231 Ga0075431_100190646 3300006847 Bacteria 2100
232 Ga0075431_100344133 3300006847 Bacteria 1500
233 Ga0075431_100484299 3300006847 Bacteria 1229
234 Ga0075433_10011639 3300006852 Bacteria 7085
235 Ga0075433_10035184 3300006852 Bacteria 4305
236 Ga0075433_10083717 3300006852 Bacteria 2816
237 Ga0075433_10154173 3300006852 Unclassified 2044
238 Ga0075433_10218177 3300006852 Bacteria 1695
239 Ga0075433_10343900 3300006852 Bacteria 1318
240 Ga0075434_100464837 3300006871 Unclassified 1286
241 Ga0075434_100961698 3300006871 Unclassified 868
242 Ga0075429_100113944 3300006880 Bacteria 2363
243 Ga0075429_100298063 3300006880 Unclassified 1412
244 Ga0075429_100355269 3300006880 Bacteria 1283
245 Ga0068865_100036648 3300006881 Bacteria 3308
246 Ga0068865_100290708 3300006881 Bacteria 1304
247 Ga0075436_100025189 3300006914 Bacteria 4092
248 Ga0097620_100000232 3300006931 Bacteria 54896
249 Ga0097620_100023784 3300006931 Bacteria 6149
250 Ga0097620_100055372 3300006931 Bacteria 3991
251 Ga0097620_100057842 3300006931 Bacteria 3905
252 Ga0097620_100057925 3300006931 Unclassified 3902
253 Ga0097620_100072718 3300006931 Bacteria 3475
254 Ga0097620_100085580 3300006931 Bacteria 3198
255 Ga0097620_100156332 3300006931 Bacteria 2357
256 Ga0097620_100508489 3300006931 Unclassified 1300
257 Ga0097620_100614393 3300006931 Bacteria 1180
258 Ga0097620_100875982 3300006931 Unclassified 983
259 Ga0075435_100008358 3300007076 Bacteria 7421
260 Ga0075435_100218365 3300007076 Bacteria 1619
261 Ga0075435_100284470 3300007076 Bacteria 1412
262 Ga0099795_10172175 3300007788 Bacteria 900
263 Ga0111539_10014961 3300009094 Bacteria 9671
264 Ga0111539_10025357 3300009094 Bacteria 7267
265 Ga0111539_10328982 3300009094 Bacteria 1779
266 Ga0111539_10503677 3300009094 Unclassified 1410
267 Ga0111539_10881001 3300009094 Unclassified 1041
268 Ga0105245_10736301 3300009098 Bacteria 1021
269 Ga0105247_10004049 3300009101 Bacteria 9428
270 Ga0105247_10282063 3300009101 Unclassified 1146
271 Ga0114129_10009579 3300009147 Bacteria 13818
272 Ga0114129_10012876 3300009147 Bacteria 11903
273 Ga0114129_10068578 3300009147 Bacteria 4945
274 Ga0114129_10137020 3300009147 Bacteria 3358
275 Ga0114129_10182878 3300009147 Unclassified 2851
276 Ga0114129_10243157 3300009147 Unclassified 2419
277 Ga0114129_10255096 3300009147 Unclassified 2353
278 Ga0114129_10427656 3300009147 Unclassified 1740
279 Ga0114129_10864319 3300009147 Bacteria 1149
280 Ga0105243_10003775 3300009148 Bacteria 12142
281 Ga0105243_10026243 3300009148 Bacteria 4458
282 Ga0105243_10032075 3300009148 Bacteria 4055
283 Ga0105243_10139315 3300009148 Bacteria 2068
284 Ga0105243_10242032 3300009148 Bacteria 1606
285 Ga0105241_10007255 3300009174 Bacteria 8160
286 Ga0105241_10040136 3300009174 Bacteria 3533
287 Ga0105241_10067802 3300009174 Bacteria 2762
288 Ga0105241_10090995 3300009174 Unclassified 2406
289 Ga0105241_10259078 3300009174 Bacteria 1478
290 Ga0105241_10310513 3300009174 Unclassified 1356
291 Ga0105241_10537739 3300009174 Bacteria 1047
292 Ga0105241_10566024 3300009174 Bacteria 1022
293 Ga0105242_10010215 3300009176 Bacteria 7195
294 Ga0105242_10014187 3300009176 Bacteria 6170
295 Ga0105248_10001808 3300009177 Bacteria 23766
296 Ga0105248_10010812 3300009177 Bacteria 10079
297 Ga0105248_10021108 3300009177 Bacteria 7216
298 Ga0105248_10025068 3300009177 Bacteria 6630
299 Ga0105248_10036200 3300009177 Bacteria 5519
300 Ga0105248_10161933 3300009177 Bacteria 2523
301 Ga0105248_10531423 3300009177 Bacteria 1326
302 Ga0105248_10544163 3300009177 Bacteria 1310
303 Ga0105237_10105778 3300009545 Bacteria 2805
304 Ga0105237_10633809 3300009545 Bacteria 1076
305 Ga0105238_10009901 3300009551 Bacteria 9556
306 Ga0105238_10016017 3300009551 Bacteria 7583
307 Ga0105249_10020353 3300009553 Bacteria 5932
308 Ga0105249_10038565 3300009553 Bacteria 4336
309 Ga0105249_10093678 3300009553 Unclassified 2814
310 Ga0105249_10123151 3300009553 Bacteria 2467
311 Ga0105249_10186169 3300009553 Bacteria 2023
312 Ga0105249_10484930 3300009553 Unclassified 1279
313 Ga0105239_10215229 3300010375 Bacteria 2154
314 Ga0105246_10011216 3300011119 Bacteria 5556
315 Ga0105246_10035668 3300011119 Bacteria 3326
316 Ga0157374_10023046 3300013296 Bacteria 5563
317 Ga0157374_10028505 3300013296 Bacteria 5045
318 Ga0157374_10137664 3300013296 Unclassified 2368
319 Ga0157378_10002620 3300013297 Bacteria 16015
320 Ga0157378_10019596 3300013297 Bacteria 5947
321 Ga0157378_10031930 3300013297 Unclassified 4652
322 Ga0157378_10046581 3300013297 Unclassified 3854
323 Ga0157378_10344640 3300013297 Unclassified 1454
324 Ga0157378_10390820 3300013297 Bacteria 1368
325 Ga0157378_10449940 3300013297 Bacteria 1278
326 Ga0157378_10487081 3300013297 Bacteria 1230
327 Ga0157378_10759807 3300013297 Bacteria 993
328 Ga0157378_10771555 3300013297 Bacteria 985
329 Ga0163162_10035373 3300013306 Bacteria 4975
330 Ga0163162_10035844 3300013306 Unclassified 4942
331 Ga0163162_10038985 3300013306 Bacteria 4744
332 Ga0163162_10120303 3300013306 Bacteria 2729
333 Ga0163162_10235949 3300013306 Bacteria 1959
334 Ga0163162_10468801 3300013306 Unclassified 1391
335 Ga0163162_10604448 3300013306 Bacteria 1223
336 Ga0157372_10218752 3300013307 Bacteria 2208
337 Ga0157372_10708245 3300013307 Bacteria 1171
338 Ga0157375_10002322 3300013308 Bacteria 16423
339 Ga0157375_10178345 3300013308 Bacteria 2275
340 Ga0157375_10255499 3300013308 Unclassified 1914
341 Ga0157375_10410298 3300013308 Bacteria 1521
342 Ga0157375_10866746 3300013308 Bacteria 1049
343 Ga0157375_11089150 3300013308 Bacteria 935
344 Ga0157375_11230805 3300013308 Unclassified 879
345 Ga0163163_10000183 3300014325 Bacteria 64505
346 Ga0163163_10002198 3300014325 Bacteria 16414
347 Ga0163163_10016794 3300014325 Bacteria 6813
348 Ga0163163_10020180 3300014325 Bacteria 6272
349 Ga0163163_10028171 3300014325 Bacteria 5390
350 Ga0163163_10060333 3300014325 Bacteria 3755
351 Ga0163163_10161439 3300014325 Bacteria 2286
352 Ga0163163_10198897 3300014325 Bacteria 2052
353 Ga0157380_10002050 3300014326 Bacteria 13483
354 Ga0157380_10019610 3300014326 Bacteria 5041
355 Ga0157380_10025475 3300014326 Bacteria 4486
356 Ga0157380_10033656 3300014326 Unclassified 3947
357 Ga0157380_10280800 3300014326 Bacteria 1523
358 Ga0157380_10338314 3300014326 Bacteria 1403
359 Ga0157377_10017790 3300014745 Bacteria 3684
360 Ga0157377_10093611 3300014745 Bacteria 1779
361 Ga0157379_10145467 3300014968 Bacteria 2138
362 Ga0157379_10293146 3300014968 Bacteria 1482
363 Ga0157379_10603927 3300014968 Bacteria 1024
364 Ga0163161_10171123 3300017792 Bacteria 1661
365 Ga0207697_10002343 3300025315 Bacteria 9863
366 Ga0207653_10007715 3300025885 Bacteria 3356
367 Ga0207642_10040291 3300025899 Bacteria 2037
368 Ga0207710_10016703 3300025900 Unclassified 3107
369 Ga0207680_10036381 3300025903 Bacteria 2835
370 Ga0207647_10000502 3300025904 Bacteria 31375
371 Ga0207685_10000060 3300025905 Bacteria 31981
372 Ga0207645_10034381 3300025907 Bacteria 3257
373 Ga0207643_10020286 3300025908 Bacteria 3647
374 Ga0207643_10069696 3300025908 Bacteria 2021
375 Ga0207684_10000023 3300025910 Bacteria 334838
376 Ga0207684_10003122 3300025910 Bacteria 16333
