F468565

General Info

Members Datasets Scaffolds Average Seq Length
606 381 559 264

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100276959|Ga0070686_1002769591
Length 299
Sequence MTAPRSTTETGSHGAAADRGTPVVEAKGLVKRYGPVTAIAGSDLELYPGEILAVIGDNGAGKSSLIKALSGALIPDEGTIRLEGKEVRFANPMDARRAGIETVYQTLAVAPGLDIADNLFLGREQRKPGILGSVFRMLDRKHMRDEAKRHMSELGIATLQNIGQAVESLSGGQRQGVAVARSAAFGSKVVILDEPTAALGVKEGNRVLQLIRDVRDRGLPVILISHNMPHVFEIADRIHIHRLGKRVAVVDPKEHSMHDVVGIMTGAVVHDIEHKDASEKLPQIDPKESEAPQQERPAG

Samples

Sample ID Description Type Environment
1 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
2 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
3 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
4 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
5 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
6 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
7 2643221616 Leifsonia sp. Root227 Isolate Unclassified
8 2643221629 Devosia sp. Root105 Isolate Unclassified
9 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
10 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
11 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
12 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
13 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
14 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
15 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
16 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
17 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
18 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
19 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
20 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
21 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
22 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
23 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
24 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
25 2909042592 Labrys sp. LIt4 Isolate Nodule
26 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
27 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
28 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
29 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
30 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
31 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
32 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
33 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
34 2952252522 Salinicola sp. DM10 Isolate Unclassified
35 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
36 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
37 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
38 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
39 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
40 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
41 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
42 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
43 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
44 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
45 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
47 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
48 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
49 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
50 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
51 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
52 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
53 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
54 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
55 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
56 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
57 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
58 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
59 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
60 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
61 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
62 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
63 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
64 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
67 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
68 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
69 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
77 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
80 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
104 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
115 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
116 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
149 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
150 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
152 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
153 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
154 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