377 Ga0207684_10045672 3300025910 Bacteria 3714
378 Ga0207684_10229947 3300025910 Bacteria 1600
379 Ga0207654_10171225 3300025911 Bacteria 1410
380 Ga0207707_10000006 3300025912 Bacteria 374131
381 Ga0207707_10011551 3300025912 Bacteria 7689
382 Ga0207707_10018360 3300025912 Bacteria 6096
383 Ga0207707_10077822 3300025912 Unclassified 2895
384 Ga0207660_10010046 3300025917 Bacteria 6131
385 Ga0207660_10235927 3300025917 Unclassified 1439
386 Ga0207660_10262851 3300025917 Unclassified 1365
387 Ga0207662_10006670 3300025918 Bacteria 6239
388 Ga0207662_10319842 3300025918 Unclassified 1036
389 Ga0207652_10000216 3300025921 Bacteria 61049
390 Ga0207652_10050439 3300025921 Bacteria 3566
391 Ga0207646_10036840 3300025922 Bacteria 4413
392 Ga0207646_10216418 3300025922 Bacteria 1730
393 Ga0207646_10217739 3300025922 Bacteria 1725
394 Ga0207681_10012229 3300025923 Bacteria 5292
395 Ga0207681_10132553 3300025923 Unclassified 1844
396 Ga0207681_10563150 3300025923 Bacteria 939
397 Ga0207694_10005857 3300025924 Bacteria 9421
398 Ga0207650_10000001 3300025925 Bacteria 1545726
399 Ga0207650_10000979 3300025925 Bacteria 21453
400 Ga0207650_10029133 3300025925 Bacteria 3966
401 Ga0207650_10201429 3300025925 Bacteria 1595
402 Ga0207650_10203411 3300025925 Bacteria 1587
403 Ga0207659_10369455 3300025926 Unclassified 1194
404 Ga0207644_10021371 3300025931 Bacteria 4407
405 Ga0207690_10013855 3300025932 Unclassified 4857
406 Ga0207690_10315778 3300025932 Bacteria 1227
407 Ga0207706_10117018 3300025933 Bacteria 2344
408 Ga0207706_10155573 3300025933 Unclassified 2011
409 Ga0207706_10603765 3300025933 Unclassified 942
410 Ga0207709_10005499 3300025935 Bacteria 7190
411 Ga0207709_10056072 3300025935 Bacteria 2437
412 Ga0207709_10129844 3300025935 Bacteria 1716
413 Ga0207709_10385535 3300025935 Unclassified 1067
414 Ga0207670_10028478 3300025936 Bacteria 3547
415 Ga0207670_10032725 3300025936 Bacteria 3346
416 Ga0207670_10092825 3300025936 Bacteria 2137
417 Ga0207669_10231015 3300025937 Bacteria 1365
418 Ga0207704_10008050 3300025938 Bacteria 5015
419 Ga0207704_10163282 3300025938 Unclassified 1588
420 Ga0207704_10432229 3300025938 Bacteria 1046
421 Ga0207665_10186411 3300025939 Bacteria 1505
422 Ga0207665_10444434 3300025939 Unclassified 994
423 Ga0207691_10000304 3300025940 Bacteria 48837
424 Ga0207691_10278994 3300025940 Unclassified 1438
425 Ga0207691_10347194 3300025940 Bacteria 1270
426 Ga0207711_10005526 3300025941 Bacteria 10689
427 Ga0207711_10016128 3300025941 Bacteria 6202
428 Ga0207711_10157468 3300025941 Bacteria 2054
429 Ga0207711_10276340 3300025941 Bacteria 1546
430 Ga0207689_10000667 3300025942 Bacteria 32744
431 Ga0207689_10011519 3300025942 Bacteria 7577
432 Ga0207689_10013543 3300025942 Bacteria 6962
433 Ga0207689_10016438 3300025942 Bacteria 6264
434 Ga0207689_10020003 3300025942 Bacteria 5638
435 Ga0207689_10116666 3300025942 Unclassified 2195
436 Ga0207689_10266529 3300025942 Bacteria 1418
437 Ga0207689_10299189 3300025942 Bacteria 1334
438 Ga0207679_10019773 3300025945 Unclassified 4533
439 Ga0207679_10439778 3300025945 Bacteria 1155
440 Ga0207679_10518599 3300025945 Bacteria 1066
441 Ga0207712_10002974 3300025961 Bacteria 10825
442 Ga0207712_10417617 3300025961 Unclassified 1131
443 Ga0207640_10016061 3300025981 Bacteria 4346
444 Ga0207640_10076697 3300025981 Bacteria 2270
445 Ga0207640_10245614 3300025981 Bacteria 1386
446 Ga0207658_10035252 3300025986 Bacteria 3583
447 Ga0207677_10025090 3300026023 Bacteria 3714
448 Ga0207677_10426117 3300026023 Bacteria 1131
449 Ga0207703_10174773 3300026035 Bacteria 1892
450 Ga0207639_10013582 3300026041 Bacteria 5705
451 Ga0207639_10128618 3300026041 Bacteria 2093
452 Ga0207639_10186211 3300026041 Unclassified 1770
453 Ga0207708_10007738 3300026075 Bacteria 7958
454 Ga0207708_10009260 3300026075 Bacteria 7289
455 Ga0207708_10043249 3300026075 Bacteria 3433
456 Ga0207708_10050249 3300026075 Bacteria 3174
457 Ga0207708_10069183 3300026075 Bacteria 2703
458 Ga0207702_10019171 3300026078 Bacteria 5660
459 Ga0207641_10131275 3300026088 Bacteria 2250
460 Ga0207641_10165711 3300026088 Bacteria 2012
461 Ga0207641_10266748 3300026088 Bacteria 1605
462 Ga0207641_10622989 3300026088 Bacteria 1058
463 Ga0207648_10004071 3300026089 Bacteria 15158
464 Ga0207648_10131862 3300026089 Bacteria 2200
465 Ga0207648_10143881 3300026089 Bacteria 2103
466 Ga0207648_10243786 3300026089 Unclassified 1601
467 Ga0207676_10008074 3300026095 Bacteria 7481
468 Ga0207676_10012511 3300026095 Bacteria 6083
469 Ga0207676_10014507 3300026095 Bacteria 5671
470 Ga0207676_10028840 3300026095 Bacteria 4151
471 Ga0207674_10000192 3300026116 Bacteria 75255
472 Ga0207674_10040812 3300026116 Bacteria 4804
473 Ga0207674_10200317 3300026116 Unclassified 1946
474 Ga0207674_10557394 3300026116 Bacteria 1107
475 Ga0207674_10611206 3300026116 Bacteria 1053
476 Ga0207674_10634892 3300026116 Bacteria 1031
477 Ga0207674_10656338 3300026116 Unclassified 1013
478 Ga0207675_100009094 3300026118 Bacteria 9322
479 Ga0207675_100063754 3300026118 Bacteria 3444
480 Ga0207675_100067632 3300026118 Bacteria 3339
481 Ga0207675_100095627 3300026118 Unclassified 2795
482 Ga0207675_100166624 3300026118 Bacteria 2105
483 Ga0207675_100249299 3300026118 Bacteria 1718
484 Ga0207683_10007724 3300026121 Bacteria 9210
485 Ga0207698_10229261 3300026142 Bacteria 1685
486 Ga0207428_10106225 3300027907 Bacteria 2165
487 Ga0268265_10033931 3300028380 Unclassified 3715
488 Ga0268265_10417533 3300028380 Bacteria 1245
489 Ga0268265_10434976 3300028380 Bacteria 1221
490 Ga0268265_10500785 3300028380 Bacteria 1145
491 Ga0268265_10578167 3300028380 Bacteria 1070
492 Ga0268264_10020639 3300028381 Bacteria 5382
493 Ga0268264_10041521 3300028381 Bacteria 3806
494 Ga0268264_10068000 3300028381 Bacteria 3009
495 Ga0268264_10125182 3300028381 Bacteria 2270
496 Ga0268264_10144639 3300028381 Bacteria 2124
497 Ga0316182_1408791 3300030745 Bacteria 1338
498 Ga0307513_10011996 3300031456 Bacteria 10729
499 Ga0307513_10179688 3300031456 Bacteria 1981
500 Ga0307408_100095880 3300031548 Bacteria 2249
501 Ga0307405_10079152 3300031731 Bacteria 2141
502 Ga0307405_10141150 3300031731 Bacteria 1680
503 Ga0307405_10196835 3300031731 Bacteria 1460
504 Ga0307406_10133523 3300031901 Bacteria 1746
505 Ga0307406_10351777 3300031901 Viruses 1152
506 Ga0307412_10345937 3300031911 Bacteria 1192
507 Ga0307416_100039981 3300032002 Bacteria 3637
508 Ga0307416_100202899 3300032002 Bacteria 1883
509 Ga0307416_100681237 3300032002 Unclassified 1116
510 Ga0307414_10003305 3300032004 Bacteria 8599
511 Ga0307414_10054983 3300032004 Bacteria 2785
512 Ga0307414_10060329 3300032004 Bacteria 2682
513 Ga0307411_10021348 3300032005 Bacteria 3787
514 Ga0307411_10044337 3300032005 Bacteria 2852
515 Ga0373949_0014255 3300035090 Bacteria 1769
516 Ga0373951_0000545 3300035091 Bacteria 10604
517 Ga0395901_0274260 3300038443 Unclassified 1754
518 Ga0395901_0670497 3300038443 Bacteria 1038
519 Ga0242420_002080 3300038996 Bacteria 2808
520 Ga0439462_0004250 3300042015 Unclassified 3484
521 Ga0439446_0072977 3300042156 Bacteria 1053
522 Ga0439444_0033958 3300042437 Unclassified 972
523 Ga0451576_0717091 3300045051 Unclassified 1051
524 Ga0495621_0032123 3300046539 Bacteria 1803
525 Ga0496102_0034530 3300048905 Bacteria 4549
526 Ga0496103_0103124 3300048906 Bacteria 1807
527 Ga0496106_0472569 3300048909 Bacteria 1007
528 Ga0496107_0027549 3300048910 Bacteria 4035
529 Ga0496108_0385598 3300048911 Bacteria 1224
530 Ga0496109_0595565 3300048912 Bacteria 1042
531 Ga0496109_0812479 3300048912 Bacteria 873
532 Ga0496110_0197117 3300048913 Bacteria 1829
533 Ga0496110_0347555 3300048913 Bacteria 1351
534 Ga0496112_0137232 3300048915 Bacteria 2416
535 Ga0496112_0159939 3300048915 Bacteria 2219
536 Ga0496112_0190351 3300048915 Bacteria 2014
537 Ga0496112_0734425 3300048915 Bacteria 914
538 Ga0496113_0319852 3300048916 Bacteria 1244
539 Ga0501292_003472 3300049515 Unclassified 2109
540 Ga0501295_020140 3300049518 Bacteria 1206
541 Ga0501296_003319 3300049519 Bacteria 1712
542 Ga0501298_000494 3300049521 Bacteria 5303
543 Ga0501299_015470 3300049522 Bacteria 1341
544 Ga0501299_017444 3300049522 Bacteria 1281
545 Ga0501048_0206292 3300049582 Bacteria 1394
546 Ga0501076_0188074 3300049592 Unclassified 1685
547 Ga0501198_000486 3300049649 Bacteria 4937
548 Ga0501198_005303 3300049649 Unclassified 1812
549 Ga0501202_031414 3300049652 Bacteria 1109
550 Ga0501206_025057 3300049653 Unclassified 867
551 Ga0501207_000055 3300049654 Bacteria 8424
552 Ga0501208_000486 3300049655 Bacteria 3175
553 Ga0501216_026283 3300049660 Bacteria 1050
554 Ga0501217_002479 3300049661 Bacteria 3639
555 Ga0501217_015990 3300049661 Bacteria 1714
556 Ga0501217_026535 3300049661 Unclassified 1400
557 Ga0501223_000939 3300049663 Bacteria 6877
558 Ga0501227_003100 3300049665 Bacteria 3616
559 Ga0501230_006720 3300049667 Bacteria 1680
560 Ga0501233_001901 3300049668 Bacteria 3629
561 Ga0501235_000627 3300049669 Bacteria 7109
562 Ga0501247_001752 3300049677 Unclassified 2163
563 Ga0501249_022690 3300049679 Bacteria 1375
564 Ga0501251_006716 3300049681 Bacteria 1260
565 Ga0501257_001326 3300049686 Bacteria 5106
566 Ga0501259_013286 3300049688 Bacteria 1382
567 Ga0501225_0004630 3300049705 Bacteria 4089
568 Ga0501225_0025955 3300049705 Bacteria 1611
569 Ga0501225_0042242 3300049705 Unclassified 1259
570 Ga0501229_017170 3300049706 Unclassified 943
571 Ga0501234_001466 3300049707 Bacteria 3705
572 Ga0501245_012383 3300049708 Bacteria 1251
573 Ga0501265_012123 3300049762 Unclassified 1071
574 Ga0501283_002373 3300049779 Bacteria 2445
575 Ga0501283_004356 3300049779 Bacteria 1911
576 Ga0501283_004746 3300049779 Unclassified 1847
577 Ga0501212_006737 3300049851 Bacteria 1557
578 Ga0501226_003117 3300049853 Bacteria 1984
579 nmdc:mga05p37_109133_c1 3300050507 Bacteria 3404
580 nmdc:mga05p37_117174_c1 3300050507 Bacteria 3273
581 nmdc:mga05p37_272556_c1 3300050507 Bacteria 2021
582 nmdc:mga05p37_50985_c1 3300050507 Bacteria 5089
583 nmdc:mga09592_105314_c1 3300050508 Bacteria 2418
584 nmdc:mga09592_145142_c1 3300050508 Bacteria 2046
585 nmdc:mga09592_238366_c2 3300050508 Bacteria 1282
586 nmdc:mga09592_281462_c1 3300050508 Unclassified 1442
587 nmdc:mga09592_429024_c1 3300050508 Bacteria 1141
588 nmdc:mga0qj67_114792_c1 3300050509 Unclassified 2175
589 nmdc:mga0qj67_228843_c1 3300050509 Unclassified 1509
590 nmdc:mga06r32_113866_c1 3300050510 Unclassified 2663
591 nmdc:mga06r32_247028_c1 3300050510 Bacteria 1772
592 nmdc:mga06r32_34130_c1 3300050510 Unclassified 4796
593 nmdc:mga08y16_206183_c1 3300050511 Bacteria 2037
594 nmdc:mga08y16_33924_c1 3300050511 Bacteria 5362
595 nmdc:mga08y16_65770_c1 3300050511 Unclassified 3784
596 nmdc:mga0n895_54079_c1 3300050512 Bacteria 3947
597 nmdc:mga0n895_854048_c1 3300050512 Unclassified 898
598 nmdc:mga0rr50_316446_c1 3300050513 Bacteria 1308
599 nmdc:mga0rr50_409550_c1 3300050513 Bacteria 1146
600 nmdc:mga0rr50_94961_c1 3300050513 Unclassified 2330
601 nmdc:mga08x19_20266_c1 3300050514 Bacteria 4095
602 nmdc:mga0a205_12776_c1 3300050515 Bacteria 7786
603 nmdc:mga0a205_15345_c1 3300050515 Bacteria 7158
604 nmdc:mga0a205_22515_c1 3300050515 Bacteria 4296
605 nmdc:mga0a205_24883_c1 3300050515 Bacteria 5697
606 nmdc:mga0a205_317805_c1 3300050515 Bacteria 1428
607 nmdc:mga0a205_37139_c1 3300050515 Bacteria 4683
608 nmdc:mga0a205_422997_c1 3300050515 Bacteria 1194
609 Ga0530510_0051178 3300061734 Bacteria 2984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006163 Ga0070715_10000056 Ga0070715_1000005612 261
2 3300025905 Ga0207685_10000060 Ga0207685_1000006012 261
3 3300005468 Ga0070707_100051115 Ga0070707_1000511152 262
4 3300005471 Ga0070698_100585125 Ga0070698_1005851251 262
5 3300031456 Ga0307513_10011996 Ga0307513_100119968 262
6 3300061734 Ga0530510_0051178 Ga0530510_0051178_1651_2439 262
7 3300003203 JGI25406J46586_10010797 JGI25406J46586_100107974 263
8 3300003322 rootL2_10218114 rootL2_102181142 263
9 3300005288 Ga0065714_10064435 Ga0065714_1006443517 263
10 3300005289 Ga0065704_10002750 Ga0065704_100027505 263
11 3300005289 Ga0065704_10009222 Ga0065704_100092222 263
12 3300005290 Ga0065712_10000118 Ga0065712_1000011818 263
13 3300005290 Ga0065712_10095833 Ga0065712_100958332 263
14 3300005290 Ga0065712_10238155 Ga0065712_102381551 263
15 3300005293 Ga0065715_10093241 Ga0065715_100932412 263
16 3300005293 Ga0065715_10143951 Ga0065715_101439512 263
17 3300005293 Ga0065715_10324146 Ga0065715_103241462 263
18 3300005295 Ga0065707_10001813 Ga0065707_1000181313 263
19 3300005295 Ga0065707_10004604 Ga0065707_100046044 263
20 3300005295 Ga0065707_10015527 Ga0065707_100155272 263
21 3300005330 Ga0070690_100077735 Ga0070690_1000777353 263
22 3300005331 Ga0070670_100069256 Ga0070670_1000692562 263
23 3300005331 Ga0070670_100189407 Ga0070670_1001894071 263
24 3300005331 Ga0070670_100799854 Ga0070670_1007998541 263
25 3300005334 Ga0068869_100012403 Ga0068869_1000124033 263
26 3300005335 Ga0070666_10038653 Ga0070666_100386532 263
27 3300005337 Ga0070682_100000051 Ga0070682_10000005146 263
28 3300005338 Ga0068868_100020497 Ga0068868_1000204972 263
29 3300005340 Ga0070689_100003649 Ga0070689_1000036492 263
30 3300005340 Ga0070689_100253491 Ga0070689_1002534913 263
31 3300005353 Ga0070669_100035821 Ga0070669_1000358212 263
32 3300005355 Ga0070671_100207830 Ga0070671_1002078302 263
33 3300005355 Ga0070671_100290318 Ga0070671_1002903181 263
34 3300005364 Ga0070673_100238556 Ga0070673_1002385562 263
35 3300005364 Ga0070673_100518186 Ga0070673_1005181861 263
36 3300005365 Ga0070688_100023415 Ga0070688_1000234152 263
37 3300005365 Ga0070688_100295301 Ga0070688_1002953011 263
38 3300005367 Ga0070667_100052670 Ga0070667_1000526702 263
39 3300005438 Ga0070701_10247297 Ga0070701_102472972 263
40 3300005444 Ga0070694_100025408 Ga0070694_1000254082 263
41 3300005444 Ga0070694_100042879 Ga0070694_1000428792 263
42 3300005444 Ga0070694_100233712 Ga0070694_1002337122 263
43 3300005445 Ga0070708_100150793 Ga0070708_1001507932 263
44 3300005459 Ga0068867_100208234 Ga0068867_1002082342 263
45 3300005467 Ga0070706_100000097 Ga0070706_10000009735 263
46 3300005467 Ga0070706_100038071 Ga0070706_1000380713 263
47 3300005468 Ga0070707_100067939 Ga0070707_1000679392 263
48 3300005468 Ga0070707_100462308 Ga0070707_1004623082 263