199 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
207 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
208 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
214 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
215 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
216 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
217 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
218 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
219 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
220 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
221 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
229 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
230 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
235 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
236 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
237 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
238 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
239 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
240 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
248 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
249 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
260 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
261 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
262 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
263 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
264 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
265 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
266 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
267 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
268 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
269 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
270 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
271 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
272 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
273 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
274 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
275 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
276 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
277 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
278 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
279 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
280 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
281 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
282 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
283 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
284 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
285 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
286 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
287 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
288 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
289 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
290 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
291 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
292 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
293 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
296 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
297 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
300 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
301 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
302 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
303 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
304 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
308 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
309 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
314 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
315 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
327 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
341 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
342 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
355 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
356 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
357 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
358 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
359 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
360 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
361 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
362 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
363 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
364 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
365 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
366 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
367 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
368 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
369 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
370 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
371 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
372 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
373 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
374 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
375 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
376 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
378 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
379 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
380 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
381 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.76
Metatranscriptomes 1.49
Isolates 7.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.09
Nodule 5.78
Rhizoplane 2.97
Rhizosphere 69.8
Stem 0
Stem Tuber 0
Unclassified 13.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1004679 3300002739 Bacteria 2045
2 JGI25151J46595_10001549 3300003187 Bacteria 15340
3 JGI25151J46595_10019898 3300003187 Bacteria 2839
4 JGI25406J46586_10011982 3300003203 Bacteria 3779
5 JGI25153J46596_10000019 3300003215 Bacteria 260291
6 rootL2_10021095 3300003322 Bacteria 3809
7 rootL2_10034493 3300003322 Bacteria 4930
8 rootL2_10093034 3300003322 Bacteria 3994
9 JGI25160J50197_1000147 3300003354 Bacteria 62036
10 JGI25161J50226_1000675 3300003374 Bacteria 13561
11 Ga0055540_1011431 3300003792 Bacteria 2862
12 Ga0055531_10020939 3300003794 Bacteria 2561
13 Ga0055543_1000129 3300004625 Bacteria 62841
14 Ga0065165_1000477 3300005262 Bacteria 62229
15 Ga0065715_10037373 3300005293 Bacteria 1262
16 Ga0070658_10095230 3300005327 Bacteria 2457
17 Ga0070676_10048599 3300005328 Bacteria 2480
18 Ga0070683_100248793 3300005329 Bacteria 1691
19 Ga0070683_100324179 3300005329 Bacteria 1466
20 Ga0070670_100123458 3300005331 Bacteria 2234
21 Ga0070677_10076918 3300005333 Bacteria 1418
22 Ga0068869_100031209 3300005334 Bacteria 3747
23 Ga0070666_10085138 3300005335 Bacteria 2165
24 Ga0070680_100252252 3300005336 Bacteria 1492
25 Ga0070680_100692360 3300005336 Bacteria 877
26 Ga0070682_100040905 3300005337 Bacteria 2854
27 Ga0068868_100048881 3300005338 Bacteria 3319
28 Ga0068868_100586973 3300005338 Bacteria 986
29 Ga0070689_100204427 3300005340 Bacteria 1614
30 Ga0070689_100496854 3300005340 Bacteria 1044
31 Ga0070687_100030182 3300005343 Bacteria 2648
32 Ga0070661_100151960 3300005344 Bacteria 1750
33 Ga0070661_100439080 3300005344 Bacteria 1037
34 Ga0070668_100167162 3300005347 Bacteria 1788
35 Ga0070668_100215448 3300005347 Bacteria 1581
36 Ga0070668_100274728 3300005347 Bacteria 1405
37 Ga0070669_100089154 3300005353 Bacteria 2310
38 Ga0070675_100247393 3300005354 Bacteria 1559
39 Ga0070674_100146594 3300005356 Bacteria 1777
40 Ga0070674_100229108 3300005356 Bacteria 1449
41 Ga0070688_100077791 3300005365 Bacteria 2138
42 Ga0070659_100039485 3300005366 Bacteria 3685
43 Ga0070659_100086128 3300005366 Bacteria 2513
44 Ga0070667_100378556 3300005367 Bacteria 1285
45 Ga0070667_100594843 3300005367 Bacteria 1019
46 Ga0070713_100070980 3300005436 Bacteria 2942
47 Ga0070710_10252708 3300005437 Bacteria 1134
48 Ga0070701_10233181 3300005438 Bacteria 1103
49 Ga0070700_100021826 3300005441 Bacteria 3725
50 Ga0070700_100238249 3300005441 Bacteria 1299
51 Ga0070663_100168329 3300005455 Bacteria 1692
52 Ga0070663_100281654 3300005455 Bacteria 1325
53 Ga0070663_100527956 3300005455 Bacteria 983
54 Ga0070662_100214147 3300005457 Bacteria 1534
55 Ga0070685_10119841 3300005466 Bacteria 1632
56 Ga0070706_100414727 3300005467 Bacteria 1253
57 Ga0070706_100839208 3300005467 Bacteria 850
58 Ga0070698_100003844 3300005471 Bacteria 16514
59 Ga0070698_100011204 3300005471 Bacteria 9527
60 Ga0070698_100121343 3300005471 Bacteria 2574
61 Ga0070698_100152824 3300005471 Bacteria 2255
62 Ga0070699_100043875 3300005518 Bacteria 3870
63 Ga0070679_100294514 3300005530 Bacteria 1574
64 Ga0070684_100031237 3300005535 Bacteria 4532
65 Ga0070684_100078361 3300005535 Bacteria 2920
66 Ga0070684_100303012 3300005535 Bacteria 1466
67 Ga0068853_100059884 3300005539 Bacteria 3290
68 Ga0070672_100228822 3300005543 Bacteria 1561
69 Ga0070686_100187545 3300005544 Bacteria 1474
70 Ga0070686_100276959 3300005544 Bacteria 1236
71 Ga0070665_100572778 3300005548 Bacteria 1142
72 Ga0068855_100579021 3300005563 Bacteria 1212
73 Ga0070664_100163306 3300005564 Bacteria 1972
74 Ga0070664_100218671 3300005564 Bacteria 1704
75 Ga0068856_100167274 3300005614 Bacteria 2210
76 Ga0068856_100393938 3300005614 Bacteria 1405
77 Ga0068856_100405504 3300005614 Bacteria 1383
78 Ga0070702_100035313 3300005615 Bacteria 2761
79 Ga0070702_100284253 3300005615 Bacteria 1137
80 Ga0068859_100050436 3300005617 Bacteria 4180
81 Ga0068859_100231883 3300005617 Bacteria 1934
82 Ga0068859_100267153 3300005617 Bacteria 1802
83 Ga0068859_100381962 3300005617 Bacteria 1504
84 Ga0068866_10144317 3300005718 Bacteria 1370