49 3300005471 Ga0070698_100000741 Ga0070698_10000074127 263
50 3300005471 Ga0070698_100012607 Ga0070698_1000126075 263
51 3300005518 Ga0070699_100019519 Ga0070699_1000195194 263
52 3300005518 Ga0070699_100538633 Ga0070699_1005386331 263
53 3300005535 Ga0070684_100476450 Ga0070684_1004764502 263
54 3300005536 Ga0070697_100001824 Ga0070697_10000182418 263
55 3300005543 Ga0070672_100018427 Ga0070672_1000184272 263
56 3300005545 Ga0070695_100164932 Ga0070695_1001649322 263
57 3300005545 Ga0070695_100539058 Ga0070695_1005390581 263
58 3300005546 Ga0070696_100030850 Ga0070696_1000308502 263
59 3300005546 Ga0070696_100034818 Ga0070696_1000348182 263
60 3300005546 Ga0070696_100148973 Ga0070696_1001489732 263
61 3300005547 Ga0070693_100033959 Ga0070693_1000339593 263
62 3300005548 Ga0070665_100245418 Ga0070665_1002454182 263
63 3300005549 Ga0070704_100121923 Ga0070704_1001219232 263
64 3300005549 Ga0070704_100272993 Ga0070704_1002729932 263
65 3300005564 Ga0070664_100209203 Ga0070664_1002092032 263
66 3300005564 Ga0070664_100484937 Ga0070664_1004849371 263
67 3300005578 Ga0068854_100166459 Ga0068854_1001664592 263
68 3300005578 Ga0068854_100461253 Ga0068854_1004612532 263
69 3300005615 Ga0070702_100030226 Ga0070702_1000302262 263
70 3300005617 Ga0068859_100000232 Ga0068859_1000002323 263
71 3300005617 Ga0068859_100023785 Ga0068859_1000237856 263
72 3300005617 Ga0068859_100057843 Ga0068859_1000578432 263
73 3300005617 Ga0068859_100072712 Ga0068859_1000727123 263
74 3300005617 Ga0068859_100156331 Ga0068859_1001563312 263
75 3300005618 Ga0068864_100009246 Ga0068864_1000092465 263
76 3300005618 Ga0068864_100020729 Ga0068864_1000207292 263
77 3300005618 Ga0068864_100100567 Ga0068864_1001005671 263
78 3300005719 Ga0068861_100029701 Ga0068861_1000297011 263
79 3300005840 Ga0068870_10003233 Ga0068870_100032339 263
80 3300005840 Ga0068870_10135203 Ga0068870_101352031 263
81 3300005841 Ga0068863_100143469 Ga0068863_1001434693 263
82 3300005841 Ga0068863_100150383 Ga0068863_1001503832 263
83 3300005841 Ga0068863_100225007 Ga0068863_1002250072 263
84 3300005841 Ga0068863_100238361 Ga0068863_1002383612 263
85 3300005841 Ga0068863_100817221 Ga0068863_1008172212 263
86 3300005842 Ga0068858_100192230 Ga0068858_1001922302 263
87 3300005843 Ga0068860_100060719 Ga0068860_1000607192 263
88 3300005843 Ga0068860_100076357 Ga0068860_1000763572 263
89 3300005843 Ga0068860_100258035 Ga0068860_1002580352 263
90 3300005844 Ga0068862_100483364 Ga0068862_1004833641 263
91 3300005983 Ga0081540_1095004 Ga0081540_10950042 263
92 3300005985 Ga0081539_10000067 Ga0081539_10000067138 263
93 3300006237 Ga0097621_100003566 Ga0097621_1000035664 263
94 3300006237 Ga0097621_100118625 Ga0097621_1001186251 263
95 3300006844 Ga0075428_100516526 Ga0075428_1005165262 263
96 3300006846 Ga0075430_100014662 Ga0075430_1000146622 263
97 3300006846 Ga0075430_100112866 Ga0075430_1001128662 263
98 3300006847 Ga0075431_100190646 Ga0075431_1001906462 263
99 3300006847 Ga0075431_100344133 Ga0075431_1003441332 263
100 3300006847 Ga0075431_100484299 Ga0075431_1004842991 263
101 3300006852 Ga0075433_10011639 Ga0075433_100116393 263
102 3300006852 Ga0075433_10218177 Ga0075433_102181771 263
103 3300006852 Ga0075433_10343900 Ga0075433_103439002 263
104 3300006871 Ga0075434_100464837 Ga0075434_1004648371 263
105 3300006880 Ga0075429_100298063 Ga0075429_1002980632 263
106 3300006881 Ga0068865_100036648 Ga0068865_1000366482 263
107 3300006931 Ga0097620_100000232 Ga0097620_1000002323 263
108 3300006931 Ga0097620_100023784 Ga0097620_1000237842 263
109 3300006931 Ga0097620_100057842 Ga0097620_1000578422 263
110 3300006931 Ga0097620_100072718 Ga0097620_1000727183 263
111 3300006931 Ga0097620_100156332 Ga0097620_1001563322 263
112 3300007076 Ga0075435_100008358 Ga0075435_1000083586 263
113 3300009094 Ga0111539_10014961 Ga0111539_100149613 263
114 3300009094 Ga0111539_10025357 Ga0111539_100253572 263
115 3300009094 Ga0111539_10328982 Ga0111539_103289822 263
116 3300009094 Ga0111539_10881001 Ga0111539_108810012 263
117 3300009147 Ga0114129_10009579 Ga0114129_100095793 263
118 3300009147 Ga0114129_10068578 Ga0114129_100685782 263
119 3300009147 Ga0114129_10137020 Ga0114129_101370202 263
120 3300009147 Ga0114129_10182878 Ga0114129_101828781 263
121 3300009147 Ga0114129_10243157 Ga0114129_102431572 263
122 3300009147 Ga0114129_10255096 Ga0114129_102550962 263
123 3300009147 Ga0114129_10427656 Ga0114129_104276561 263
124 3300009148 Ga0105243_10032075 Ga0105243_100320755 263
125 3300009174 Ga0105241_10067802 Ga0105241_100678022 263
126 3300009174 Ga0105241_10090995 Ga0105241_100909952 263
127 3300009174 Ga0105241_10310513 Ga0105241_103105132 263
128 3300009174 Ga0105241_10537739 Ga0105241_105377391 263
129 3300009177 Ga0105248_10001808 Ga0105248_100018085 263
130 3300009177 Ga0105248_10010812 Ga0105248_100108128 263
131 3300009177 Ga0105248_10021108 Ga0105248_100211083 263
132 3300009177 Ga0105248_10161933 Ga0105248_101619333 263
133 3300009177 Ga0105248_10544163 Ga0105248_105441632 263
134 3300009551 Ga0105238_10009901 Ga0105238_100099012 263
135 3300009553 Ga0105249_10093678 Ga0105249_100936782 263
136 3300009553 Ga0105249_10123151 Ga0105249_101231512 263
137 3300010375 Ga0105239_10215229 Ga0105239_102152293 263
138 3300013296 Ga0157374_10023046 Ga0157374_100230462 263
139 3300013296 Ga0157374_10137664 Ga0157374_101376643 263
140 3300013297 Ga0157378_10002620 Ga0157378_100026202 263
141 3300013297 Ga0157378_10390820 Ga0157378_103908202 263
142 3300013297 Ga0157378_10449940 Ga0157378_104499401 263
143 3300013297 Ga0157378_10487081 Ga0157378_104870811 263
144 3300013297 Ga0157378_10759807 Ga0157378_107598071 263
145 3300013306 Ga0163162_10035844 Ga0163162_100358442 263
146 3300013306 Ga0163162_10038985 Ga0163162_100389852 263
147 3300013306 Ga0163162_10120303 Ga0163162_101203032 263
148 3300013306 Ga0163162_10235949 Ga0163162_102359492 263
149 3300013306 Ga0163162_10468801 Ga0163162_104688011 263
150 3300013307 Ga0157372_10708245 Ga0157372_107082452 263
151 3300013308 Ga0157375_10002322 Ga0157375_100023224 263
152 3300013308 Ga0157375_10255499 Ga0157375_102554992 263
153 3300013308 Ga0157375_10410298 Ga0157375_104102982 263
154 3300013308 Ga0157375_11230805 Ga0157375_112308051 263
155 3300014325 Ga0163163_10002198 Ga0163163_100021984 263
156 3300014325 Ga0163163_10020180 Ga0163163_100201803 263
157 3300014325 Ga0163163_10028171 Ga0163163_100281715 263
158 3300014325 Ga0163163_10161439 Ga0163163_101614393 263
159 3300014326 Ga0157380_10025475 Ga0157380_100254754 263
160 3300014326 Ga0157380_10033656 Ga0157380_100336562 263
161 3300014326 Ga0157380_10280800 Ga0157380_102808002 263
162 3300014745 Ga0157377_10017790 Ga0157377_100177902 263
163 3300014968 Ga0157379_10145467 Ga0157379_101454672 263
164 3300014968 Ga0157379_10293146 Ga0157379_102931462 263
165 3300025903 Ga0207680_10036381 Ga0207680_100363812 263
166 3300025908 Ga0207643_10020286 Ga0207643_100202863 263
167 3300025910 Ga0207684_10000023 Ga0207684_10000023146 263
168 3300025910 Ga0207684_10045672 Ga0207684_100456723 263
169 3300025923 Ga0207681_10132553 Ga0207681_101325531 263
170 3300025924 Ga0207694_10005857 Ga0207694_100058572 263
171 3300025925 Ga0207650_10029133 Ga0207650_100291333 263
172 3300025925 Ga0207650_10203411 Ga0207650_102034112 263
173 3300025933 Ga0207706_10603765 Ga0207706_106037651 263
174 3300025935 Ga0207709_10056072 Ga0207709_100560722 263
175 3300025936 Ga0207670_10028478 Ga0207670_100284782 263
176 3300025937 Ga0207669_10231015 Ga0207669_102310152 263
177 3300025938 Ga0207704_10432229 Ga0207704_104322291 263
178 3300025940 Ga0207691_10347194 Ga0207691_103471942 263
179 3300025941 Ga0207711_10005526 Ga0207711_100055264 263
180 3300025941 Ga0207711_10016128 Ga0207711_100161284 263
181 3300025941 Ga0207711_10157468 Ga0207711_101574682 263
182 3300025942 Ga0207689_10011519 Ga0207689_100115192 263
183 3300025942 Ga0207689_10013543 Ga0207689_100135432 263
184 3300025942 Ga0207689_10020003 Ga0207689_100200033 263
185 3300025942 Ga0207689_10299189 Ga0207689_102991892 263
186 3300025945 Ga0207679_10439778 Ga0207679_104397782 263
187 3300025945 Ga0207679_10518599 Ga0207679_105185992 263
188 3300025961 Ga0207712_10417617 Ga0207712_104176171 263
189 3300025981 Ga0207640_10016061 Ga0207640_100160615 263
190 3300025981 Ga0207640_10076697 Ga0207640_100766973 263
191 3300025986 Ga0207658_10035252 Ga0207658_100352522 263
192 3300026023 Ga0207677_10025090 Ga0207677_100250902 263
193 3300026075 Ga0207708_10007738 Ga0207708_100077387 263
194 3300026075 Ga0207708_10050249 Ga0207708_100502492 263
195 3300026088 Ga0207641_10622989 Ga0207641_106229891 263
196 3300026089 Ga0207648_10131862 Ga0207648_101318621 263
197 3300026089 Ga0207648_10243786 Ga0207648_102437862 263
198 3300026095 Ga0207676_10008074 Ga0207676_100080742 263
199 3300026095 Ga0207676_10012511 Ga0207676_100125112 263
200 3300026095 Ga0207676_10014507 Ga0207676_100145074 263
201 3300026116 Ga0207674_10611206 Ga0207674_106112061 263
202 3300026116 Ga0207674_10634892 Ga0207674_106348922 263
203 3300026116 Ga0207674_10656338 Ga0207674_106563381 263
204 3300026118 Ga0207675_100095627 Ga0207675_1000956271 263
205 3300027907 Ga0207428_10106225 Ga0207428_101062252 263
206 3300028380 Ga0268265_10033931 Ga0268265_100339312 263
207 3300028380 Ga0268265_10417533 Ga0268265_104175332 263
208 3300028380 Ga0268265_10578167 Ga0268265_105781671 263
209 3300028381 Ga0268264_10020639 Ga0268264_100206394 263
210 3300028381 Ga0268264_10041521 Ga0268264_100415214 263
211 3300030745 Ga0316182_1408791 Ga0316182_14087912 263
212 3300031548 Ga0307408_100095880 Ga0307408_1000958802 263
213 3300031731 Ga0307405_10141150 Ga0307405_101411502 263
214 3300031731 Ga0307405_10196835 Ga0307405_101968352 263
215 3300031901 Ga0307406_10133523 Ga0307406_101335231 263
216 3300031901 Ga0307406_10351777 Ga0307406_103517772 263
217 3300031911 Ga0307412_10345937 Ga0307412_103459371 263
218 3300032002 Ga0307416_100039981 Ga0307416_1000399813 263
219 3300032002 Ga0307416_100202899 Ga0307416_1002028992 263
220 3300032002 Ga0307416_100681237 Ga0307416_1006812372 263
221 3300032004 Ga0307414_10003305 Ga0307414_100033053 263
222 3300032004 Ga0307414_10054983 Ga0307414_100549833 263
223 3300032004 Ga0307414_10060329 Ga0307414_100603292 263
224 3300032005 Ga0307411_10044337 Ga0307411_100443373 263
225 3300038443 Ga0395901_0274260 Ga0395901_0274260_328_1119 263
226 3300045051 Ga0451576_0717091 Ga0451576_0717091_133_924 263
227 3300048909 Ga0496106_0472569 Ga0496106_0472569_14_805 263
228 3300048910 Ga0496107_0027549 Ga0496107_0027549_2501_3292 263
229 3300048911 Ga0496108_0385598 Ga0496108_0385598_44_835 263
230 3300048912 Ga0496109_0812479 Ga0496109_0812479_10_801 263
231 3300048915 Ga0496112_0137232 Ga0496112_0137232_440_1231 263
232 3300048915 Ga0496112_0734425 Ga0496112_0734425_102_893 263
233 3300049522 Ga0501299_015470 Ga0501299_015470_84_875 263
234 3300049582 Ga0501048_0206292 Ga0501048_0206292_27_818 263
235 3300049592 Ga0501076_0188074 Ga0501076_0188074_209_1000 263
236 3300049649 Ga0501198_000486 Ga0501198_000486_3443_4234 263
237 3300049652 Ga0501202_031414 Ga0501202_031414_235_1026 263
238 3300049653 Ga0501206_025057 Ga0501206_025057_49_840 263
239 3300049654 Ga0501207_000055 Ga0501207_000055_393_1184 263
240 3300049655 Ga0501208_000486 Ga0501208_000486_2209_3000 263
241 3300049660 Ga0501216_026283 Ga0501216_026283_211_1002 263
242 3300049661 Ga0501217_002479 Ga0501217_002479_2223_3014 263
243 3300049663 Ga0501223_000939 Ga0501223_000939_4181_4972 263
244 3300049665 Ga0501227_003100 Ga0501227_003100_596_1387 263
245 3300049667 Ga0501230_006720 Ga0501230_006720_44_835 263
246 3300049668 Ga0501233_001901 Ga0501233_001901_1391_2182 263
247 3300049669 Ga0501235_000627 Ga0501235_000627_74_865 263
248 3300049686 Ga0501257_001326 Ga0501257_001326_3087_3878 263
249 3300049705 Ga0501225_0004630 Ga0501225_0004630_1084_1875 263
250 3300049705 Ga0501225_0042242 Ga0501225_0042242_421_1212 263
251 3300049706 Ga0501229_017170 Ga0501229_017170_66_857 263
252 3300049707 Ga0501234_001466 Ga0501234_001466_633_1424 263
253 3300049708 Ga0501245_012383 Ga0501245_012383_168_959 263
254 3300049779 Ga0501283_004746 Ga0501283_004746_1006_1797 263
255 3300049853 Ga0501226_003117 Ga0501226_003117_703_1494 263
256 3300050507 nmdc:mga05p37_109133_c1 nmdc:mga05p37_109133_c1_2551_3342 263
257 3300050507 nmdc:mga05p37_117174_c1 nmdc:mga05p37_117174_c1_60_851 263
258 3300050507 nmdc:mga05p37_272556_c1 nmdc:mga05p37_272556_c1_970_1761 263
259 3300050508 nmdc:mga09592_145142_c1 nmdc:mga09592_145142_c1_523_1314 263
260 3300050508 nmdc:mga09592_281462_c1 nmdc:mga09592_281462_c1_468_1259 263
261 3300050508 nmdc:mga09592_429024_c1 nmdc:mga09592_429024_c1_167_958 263
262 3300050509 nmdc:mga0qj67_114792_c1 nmdc:mga0qj67_114792_c1_758_1549 263
263 3300050509 nmdc:mga0qj67_228843_c1 nmdc:mga0qj67_228843_c1_15_806 263
264 3300050510 nmdc:mga06r32_113866_c1 nmdc:mga06r32_113866_c1_558_1349 263
265 3300050510 nmdc:mga06r32_247028_c1 nmdc:mga06r32_247028_c1_95_886 263
266 3300050510 nmdc:mga06r32_34130_c1 nmdc:mga06r32_34130_c1_612_1403 263
267 3300050511 nmdc:mga08y16_206183_c1 nmdc:mga08y16_206183_c1_486_1277 263
268 3300050511 nmdc:mga08y16_33924_c1 nmdc:mga08y16_33924_c1_3744_4535 263
269 3300050511 nmdc:mga08y16_65770_c1 nmdc:mga08y16_65770_c1_2938_3729 263
270 3300050512 nmdc:mga0n895_54079_c1 nmdc:mga0n895_54079_c1_1393_2184 263
271 3300050513 nmdc:mga0rr50_94961_c1 nmdc:mga0rr50_94961_c1_906_1697 263
272 3300050515 nmdc:mga0a205_12776_c1 nmdc:mga0a205_12776_c1_5574_6365 263
273 3300050515 nmdc:mga0a205_317805_c1 nmdc:mga0a205_317805_c1_70_861 263
274 3300050515 nmdc:mga0a205_37139_c1 nmdc:mga0a205_37139_c1_2480_3271 263
275 3300002459 JGI24751J29686_10000010 JGI24751J29686_100000104 264
276 3300002459 JGI24751J29686_10000107 JGI24751J29686_1000010713 264
277 3300005290 Ga0065712_10005981 Ga0065712_100059814 264
278 3300005290 Ga0065712_10072544 Ga0065712_100725444 264
279 3300005293 Ga0065715_10003867 Ga0065715_100038674 264
280 3300005293 Ga0065715_10004377 Ga0065715_100043772 264
281 3300005293 Ga0065715_10009071 Ga0065715_100090712 264
282 3300005293 Ga0065715_10010548 Ga0065715_100105482 264
283 3300005293 Ga0065715_10129902 Ga0065715_101299022 264
284 3300005328 Ga0070676_10052220 Ga0070676_100522202 264