85 Ga0068851_10148789 3300005834 Bacteria 1279
86 Ga0068860_100387526 3300005843 Bacteria 1380
87 Ga0068860_100489645 3300005843 Bacteria 1226
88 Ga0068862_100057284 3300005844 Bacteria 3341
89 Ga0068862_100082549 3300005844 Bacteria 2789
90 Ga0068862_100113799 3300005844 Bacteria 2378
91 Ga0068862_100458472 3300005844 Bacteria 1203
92 Ga0081455_10047563 3300005937 Bacteria 3714
93 Ga0081455_10057779 3300005937 Bacteria 3286
94 Ga0081455_10104029 3300005937 Bacteria 2272
95 Ga0081540_1015586 3300005983 Bacteria 4806
96 Ga0081540_1109767 3300005983 Bacteria 1169
97 Ga0081540_1119509 3300005983 Bacteria 1096
98 Ga0081539_10000126 3300005985 Bacteria 180324
99 Ga0081539_10000625 3300005985 Bacteria 71667
100 Ga0081539_10000637 3300005985 Bacteria 70993
101 Ga0081539_10003444 3300005985 Bacteria 19435
102 Ga0081539_10005772 3300005985 Bacteria 12340
103 Ga0081539_10007415 3300005985 Bacteria 10010
104 Ga0081539_10011727 3300005985 Bacteria 6874
105 Ga0081539_10011985 3300005985 Bacteria 6757
106 Ga0081539_10017034 3300005985 Bacteria 5134
107 Ga0081539_10074717 3300005985 Bacteria 1804
108 Ga0070717_10058519 3300006028 Bacteria 3187
109 Ga0070716_100004860 3300006173 Bacteria 6462
110 Ga0075369_10019363 3300006186 Bacteria 2779
111 Ga0075366_10231959 3300006195 Bacteria 1125
112 Ga0068871_100113946 3300006358 Bacteria 2277
113 Ga0075428_100167804 3300006844 Bacteria 2381
114 Ga0075428_100463180 3300006844 Bacteria 1357
115 Ga0075430_100134205 3300006846 Bacteria 2063
116 Ga0075430_100226671 3300006846 Bacteria 1550
117 Ga0075431_100028517 3300006847 Bacteria 5739
118 Ga0075434_100143599 3300006871 Bacteria 2407
119 Ga0068865_100019996 3300006881 Bacteria 4339
120 Ga0068865_100363688 3300006881 Bacteria 1176
121 Ga0068865_100410742 3300006881 Bacteria 1111
122 Ga0068865_100535412 3300006881 Bacteria 982
123 Ga0097620_100050436 3300006931 Bacteria 4180
124 Ga0097620_100231886 3300006931 Bacteria 1934
125 Ga0097620_100267147 3300006931 Bacteria 1802
126 Ga0079104_1003546 3300006946 Bacteria 7174
127 Ga0099826_10009641 3300006948 Bacteria 7211
128 Ga0105240_10108889 3300009093 Bacteria 3356
129 Ga0111539_10010363 3300009094 Bacteria 11736
130 Ga0111539_10069633 3300009094 Bacteria 4154
131 Ga0111539_10305644 3300009094 Bacteria 1851
132 Ga0111539_10588167 3300009094 Bacteria 1296
133 Ga0114129_10003154 3300009147 Bacteria 23134
134 Ga0114129_10647522 3300009147 Bacteria 1364
135 Ga0105243_10059707 3300009148 Bacteria 3044
136 Ga0105243_10174335 3300009148 Bacteria 1865
137 Ga0105241_10050487 3300009174 Bacteria 3170
138 Ga0105242_10224843 3300009176 Bacteria 1679
139 Ga0105248_10223354 3300009177 Bacteria 2120
140 Ga0105237_10111977 3300009545 Bacteria 2721
141 Ga0105237_10263238 3300009545 Bacteria 1727
142 Ga0105238_10372651 3300009551 Bacteria 1418
143 Ga0105238_10872705 3300009551 Bacteria 917
144 Ga0105249_10105939 3300009553 Bacteria 2651
145 Ga0105249_10124621 3300009553 Bacteria 2452
146 Ga0105249_10437986 3300009553 Bacteria 1344
147 Ga0105032_104024 3300009979 Bacteria 1261
148 Ga0105239_10198574 3300010375 Bacteria 2247
149 Ga0105239_10591175 3300010375 Bacteria 1266
150 Ga0105246_10125784 3300011119 Bacteria 1907
151 Ga0105246_10384664 3300011119 Bacteria 1160
152 Ga0157371_10324675 3300013102 Bacteria 1117
153 Ga0157369_10169849 3300013105 Bacteria 2298
154 Ga0157369_10341140 3300013105 Bacteria 1556
155 Ga0157369_10476009 3300013105 Bacteria 1292
156 Ga0157374_10032892 3300013296 Bacteria 4727
157 Ga0157374_10159632 3300013296 Bacteria 2196
158 Ga0157374_10197379 3300013296 Bacteria 1969
159 Ga0157378_10091360 3300013297 Bacteria 2767
160 Ga0157378_10141186 3300013297 Bacteria 2237
161 Ga0163162_10255599 3300013306 Bacteria 1884
162 Ga0157372_10369368 3300013307 Bacteria 1672
163 Ga0157372_10498852 3300013307 Bacteria 1419
164 Ga0157372_10695120 3300013307 Bacteria 1184
165 Ga0157375_10278171 3300013308 Bacteria 1837
166 Ga0157375_10429746 3300013308 Bacteria 1487
167 Ga0163163_10085665 3300014325 Bacteria 3159
168 Ga0163163_10102051 3300014325 Bacteria 2892
169 Ga0157380_10016085 3300014326 Bacteria 5511
170 Ga0157380_10133460 3300014326 Bacteria 2122
171 Ga0157377_10049872 3300014745 Bacteria 2355
172 Ga0157377_10090477 3300014745 Bacteria 1806
173 Ga0157379_10098680 3300014968 Bacteria 2622
174 Ga0157376_10072154 3300014969 Bacteria 2936
175 Ga0157376_10163440 3300014969 Bacteria 2020
176 Ga0163161_10179140 3300017792 Bacteria 1624
177 Ga0163161_10276361 3300017792 Bacteria 1316
178 Ga0197907_10385080 3300020069 Bacteria 2793
179 Ga0206351_10974719 3300020077 Bacteria 4726
180 Ga0206350_10575891 3300020080 Bacteria 4663
181 Ga0154015_1648053 3300020610 Bacteria 1709
182 Ga0213874_10024230 3300021377 Bacteria 1700
183 Ga0213876_10008246 3300021384 Bacteria 5638
184 Ga0213875_10000999 3300021388 Bacteria 20157
185 Ga0213871_10019812 3300021441 Bacteria 1660
186 Ga0224712_10001521 3300022467 Bacteria 5379
187 Ga0224712_10068507 3300022467 Bacteria 1434
188 Ga0228711_1010705 3300022739 Bacteria 11957
189 Ga0228710_1004002 3300022740 Bacteria 23308
190 Ga0209436_100321 3300025208 Bacteria 21971
191 Ga0209673_1048255 3300025273 Bacteria 1148
192 Ga0209130_1000234 3300025284 Bacteria 71914
193 Ga0209025_1000148 3300025294 Bacteria 179802
194 Ga0209025_1001085 3300025294 Bacteria 39382
195 Ga0209025_1096319 3300025294 Bacteria 951
196 Ga0209758_1000028 3300025297 Bacteria 530102
197 Ga0207426_1000410 3300025302 Bacteria 71914
198 Ga0209051_1000151 3300025303 Bacteria 131835
199 Ga0209257_1000688 3300025304 Bacteria 52564
200 Ga0209257_1009307 3300025304 Bacteria 5306
201 Ga0207656_10123726 3300025321 Bacteria 1206
202 Ga0207642_10031982 3300025899 Bacteria 2210
203 Ga0207642_10228734 3300025899 Bacteria 1043
204 Ga0207710_10103502 3300025900 Bacteria 1345
205 Ga0207688_10053057 3300025901 Bacteria 2273
206 Ga0207688_10065102 3300025901 Bacteria 2059
207 Ga0207647_10120478 3300025904 Bacteria 1547
208 Ga0207645_10167248 3300025907 Bacteria 1440
209 Ga0207643_10030850 3300025908 Bacteria 2986
210 Ga0207684_10230102 3300025910 Bacteria 1599
211 Ga0207684_10261286 3300025910 Bacteria 1494
212 Ga0207684_10391971 3300025910 Bacteria 1194
213 Ga0207662_10010208 3300025918 Bacteria 5179
214 Ga0207662_10066514 3300025918 Bacteria 2172
215 Ga0207662_10125744 3300025918 Bacteria 1612
216 Ga0207657_10190637 3300025919 Bacteria 1654
217 Ga0207652_10064459 3300025921 Bacteria 3171
218 Ga0207652_10254170 3300025921 Bacteria 1585
219 Ga0207646_10081275 3300025922 Bacteria 2897
220 Ga0207681_10124747 3300025923 Bacteria 1894
221 Ga0207694_10285465 3300025924 Bacteria 1356
222 Ga0207650_10473936 3300025925 Bacteria 1044
223 Ga0207687_10051809 3300025927 Bacteria 2862
224 Ga0207706_10162215 3300025933 Bacteria 1965
225 Ga0207709_10120437 3300025935 Bacteria 1771
226 Ga0207670_10091523 3300025936 Bacteria 2151
227 Ga0207691_10215311 3300025940 Bacteria 1667
228 Ga0207711_10225018 3300025941 Bacteria 1717
229 Ga0207711_10481852 3300025941 Bacteria 1156
230 Ga0207689_10080230 3300025942 Bacteria 2682
231 Ga0207679_10155566 3300025945 Bacteria 1866
232 Ga0207679_10324152 3300025945 Bacteria 1335
233 Ga0207712_10007694 3300025961 Bacteria 6813
234 Ga0207668_10005051 3300025972 Bacteria 7765
235 Ga0207668_10008857 3300025972 Bacteria 6017
236 Ga0207668_10184120 3300025972 Bacteria 1650
237 Ga0207640_10138137 3300025981 Bacteria 1772
238 Ga0207658_10077762 3300025986 Bacteria 2533
239 Ga0207678_10000467 3300026067 Bacteria 36612
240 Ga0207678_10018585 3300026067 Bacteria 6103
241 Ga0207678_10775748 3300026067 Bacteria 846
242 Ga0207708_10012373 3300026075 Bacteria 6359
243 Ga0207708_10099757 3300026075 Bacteria 2246
244 Ga0207708_10205872 3300026075 Bacteria 1571
245 Ga0207708_10300090 3300026075 Bacteria 1306
246 Ga0207702_10075671 3300026078 Bacteria 2909
247 Ga0207702_10222848 3300026078 Bacteria 1758
248 Ga0207641_10278060 3300026088 Bacteria 1573
249 Ga0207648_10361910 3300026089 Bacteria 1309
250 Ga0207676_10077355 3300026095 Bacteria 2691
251 Ga0207674_10054248 3300026116 Bacteria 4081
252 Ga0207674_10247353 3300026116 Bacteria 1730
253 Ga0207675_100138020 3300026118 Bacteria 2315
254 Ga0207683_10218524 3300026121 Bacteria 1736
255 Ga0207683_10552097 3300026121 Bacteria 1065
256 Ga0207698_10146122 3300026142 Bacteria 2045
257 Ga0209281_1002478 3300027111 Bacteria 7339
258 Ga0209983_1055110 3300027665 Bacteria 873
259 Ga0209282_1006327 3300027666 Bacteria 7348
260 Ga0268266_10072249 3300028379 Bacteria 2991
261 Ga0268266_10220387 3300028379 Bacteria 1744
262 Ga0268265_10040511 3300028380 Bacteria 3441
263 Ga0268265_10217404 3300028380 Bacteria 1669
264 Ga0268265_10283063 3300028380 Bacteria 1484
265 Ga0268264_10517697 3300028381 Bacteria 1166
266 Ga0307517_10091100 3300028786 Bacteria 2494
267 Ga0307517_10138535 3300028786 Bacteria 1719
268 Ga0307515_10004370 3300028794 Bacteria 29310
269 Ga0307515_10008974 3300028794 Bacteria 19426
270 Ga0307515_10065639 3300028794 Bacteria 5045
271 Ga0307515_10068670 3300028794 Bacteria 4863
272 Ga0307515_10072941 3300028794 Bacteria 4623
273 Ga0307515_10177356 3300028794 Bacteria 2096
274 Ga0307515_10202591 3300028794 Bacteria 1855
275 Ga0265338_10182629 3300028800 Bacteria 1598
276 Ga0307511_10000018 3300030521 Bacteria 118259
277 Ga0307512_10025405 3300030522 Bacteria 5249
278 Ga0307512_10048766 3300030522 Bacteria 3424
279 Ga0307512_10080563 3300030522 Bacteria 2343
280 Ga0307512_10182825 3300030522 Bacteria 1174
281 Ga0265325_10035191 3300031241 Bacteria 2662
282 Ga0265340_10000264 3300031247 Bacteria 27200
283 Ga0265340_10001252 3300031247 Bacteria 14590
284 Ga0265339_10014693 3300031249 Bacteria 4713
285 Ga0265316_10009686 3300031344 Bacteria 8845
286 Ga0307513_10003112 3300031456 Bacteria 22645
287 Ga0307513_10006535 3300031456 Bacteria 15225