285 3300005330 Ga0070690_100015318 Ga0070690_1000153181 264
286 3300005330 Ga0070690_100024037 Ga0070690_1000240372 264
287 3300005330 Ga0070690_100040830 Ga0070690_1000408302 264
288 3300005331 Ga0070670_100000172 Ga0070670_10000017248 264
289 3300005331 Ga0070670_100003381 Ga0070670_1000033819 264
290 3300005331 Ga0070670_100304390 Ga0070670_1003043902 264
291 3300005333 Ga0070677_10095430 Ga0070677_100954302 264
292 3300005334 Ga0068869_100005023 Ga0068869_1000050232 264
293 3300005334 Ga0068869_100007207 Ga0068869_1000072072 264
294 3300005334 Ga0068869_100123258 Ga0068869_1001232582 264
295 3300005335 Ga0070666_10091081 Ga0070666_100910812 264
296 3300005336 Ga0070680_100002492 Ga0070680_1000024922 264
297 3300005336 Ga0070680_100179214 Ga0070680_1001792142 264
298 3300005337 Ga0070682_100125859 Ga0070682_1001258592 264
299 3300005338 Ga0068868_100033404 Ga0068868_1000334041 264
300 3300005340 Ga0070689_100027931 Ga0070689_1000279312 264
301 3300005340 Ga0070689_100055572 Ga0070689_1000555724 264
302 3300005343 Ga0070687_100016661 Ga0070687_1000166612 264
303 3300005343 Ga0070687_100221796 Ga0070687_1002217961 264
304 3300005345 Ga0070692_10057277 Ga0070692_100572772 264
305 3300005353 Ga0070669_100000729 Ga0070669_1000007293 264
306 3300005353 Ga0070669_100005681 Ga0070669_1000056813 264
307 3300005353 Ga0070669_100117377 Ga0070669_1001173772 264
308 3300005354 Ga0070675_100112321 Ga0070675_1001123212 264
309 3300005355 Ga0070671_100004322 Ga0070671_1000043225 264
310 3300005364 Ga0070673_100034361 Ga0070673_1000343614 264
311 3300005365 Ga0070688_100033712 Ga0070688_1000337124 264
312 3300005366 Ga0070659_100001984 Ga0070659_1000019842 264
313 3300005367 Ga0070667_100036944 Ga0070667_1000369442 264
314 3300005406 Ga0070703_10007901 Ga0070703_100079011 264
315 3300005438 Ga0070701_10024086 Ga0070701_100240862 264
316 3300005438 Ga0070701_10115019 Ga0070701_101150192 264
317 3300005440 Ga0070705_100005490 Ga0070705_1000054901 264
318 3300005441 Ga0070700_100004485 Ga0070700_1000044855 264
319 3300005444 Ga0070694_100034268 Ga0070694_1000342683 264
320 3300005444 Ga0070694_100287270 Ga0070694_1002872702 264
321 3300005444 Ga0070694_100412955 Ga0070694_1004129551 264
322 3300005445 Ga0070708_100005104 Ga0070708_1000051046 264
323 3300005456 Ga0070678_100070475 Ga0070678_1000704752 264
324 3300005457 Ga0070662_100065723 Ga0070662_1000657233 264
325 3300005457 Ga0070662_100089204 Ga0070662_1000892042 264
326 3300005457 Ga0070662_100243556 Ga0070662_1002435562 264
327 3300005457 Ga0070662_100408673 Ga0070662_1004086731 264
328 3300005458 Ga0070681_10000475 Ga0070681_100004756 264
329 3300005458 Ga0070681_10006749 Ga0070681_100067494 264
330 3300005458 Ga0070681_10008066 Ga0070681_100080662 264
331 3300005459 Ga0068867_100035843 Ga0068867_1000358435 264
332 3300005459 Ga0068867_100438454 Ga0068867_1004384542 264
333 3300005467 Ga0070706_100008151 Ga0070706_1000081513 264
334 3300005468 Ga0070707_100014181 Ga0070707_1000141812 264
335 3300005471 Ga0070698_100008518 Ga0070698_1000085186 264
336 3300005471 Ga0070698_100018959 Ga0070698_1000189593 264
337 3300005471 Ga0070698_100054512 Ga0070698_1000545122 264
338 3300005471 Ga0070698_100140077 Ga0070698_1001400772 264
339 3300005518 Ga0070699_100048347 Ga0070699_1000483471 264
340 3300005518 Ga0070699_100623576 Ga0070699_1006235761 264
341 3300005530 Ga0070679_100000307 Ga0070679_10000030732 264
342 3300005530 Ga0070679_100020664 Ga0070679_1000206643 264
343 3300005536 Ga0070697_100000176 Ga0070697_10000017620 264
344 3300005536 Ga0070697_100003300 Ga0070697_1000033007 264
345 3300005536 Ga0070697_100062956 Ga0070697_1000629562 264
346 3300005536 Ga0070697_100093480 Ga0070697_1000934802 264
347 3300005536 Ga0070697_100298306 Ga0070697_1002983062 264
348 3300005536 Ga0070697_100416902 Ga0070697_1004169021 264
349 3300005536 Ga0070697_100495410 Ga0070697_1004954102 264
350 3300005539 Ga0068853_100021562 Ga0068853_1000215622 264
351 3300005539 Ga0068853_100022682 Ga0068853_1000226825 264
352 3300005543 Ga0070672_100010434 Ga0070672_1000104342 264
353 3300005543 Ga0070672_100219260 Ga0070672_1002192601 264
354 3300005544 Ga0070686_100002923 Ga0070686_1000029234 264
355 3300005544 Ga0070686_100016272 Ga0070686_1000162722 264
356 3300005545 Ga0070695_100020382 Ga0070695_1000203822 264
357 3300005545 Ga0070695_100033141 Ga0070695_1000331413 264
358 3300005546 Ga0070696_100011221 Ga0070696_1000112214 264
359 3300005546 Ga0070696_100038428 Ga0070696_1000384282 264
360 3300005546 Ga0070696_100116105 Ga0070696_1001161051 264
361 3300005546 Ga0070696_100173594 Ga0070696_1001735942 264
362 3300005546 Ga0070696_100193537 Ga0070696_1001935372 264
363 3300005546 Ga0070696_100252713 Ga0070696_1002527132 264
364 3300005546 Ga0070696_100486320 Ga0070696_1004863201 264
365 3300005547 Ga0070693_100097113 Ga0070693_1000971132 264
366 3300005547 Ga0070693_100097213 Ga0070693_1000972132 264
367 3300005547 Ga0070693_100137430 Ga0070693_1001374302 264
368 3300005549 Ga0070704_100050453 Ga0070704_1000504533 264
369 3300005549 Ga0070704_100072147 Ga0070704_1000721472 264
370 3300005549 Ga0070704_100079533 Ga0070704_1000795332 264
371 3300005549 Ga0070704_100147629 Ga0070704_1001476292 264
372 3300005549 Ga0070704_100158231 Ga0070704_1001582312 264
373 3300005563 Ga0068855_100696091 Ga0068855_1006960912 264
374 3300005564 Ga0070664_100002835 Ga0070664_1000028351 264
375 3300005577 Ga0068857_100006192 Ga0068857_1000061925 264
376 3300005578 Ga0068854_100245768 Ga0068854_1002457683 264
377 3300005614 Ga0068856_100008247 Ga0068856_1000082473 264
378 3300005615 Ga0070702_100002632 Ga0070702_1000026323 264
379 3300005617 Ga0068859_100055373 Ga0068859_1000553734 264
380 3300005617 Ga0068859_100085575 Ga0068859_1000855754 264
381 3300005617 Ga0068859_100508451 Ga0068859_1005084512 264
382 3300005617 Ga0068859_100614479 Ga0068859_1006144792 264
383 3300005617 Ga0068859_100875917 Ga0068859_1008759171 264
384 3300005618 Ga0068864_100079899 Ga0068864_1000798994 264
385 3300005618 Ga0068864_100243304 Ga0068864_1002433041 264
386 3300005618 Ga0068864_100575878 Ga0068864_1005758782 264
387 3300005719 Ga0068861_100013443 Ga0068861_1000134433 264
388 3300005719 Ga0068861_100101313 Ga0068861_1001013132 264
389 3300005719 Ga0068861_100190488 Ga0068861_1001904882 264
390 3300005840 Ga0068870_10024721 Ga0068870_100247214 264
391 3300005840 Ga0068870_10063146 Ga0068870_100631461 264
392 3300005840 Ga0068870_10098885 Ga0068870_100988852 264
393 3300005841 Ga0068863_100161410 Ga0068863_1001614102 264
394 3300005841 Ga0068863_100273511 Ga0068863_1002735112 264
395 3300005841 Ga0068863_100434115 Ga0068863_1004341152 264
396 3300005842 Ga0068858_100736698 Ga0068858_1007366982 264
397 3300005843 Ga0068860_100031710 Ga0068860_1000317102 264
398 3300005843 Ga0068860_100033016 Ga0068860_1000330162 264
399 3300005843 Ga0068860_100144474 Ga0068860_1001444742 264
400 3300005843 Ga0068860_100398837 Ga0068860_1003988371 264
401 3300005844 Ga0068862_100025178 Ga0068862_1000251782 264
402 3300005844 Ga0068862_100154453 Ga0068862_1001544531 264
403 3300005985 Ga0081539_10003247 Ga0081539_1000324714 264