288 Ga0307513_10034606 3300031456 Bacteria 5666
289 Ga0307513_10078136 3300031456 Bacteria 3424
290 Ga0307513_10146342 3300031456 Bacteria 2280
291 Ga0307513_10267271 3300031456 Unclassified 1496
292 Ga0307513_10284528 3300031456 Bacteria 1429
293 Ga0307509_10019257 3300031507 Bacteria 7791
294 Ga0307509_10268801 3300031507 Bacteria 1474
295 Ga0307509_10517374 3300031507 Bacteria 875
296 Ga0307408_100616705 3300031548 Bacteria 966
297 Ga0265313_10006384 3300031595 Bacteria 8365
298 Ga0307508_10032834 3300031616 Bacteria 4687
299 Ga0307508_10161641 3300031616 Bacteria 1843
300 Ga0307508_10344043 3300031616 Bacteria 1083
301 Ga0316575_10091944 3300031665 Bacteria 1229
302 Ga0265342_10007507 3300031712 Bacteria 7977
303 Ga0316576_10285238 3300031727 Bacteria 1236
304 Ga0307516_10001110 3300031730 Bacteria 37506
305 Ga0307516_10062844 3300031730 Bacteria 3596
306 Ga0307516_10092896 3300031730 Bacteria 2844
307 Ga0307516_10118217 3300031730 Bacteria 2445
308 Ga0307516_10165195 3300031730 Bacteria 1959
309 Ga0307516_10170528 3300031730 Bacteria 1917
310 Ga0307405_10570842 3300031731 Bacteria 919
311 Ga0316577_10001658 3300031733 Bacteria 10647
312 Ga0307413_10092983 3300031824 Bacteria 1970
313 Ga0307410_10013090 3300031852 Bacteria 4827
314 Ga0307410_10027433 3300031852 Bacteria 3600
315 Ga0307410_10032173 3300031852 Bacteria 3373
316 Ga0307406_10060053 3300031901 Bacteria 2450
317 Ga0307406_10444874 3300031901 Bacteria 1038
318 Ga0307407_10030825 3300031903 Bacteria 2898
319 Ga0307412_10728069 3300031911 Bacteria 854
320 Ga0315914_1006088 3300031967 Bacteria 17251
321 Ga0307409_100041508 3300031995 Bacteria 3437
322 Ga0307409_100054873 3300031995 Bacteria 3072
323 Ga0307409_100059667 3300031995 Bacteria 2970
324 Ga0307409_100125537 3300031995 Bacteria 2182
325 Ga0307409_100140161 3300031995 Bacteria 2082
326 Ga0307409_100154556 3300031995 Bacteria 1997
327 Ga0307409_100230997 3300031995 Bacteria 1677
328 Ga0307409_100333330 3300031995 Bacteria 1425
329 Ga0307409_100653347 3300031995 Bacteria 1046
330 Ga0307416_100017610 3300032002 Bacteria 5006
331 Ga0307416_100065503 3300032002 Bacteria 2986
332 Ga0307416_100070045 3300032002 Bacteria 2906
333 Ga0307416_100176676 3300032002 Bacteria 1996
334 Ga0307411_10134806 3300032005 Bacteria 1811
335 Ga0307411_10204669 3300032005 Bacteria 1519
336 Ga0307415_100002826 3300032126 Bacteria 8694
337 Ga0307415_100022456 3300032126 Bacteria 3894
338 Ga0307415_100025086 3300032126 Bacteria 3735
339 Ga0307415_100276505 3300032126 Bacteria 1378
340 Ga0307507_10034587 3300033179 Bacteria 5214
341 Ga0307507_10304869 3300033179 Bacteria 973
342 Ga0307510_10073095 3300033180 Bacteria 3401
343 Ga0315913_1009766 3300033430 Bacteria 11183
344 Ga0315915_1013567 3300033464 Bacteria 8345
345 Ga0373950_0009114 3300034818 Bacteria 1576
346 Ga0373938_0003915 3300034957 Bacteria 2462
347 Ga0373951_0000019 3300035091 Bacteria 63710
348 Ga0373932_0067724 3300035112 Bacteria 1100
349 Ga0373941_0017724 3300035115 Bacteria 1956
350 Ga0373954_0074605 3300035118 Bacteria 1615
351 Ga0373955_0161046 3300035172 Bacteria 1325
352 Ga0373942_0000361 3300035207 Bacteria 12507
353 Ga0373962_0000437 3300035242 Bacteria 9118
354 Ga0373962_0004433 3300035242 Bacteria 3392
355 Ga0373931_0223046 3300035691 Bacteria 1136
356 Ga0373931_0233636 3300035691 Bacteria 1112
357 Ga0373935_0325304 3300035692 Bacteria 1092
358 Ga0373935_0491823 3300035692 Bacteria 890
359 Ga0373927_0205054 3300035695 Bacteria 1295
360 Ga0373937_0397672 3300036401 Bacteria 1307
361 Ga0316584_0111828 3300036712 Bacteria 2044
362 Ga0373925_0072324 3300037068 Bacteria 2609
363 Ga0373925_0271516 3300037068 Bacteria 1364
364 Ga0395899_0009166 3300037312 Bacteria 7601
365 Ga0395900_0002343 3300037418 Bacteria 20976
366 Ga0395898_0001662 3300037466 Bacteria 29830
367 Ga0395898_0005170 3300037466 Bacteria 14117
368 Ga0395898_0524786 3300037466 Bacteria 1126
369 Ga0395905_0003552 3300037471 Bacteria 16606
370 Ga0395905_0328424 3300037471 Bacteria 1420
371 Ga0436364_0440359 3300037853 Bacteria 3349
372 Ga0436364_0821552 3300037853 Bacteria 4804
373 Ga0395901_0001195 3300038443 Bacteria 27615
374 Ga0395901_0034366 3300038443 Bacteria 5235
375 Ga0395901_0206282 3300038443 Bacteria 2059
376 Ga0400484_07329 3300038725 Bacteria 3154
377 Ga0400484_17835 3300038725 Bacteria 9328
378 Ga0400490_19280 3300038726 Bacteria 13156
379 Ga0400490_32168 3300038726 Bacteria 1453
380 Ga0400490_50315 3300038726 Bacteria 3807
381 Ga0400485_15476 3300038735 Bacteria 17000
382 Ga0400488_13961 3300038741 Bacteria 16027
383 Ga0400488_44356 3300038741 Bacteria 2613
384 Ga0400488_55735 3300038741 Bacteria 5310
385 Ga0400486_16545 3300038742 Bacteria 17067
386 Ga0400483_056450 3300039062 Bacteria 5765
387 Ga0400483_157671 3300039062 Bacteria 11039
388 Ga0400489_00529 3300039093 Bacteria 8812
389 Ga0400489_03098 3300039093 Bacteria 10205
390 Ga0400487_06944 3300039110 Bacteria 16691
391 Ga0400487_22271 3300039110 Bacteria 1839
392 Ga0436365_0212978 3300039437 Bacteria 12450
393 Ga0436365_1884481 3300039437 Bacteria 1483
394 Ga0436360_0530628 3300039438 Bacteria 4361
395 Ga0436361_0218515 3300039447 Bacteria 1838
396 Ga0436361_0302978 3300039447 Bacteria 1550
397 Ga0436361_0410902 3300039447 Bacteria 1253
398 Ga0439436_0031243 3300041404 Bacteria 1546
399 Ga0451791_0926953 3300041451 Bacteria 4546
400 Ga0451807_0376592 3300041486 Bacteria 1480
401 Ga0451837_0235358 3300041494 Bacteria 1134
402 Ga0451853_1042061 3300041512 Bacteria 815
403 Ga0439441_044549 3300042001 Bacteria 898
404 Ga0439443_010104 3300042003 Bacteria 1364
405 Ga0439445_0052494 3300042004 Bacteria 1103
406 Ga0439449_0000640 3300042007 Bacteria 13147
407 Ga0439449_0003455 3300042007 Bacteria 6148
408 Ga0439449_0042470 3300042007 Bacteria 1689
409 Ga0439463_040161 3300042016 Bacteria 1189
410 Ga0439446_0025891 3300042156 Bacteria 1678
411 Ga0439444_0027935 3300042437 Bacteria 1042
412 Ga0439460_0031821 3300042461 Bacteria 1507
413 Ga0466969_0004693 3300044656 Bacteria 7280
414 Ga0466972_0001381 3300044658 Bacteria 11774
415 Ga0466965_0009209 3300044683 Bacteria 4587
416 Ga0466965_0087329 3300044683 Bacteria 1583
417 Ga0466966_0002186 3300044684 Bacteria 12692
418 Ga0466961_0239846 3300044693 Bacteria 1114
419 Ga0466963_0221000 3300044694 Bacteria 1327
420 Ga0466970_0123530 3300044765 Bacteria 1419
421 Ga0466959_0031539 3300045049 Bacteria 3920
422 Ga0451576_0011765 3300045051 Bacteria 9910
423 Ga0466958_0155968 3300045836 Bacteria 1441
424 Ga0466967_0317524 3300045976 Bacteria 1502
425 Ga0466967_0318895 3300045976 Bacteria 1498
426 Ga0495603_0161135 3300046455 Bacteria 1301
427 Ga0495629_0050815 3300046459 Bacteria 2903
428 Ga0495638_0015949 3300046460 Bacteria 5036
429 Ga0495641_0012815 3300046461 Bacteria 4655
430 Ga0495651_0023410 3300046462 Bacteria 4802
431 Ga0495651_0174114 3300046462 Bacteria 1530
432 Ga0495650_0056498 3300046471 Bacteria 1592
433 Ga0495583_0000321 3300046506 Bacteria 75664
434 Ga0495583_0000957 3300046506 Bacteria 33535
435 Ga0495610_0007440 3300046512 Bacteria 7285
436 Ga0495618_0039748 3300046514 Bacteria 2958
437 Ga0495628_0268589 3300046516 Bacteria 1269
438 Ga0495668_0220038 3300046616 Bacteria 1040
439 Ga0495613_0051938 3300046689 Bacteria 3020
440 Ga0495624_0040824 3300046690 Bacteria 2971
441 Ga0495589_0149714 3300046794 Bacteria 1115
442 Ga0495674_0027455 3300047319 Bacteria 5203
443 Ga0495680_0002178 3300047322 Bacteria 20273
444 Ga0496102_0175669 3300048905 Bacteria 2017
445 Ga0496102_1148589 3300048905 Bacteria 696
446 Ga0496104_0429500 3300048907 Bacteria 1233
447 Ga0496105_0540410 3300048908 Bacteria 911
448 Ga0496108_0000136 3300048911 Bacteria 71114
449 Ga0496108_0074415 3300048911 Bacteria 2868
450 Ga0496108_0530424 3300048911 Bacteria 1028
451 Ga0496109_0042582 3300048912 Bacteria 4114
452 Ga0496109_0304051 3300048912 Bacteria 1504
453 Ga0496110_0050865 3300048913 Bacteria 3640
454 Ga0496110_0185520 3300048913 Bacteria 1889
455 Ga0496110_0241084 3300048913 Bacteria 1645
456 Ga0496112_0180664 3300048915 Bacteria 2074
457 Ga0496112_0745756 3300048915 Bacteria 906
458 Ga0496113_0340715 3300048916 Bacteria 1202
459 Ga0496114_0085841 3300048917 Bacteria 2666
460 Ga0496117_0000912 3300048920 Bacteria 45269
461 Ga0496122_0000364 3300048925 Bacteria 97193
462 Ga0496123_0000094 3300048926 Bacteria 178612
463 Ga0496124_0000741 3300048927 Bacteria 53446
464 Ga0496125_0002252 3300048928 Bacteria 25630
465 Ga0496125_0086256 3300048928 Bacteria 2375
466 Ga0496126_0000418 3300048929 Bacteria 85944
467 Ga0501308_000288 3300049128 Bacteria 3044
468 Ga0501301_004766 3300049524 Bacteria 974
469 Ga0501311_011109 3300049527 Bacteria 1104
470 Ga0501031_0125742 3300049568 Bacteria 1675
471 Ga0501032_0006089 3300049569 Bacteria 8885
472 Ga0501033_0025989 3300049570 Bacteria 4406
473 Ga0501033_0236042 3300049570 Bacteria 1298
474 Ga0501033_0411059 3300049570 Bacteria 943
475 Ga0501034_0046126 3300049571 Bacteria 4403
476 Ga0501034_0775769 3300049571 Bacteria 853
477 Ga0501036_0103311 3300049572 Bacteria 2410
478 Ga0501036_0133139 3300049572 Bacteria 2098
479 Ga0501037_0022613 3300049573 Bacteria 4649
480 Ga0501038_0001456 3300049574 Bacteria 21753
481 Ga0501038_0099275 3300049574 Bacteria 2427
482 Ga0501039_0033041 3300049575 Bacteria 3991
483 Ga0501043_0017631 3300049579 Bacteria 5599
484 Ga0501046_0009615 3300049580 Bacteria 8338
485 Ga0501046_0073211 3300049580 Bacteria 2659
486 Ga0501047_0017612 3300049581 Bacteria 6845
487 Ga0501047_0227897 3300049581 Bacteria 1718
488 Ga0501048_0025412 3300049582 Bacteria 4316
489 Ga0501067_0014017 3300049583 Bacteria 4440
490 Ga0501067_0111553 3300049583 Bacteria 1521
491 Ga0501068_0060285 3300049584 Bacteria 2304
492 Ga0501069_0000186 3300049585 Bacteria 27883
493 Ga0501069_0044750 3300049585 Bacteria 2451