404 3300006237 Ga0097621_100001354 Ga0097621_1000013543 264
405 3300006237 Ga0097621_100010030 Ga0097621_1000100304 264
406 3300006237 Ga0097621_100590081 Ga0097621_1005900812 264
407 3300006358 Ga0068871_100003147 Ga0068871_1000031475 264
408 3300006358 Ga0068871_100022903 Ga0068871_1000229032 264
409 3300006358 Ga0068871_100163472 Ga0068871_1001634722 264
410 3300006844 Ga0075428_100255697 Ga0075428_1002556973 264
411 3300006852 Ga0075433_10035184 Ga0075433_100351844 264
412 3300006852 Ga0075433_10083717 Ga0075433_100837172 264
413 3300006852 Ga0075433_10154173 Ga0075433_101541732 264
414 3300006871 Ga0075434_100961698 Ga0075434_1009616981 264
415 3300006880 Ga0075429_100113944 Ga0075429_1001139442 264
416 3300006880 Ga0075429_100355269 Ga0075429_1003552691 264
417 3300006881 Ga0068865_100290708 Ga0068865_1002907082 264
418 3300006914 Ga0075436_100025189 Ga0075436_1000251893 264
419 3300006931 Ga0097620_100055372 Ga0097620_1000553724 264
420 3300006931 Ga0097620_100057925 Ga0097620_1000579252 264
421 3300006931 Ga0097620_100085580 Ga0097620_1000855802 264
422 3300006931 Ga0097620_100508489 Ga0097620_1005084891 264
423 3300006931 Ga0097620_100614393 Ga0097620_1006143931 264
424 3300006931 Ga0097620_100875982 Ga0097620_1008759822 264
425 3300007076 Ga0075435_100218365 Ga0075435_1002183652 264
426 3300007076 Ga0075435_100284470 Ga0075435_1002844702 264
427 3300007788 Ga0099795_10172175 Ga0099795_101721751 264
428 3300009094 Ga0111539_10503677 Ga0111539_105036772 264
429 3300009098 Ga0105245_10736301 Ga0105245_107363012 264
430 3300009101 Ga0105247_10004049 Ga0105247_100040498 264
431 3300009101 Ga0105247_10282063 Ga0105247_102820631 264
432 3300009147 Ga0114129_10012876 Ga0114129_100128765 264
433 3300009147 Ga0114129_10864319 Ga0114129_108643191 264
434 3300009148 Ga0105243_10003775 Ga0105243_1000377510 264
435 3300009148 Ga0105243_10026243 Ga0105243_100262435 264
436 3300009148 Ga0105243_10139315 Ga0105243_101393153 264
437 3300009148 Ga0105243_10242032 Ga0105243_102420322 264
438 3300009174 Ga0105241_10007255 Ga0105241_100072559 264
439 3300009174 Ga0105241_10040136 Ga0105241_100401365 264
440 3300009174 Ga0105241_10259078 Ga0105241_102590782 264
441 3300009174 Ga0105241_10566024 Ga0105241_105660242 264
442 3300009176 Ga0105242_10010215 Ga0105242_100102152 264
443 3300009176 Ga0105242_10014187 Ga0105242_100141873 264
444 3300009177 Ga0105248_10025068 Ga0105248_100250682 264
445 3300009177 Ga0105248_10036200 Ga0105248_100362004 264
446 3300009177 Ga0105248_10531423 Ga0105248_105314231 264
447 3300009545 Ga0105237_10105778 Ga0105237_101057782 264
448 3300009545 Ga0105237_10633809 Ga0105237_106338091 264
449 3300009551 Ga0105238_10016017 Ga0105238_100160173 264
450 3300009553 Ga0105249_10020353 Ga0105249_100203533 264
451 3300009553 Ga0105249_10038565 Ga0105249_100385655 264
452 3300009553 Ga0105249_10186169 Ga0105249_101861692 264
453 3300009553 Ga0105249_10484930 Ga0105249_104849302 264
454 3300011119 Ga0105246_10011216 Ga0105246_100112164 264
455 3300011119 Ga0105246_10035668 Ga0105246_100356684 264
456 3300013296 Ga0157374_10028505 Ga0157374_100285054 264
457 3300013297 Ga0157378_10019596 Ga0157378_100195963 264
458 3300013297 Ga0157378_10031930 Ga0157378_100319302 264
459 3300013297 Ga0157378_10046581 Ga0157378_100465812 264
460 3300013297 Ga0157378_10344640 Ga0157378_103446402 264
461 3300013297 Ga0157378_10771555 Ga0157378_107715552 264
462 3300013306 Ga0163162_10035373 Ga0163162_100353732 264
463 3300013306 Ga0163162_10604448 Ga0163162_106044482 264
464 3300013307 Ga0157372_10218752 Ga0157372_102187523 264
465 3300013308 Ga0157375_10178345 Ga0157375_101783452 264
466 3300013308 Ga0157375_10866746 Ga0157375_108667462 264
467 3300013308 Ga0157375_11089150 Ga0157375_110891502 264
468 3300014325 Ga0163163_10000183 Ga0163163_1000018344 264
469 3300014325 Ga0163163_10016794 Ga0163163_100167943 264
470 3300014325 Ga0163163_10060333 Ga0163163_100603332 264
471 3300014325 Ga0163163_10198897 Ga0163163_101988972 264
472 3300014326 Ga0157380_10002050 Ga0157380_1000205010 264
473 3300014326 Ga0157380_10019610 Ga0157380_100196101 264
474 3300014326 Ga0157380_10338314 Ga0157380_103383142 264
475 3300014745 Ga0157377_10093611 Ga0157377_100936112 264
476 3300014968 Ga0157379_10603927 Ga0157379_106039271 264
477 3300017792 Ga0163161_10171123 Ga0163161_101711232 264
478 3300025315 Ga0207697_10002343 Ga0207697_100023433 264
479 3300025885 Ga0207653_10007715 Ga0207653_100077152 264
480 3300025899 Ga0207642_10040291 Ga0207642_100402912 264
481 3300025900 Ga0207710_10016703 Ga0207710_100167032 264
482 3300025904 Ga0207647_10000502 Ga0207647_1000050221 264
483 3300025907 Ga0207645_10034381 Ga0207645_100343814 264
484 3300025908 Ga0207643_10069696 Ga0207643_100696962 264
485 3300025910 Ga0207684_10003122 Ga0207684_100031225 264
486 3300025910 Ga0207684_10229947 Ga0207684_102299472 264
487 3300025911 Ga0207654_10171225 Ga0207654_101712252 264
488 3300025912 Ga0207707_10000006 Ga0207707_10000006177 264
489 3300025912 Ga0207707_10011551 Ga0207707_100115512 264
490 3300025912 Ga0207707_10018360 Ga0207707_100183604 264
491 3300025912 Ga0207707_10077822 Ga0207707_100778222 264
492 3300025917 Ga0207660_10010046 Ga0207660_100100462 264
493 3300025917 Ga0207660_10235927 Ga0207660_102359271 264
494 3300025917 Ga0207660_10262851 Ga0207660_102628511 264
495 3300025918 Ga0207662_10006670 Ga0207662_100066706 264
496 3300025918 Ga0207662_10319842 Ga0207662_103198422 264
497 3300025921 Ga0207652_10000216 Ga0207652_1000021639 264
498 3300025921 Ga0207652_10050439 Ga0207652_100504392 264
499 3300025922 Ga0207646_10036840 Ga0207646_100368403 264
500 3300025922 Ga0207646_10216418 Ga0207646_102164182 264
501 3300025922 Ga0207646_10217739 Ga0207646_102177392 264
502 3300025923 Ga0207681_10012229 Ga0207681_100122293 264
503 3300025923 Ga0207681_10563150 Ga0207681_105631502 264
504 3300025925 Ga0207650_10000001 Ga0207650_10000001508 264
505 3300025925 Ga0207650_10000979 Ga0207650_1000097913 264
506 3300025925 Ga0207650_10201429 Ga0207650_102014292 264
507 3300025926 Ga0207659_10369455 Ga0207659_103694551 264
508 3300025931 Ga0207644_10021371 Ga0207644_100213713 264
509 3300025932 Ga0207690_10013855 Ga0207690_100138553 264
510 3300025932 Ga0207690_10315778 Ga0207690_103157781 264
511 3300025933 Ga0207706_10117018 Ga0207706_101170182 264
512 3300025933 Ga0207706_10155573 Ga0207706_101555732 264
513 3300025935 Ga0207709_10005499 Ga0207709_100054992 264
514 3300025935 Ga0207709_10129844 Ga0207709_101298442 264
515 3300025935 Ga0207709_10385535 Ga0207709_103855351 264
516 3300025936 Ga0207670_10032725 Ga0207670_100327253 264
517 3300025936 Ga0207670_10092825 Ga0207670_100928252 264
518 3300025938 Ga0207704_10008050 Ga0207704_100080502 264
519 3300025938 Ga0207704_10163282 Ga0207704_101632822 264
520 3300025939 Ga0207665_10186411 Ga0207665_101864111 264
521 3300025939 Ga0207665_10444434 Ga0207665_104444341 264
522 3300025940 Ga0207691_10000304 Ga0207691_1000030442 264
523 3300025940 Ga0207691_10278994 Ga0207691_102789942 264
524 3300025941 Ga0207711_10276340 Ga0207711_102763403 264
525 3300025942 Ga0207689_10000667 Ga0207689_100006672 264
526 3300025942 Ga0207689_10016438 Ga0207689_100164386 264
527 3300025942 Ga0207689_10116666 Ga0207689_101166662 264
528 3300025942 Ga0207689_10266529 Ga0207689_102665292 264
529 3300025945 Ga0207679_10019773 Ga0207679_100197733 264
530 3300025961 Ga0207712_10002974 Ga0207712_100029749 264
531 3300025981 Ga0207640_10245614 Ga0207640_102456141 264
532 3300026023 Ga0207677_10426117 Ga0207677_104261172 264
533 3300026035 Ga0207703_10174773 Ga0207703_101747732 264
534 3300026041 Ga0207639_10013582 Ga0207639_100135825 264
535 3300026041 Ga0207639_10128618 Ga0207639_101286182 264
536 3300026041 Ga0207639_10186211 Ga0207639_101862112 264
537 3300026075 Ga0207708_10009260 Ga0207708_100092608 264
538 3300026075 Ga0207708_10043249 Ga0207708_100432492 264
539 3300026075 Ga0207708_10069183 Ga0207708_100691832 264
540 3300026078 Ga0207702_10019171 Ga0207702_100191712 264
541 3300026088 Ga0207641_10131275 Ga0207641_101312752 264
542 3300026088 Ga0207641_10165711 Ga0207641_101657112 264
543 3300026088 Ga0207641_10266748 Ga0207641_102667482 264
544 3300026089 Ga0207648_10004071 Ga0207648_100040718 264
545 3300026089 Ga0207648_10143881 Ga0207648_101438811 264
546 3300026095 Ga0207676_10028840 Ga0207676_100288405 264
547 3300026116 Ga0207674_10000192 Ga0207674_1000019232 264
548 3300026116 Ga0207674_10040812 Ga0207674_100408122 264
549 3300026116 Ga0207674_10200317 Ga0207674_102003172 264
550 3300026116 Ga0207674_10557394 Ga0207674_105573942 264
551 3300026118 Ga0207675_100009094 Ga0207675_1000090947 264
552 3300026118 Ga0207675_100063754 Ga0207675_1000637542 264
553 3300026118 Ga0207675_100067632 Ga0207675_1000676322 264
554 3300026118 Ga0207675_100166624 Ga0207675_1001666241 264
555 3300026118 Ga0207675_100249299 Ga0207675_1002492991 264
556 3300026121 Ga0207683_10007724 Ga0207683_100077247 264
557 3300026142 Ga0207698_10229261 Ga0207698_102292612 264
558 3300028380 Ga0268265_10434976 Ga0268265_104349762 264
559 3300028380 Ga0268265_10500785 Ga0268265_105007852 264
560 3300028381 Ga0268264_10068000 Ga0268264_100680004 264
561 3300028381 Ga0268264_10125182 Ga0268264_101251822 264
562 3300028381 Ga0268264_10144639 Ga0268264_101446392 264
563 3300031456 Ga0307513_10179688 Ga0307513_101796884 264
564 3300031731 Ga0307405_10079152 Ga0307405_100791522 264
565 3300032005 Ga0307411_10021348 Ga0307411_100213482 264
566 3300035090 Ga0373949_0014255 Ga0373949_0014255_879_1673 264
567 3300035091 Ga0373951_0000545 Ga0373951_0000545_5726_6520 264
568 3300038443 Ga0395901_0670497 Ga0395901_0670497_229_1026 264
569 3300038996 Ga0242420_002080 Ga0242420_002080_1913_2713 264
570 3300042015 Ga0439462_0004250 Ga0439462_0004250_2188_2982 264
571 3300042156 Ga0439446_0072977 Ga0439446_0072977_104_898 264
572 3300042437 Ga0439444_0033958 Ga0439444_0033958_48_842 264
573 3300046539 Ga0495621_0032123 Ga0495621_0032123_752_1546 264
574 3300048905 Ga0496102_0034530 Ga0496102_0034530_2510_3310 264
575 3300048906 Ga0496103_0103124 Ga0496103_0103124_457_1257 264
576 3300048912 Ga0496109_0595565 Ga0496109_0595565_104_904 264
577 3300048913 Ga0496110_0197117 Ga0496110_0197117_393_1187 264
578 3300048913 Ga0496110_0347555 Ga0496110_0347555_406_1206 264
579 3300048915 Ga0496112_0159939 Ga0496112_0159939_1164_1958 264
580 3300048915 Ga0496112_0190351 Ga0496112_0190351_1139_1933 264
581 3300048916 Ga0496113_0319852 Ga0496113_0319852_198_992 264
582 3300049515 Ga0501292_003472 Ga0501292_003472_862_1656 264
583 3300049518 Ga0501295_020140 Ga0501295_020140_47_841 264
584 3300049519 Ga0501296_003319 Ga0501296_003319_391_1185 264
585 3300049521 Ga0501298_000494 Ga0501298_000494_4223_5017 264
586 3300049522 Ga0501299_017444 Ga0501299_017444_40_834 264
587 3300049649 Ga0501198_005303 Ga0501198_005303_31_825 264
588 3300049661 Ga0501217_015990 Ga0501217_015990_763_1557 264
589 3300049661 Ga0501217_026535 Ga0501217_026535_265_1059 264
590 3300049677 Ga0501247_001752 Ga0501247_001752_1086_1880 264
591 3300049679 Ga0501249_022690 Ga0501249_022690_499_1293 264
592 3300049681 Ga0501251_006716 Ga0501251_006716_394_1188 264
593 3300049688 Ga0501259_013286 Ga0501259_013286_309_1103 264
594 3300049705 Ga0501225_0025955 Ga0501225_0025955_111_905 264
595 3300049762 Ga0501265_012123 Ga0501265_012123_265_1059 264
596 3300049779 Ga0501283_002373 Ga0501283_002373_195_989 264
597 3300049779 Ga0501283_004356 Ga0501283_004356_348_1142 264
598 3300049851 Ga0501212_006737 Ga0501212_006737_557_1351 264
599 3300050507 nmdc:mga05p37_50985_c1 nmdc:mga05p37_50985_c1_666_1466 264
600 3300050508 nmdc:mga09592_105314_c1 nmdc:mga09592_105314_c1_1535_2338 264
601 3300050508 nmdc:mga09592_238366_c2 nmdc:mga09592_238366_c2_247_1041 264
602 3300050512 nmdc:mga0n895_854048_c1 nmdc:mga0n895_854048_c1_70_864 264
603 3300050513 nmdc:mga0rr50_316446_c1 nmdc:mga0rr50_316446_c1_16_816 264
604 3300050513 nmdc:mga0rr50_409550_c1 nmdc:mga0rr50_409550_c1_97_897 264
605 3300050514 nmdc:mga08x19_20266_c1 nmdc:mga08x19_20266_c1_2617_3411 264
606 3300050515 nmdc:mga0a205_15345_c1 nmdc:mga0a205_15345_c1_516_1316 264
607 3300050515 nmdc:mga0a205_22515_c1 nmdc:mga0a205_22515_c1_28_828 264
608 3300050515 nmdc:mga0a205_24883_c1 nmdc:mga0a205_24883_c1_1602_2396 264
609 3300050515 nmdc:mga0a205_422997_c1 nmdc:mga0a205_422997_c1_295_1095 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

1

193

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.7446 2 247
4bxp-assembly1.cif.gz_A structure of the wild-type tcp10 domain of danio rerio cpap 0.7416 218 244
5khr-assembly1.cif.gz_A model of human anaphase-promoting complex/cyclosome complex (apc15 deletion mutant) in complex with the e2 ube2c/ubch10 poised for ubiquitin ligation to substrate (apc/c-cdc20-substrate-ube2c) 0.7277 220 252
1g5b-assembly2.cif.gz_B bacteriophage lambda ser/thr protein phosphatase 0.7025 2 226
2qjc-assembly1.cif.gz_A crystal structure of a putative diadenosine tetraphosphatase 0.7007 2 247
ID Description Score Start End Superfamily
af_Q9HBG6_233_372_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9515 230 246 2.130.10.10
af_A0A0G2JVF8_183_402_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8845 230 244 2.130.10.10
af_Q18968_710_860_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.8634 230 246 2.40.128.630
af_Q9W040_136_373_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8305 227 244 2.130.10.10
af_F1M8Z5_583_818_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8035 230 246 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V8QEV5-F1-model_v4 Serine/threonine protein phosphatase 0.9999 3 73 GO:0005737
GO:0008803
GO:0016791
GO:0110154
AF-A0A7W0UUK4-F1-model_v4 Metallophosphoesterase 0.9779 3 159 GO:0005737
GO:0008803
GO:0016791
GO:0110154
AF-A0A2V8PW78-F1-model_v4 Serine/threonine specific protein phosphatases domain-containing protein 0.9659 1 262 GO:0005737
GO:0016791
AF-A0A2V8QEV5-F1-model_v4 Serine/threonine protein phosphatase 0.9594 3 73 GO:0005737
GO:0008803
GO:0016791
GO:0110154
AF-A0A2V8PW78-F1-model_v4 Serine/threonine specific protein phosphatases domain-containing protein 0.9552 1 262 GO:0005737
GO:0016791

Feature Viewer

pLDDT pTM Quality
89.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map