494 Ga0501070_0009024 3300049586 Bacteria 8436
495 Ga0501070_0394805 3300049586 Bacteria 1119
496 Ga0501071_0175852 3300049587 Bacteria 1603
497 Ga0501072_0067789 3300049588 Bacteria 2816
498 Ga0501073_0017595 3300049589 Bacteria 5176
499 Ga0501073_0032382 3300049589 Bacteria 3726
500 Ga0501073_0122210 3300049589 Bacteria 1804
501 Ga0501074_0002793 3300049590 Bacteria 12217
502 Ga0501074_0141109 3300049590 Bacteria 1723
503 Ga0501075_0429954 3300049591 Bacteria 1007
504 Ga0501079_0329089 3300049741 Bacteria 1196
505 Ga0501080_0001486 3300049742 Bacteria 19779
506 Ga0501080_0006549 3300049742 Bacteria 10467
507 Ga0501080_0031148 3300049742 Bacteria 4970
508 Ga0501080_0079992 3300049742 Bacteria 3038
509 Ga0501083_0005967 3300049744 Bacteria 8624
510 Ga0501083_0010321 3300049744 Bacteria 6578
511 Ga0501035_0019378 3300049822 Bacteria 6258
512 Ga0501044_0045876 3300049823 Bacteria 4526
513 Ga0501044_0262827 3300049823 Bacteria 1664
514 nmdc:mga05p37_611325_c1 3300050507 Bacteria 1228
515 nmdc:mga05p37_669460_c1 3300050507 Bacteria 1159
516 nmdc:mga05p37_70192_c1 3300050507 Bacteria 4309
517 nmdc:mga09592_120498_c1 3300050508 Bacteria 2253
518 nmdc:mga09592_121881_c1 3300050508 Bacteria 2240
519 nmdc:mga09592_752817_c1 3300050508 Bacteria 826
520 nmdc:mga0qj67_17827_c2 3300050509 Bacteria 3345
521 nmdc:mga0qj67_27984_c1 3300050509 Bacteria 4373
522 nmdc:mga06r32_1502_c1 3300050510 Bacteria 20961
523 nmdc:mga08y16_181087_c1 3300050511 Bacteria 2188
524 nmdc:mga08y16_278294_c1 3300050511 Bacteria 1726
525 nmdc:mga08y16_555291_c1 3300050511 Bacteria 1162
526 Ga0500578_0000683 3300053086 Bacteria 40592
527 Ga0500578_0015335 3300053086 Bacteria 4926
528 Ga0500644_0007215 3300053088 Bacteria 2886
529 Ga0500644_0115506 3300053088 Bacteria 1039
530 Ga0500646_0012505 3300053090 Bacteria 2191
531 Ga0500651_0028674 3300053093 Bacteria 3500
532 Ga0500641_0007723 3300053096 Bacteria 3833
533 Ga0500641_0013554 3300053096 Bacteria 2996
534 Ga0500556_0000469 3300053104 Bacteria 28449
535 Ga0500556_0078962 3300053104 Bacteria 1241
536 Ga0500562_023520 3300053108 Bacteria 1609
537 Ga0500594_0100429 3300053118 Bacteria 890
538 Ga0500595_007283 3300053119 Bacteria 4594
539 Ga0500642_0111052 3300053130 Bacteria 1280
540 Ga0500652_014571 3300053131 Bacteria 2815
541 Ga0500604_0001711 3300053151 Bacteria 6150
542 Ga0500604_0086314 3300053151 Bacteria 1020
543 Ga0500616_0001651 3300053153 Bacteria 20626
544 Ga0500616_0001912 3300053153 Bacteria 18607
545 Ga0500616_0001922 3300053153 Bacteria 18561
546 Ga0500616_0046551 3300053153 Bacteria 2305
547 Ga0500636_0020970 3300053177 Bacteria 3869
548 Ga0500636_0046727 3300053177 Bacteria 2552
549 Ga0500609_001646 3300053731 Bacteria 3258
550 Ga0500609_017868 3300053731 Bacteria 964
551 Ga0500599_006284 3300053736 Bacteria 1512
552 Ga0501084_0009489 3300054114 Bacteria 8053
553 Ga0501084_0017454 3300054114 Bacteria 5966
554 Ga0501084_0491750 3300054114 Bacteria 1037
555 Ga0587069_019247 3300059642 Bacteria 1007
556 Ga0501082_0013701 3300060353 Bacteria 6969
557 Ga0501082_0103648 3300060353 Bacteria 2461
558 Ga0501082_0517766 3300060353 Bacteria 1043
559 Ga0466962_0054728 3300061719 Bacteria 1907

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_1148589 Ga0496102_1148589_15_683 212
2 3300048908 Ga0496105_0540410 Ga0496105_0540410_99_854 213
3 3300041512 Ga0451853_1042061 Ga0451853_1042061_28_768 215
4 3300053104 Ga0500556_0078962 Ga0500556_0078962_332_1144 217
5 3300006028 Ga0070717_10058519 Ga0070717_100585192 221
6 3300046506 Ga0495583_0000957 Ga0495583_0000957_6451_7305 221
7 3300050508 nmdc:mga09592_752817_c1 nmdc:mga09592_752817_c1_145_810 221
8 3300005985 Ga0081539_10011985 Ga0081539_100119853 223
9 3300037853 Ga0436364_0821552 Ga0436364_0821552_2119_2925 227
10 3300050508 nmdc:mga09592_121881_c1 nmdc:mga09592_121881_c1_1193_1888 228
11 3300005937 Ga0081455_10047563 Ga0081455_100475633 231
12 3300014745 Ga0157377_10049872 Ga0157377_100498723 231
13 3300005535 Ga0070684_100303012 Ga0070684_1003030122 232
14 3300005614 Ga0068856_100393938 Ga0068856_1003939382 232
15 3300025945 Ga0207679_10155566 Ga0207679_101555662 232
16 3300026067 Ga0207678_10775748 Ga0207678_107757482 232
17 3300026078 Ga0207702_10075671 Ga0207702_100756713 232
18 3300003322 rootL2_10034493 rootL2_100344933 233
19 3300005937 Ga0081455_10057779 Ga0081455_100577792 233
20 3300005535 Ga0070684_100031237 Ga0070684_1000312373 234
21 3300025921 Ga0207652_10064459 Ga0207652_100644593 235
22 3300046459 Ga0495629_0050815 Ga0495629_0050815_48_875 235
23 3300046461 Ga0495641_0012815 Ga0495641_0012815_1972_2799 235
24 3300046514 Ga0495618_0039748 Ga0495618_0039748_216_1043 235
25 3300046689 Ga0495613_0051938 Ga0495613_0051938_1503_2330 235
26 3300046690 Ga0495624_0040824 Ga0495624_0040824_229_1056 235
27 3300047319 Ga0495674_0027455 Ga0495674_0027455_2085_2912 235
28 3300047322 Ga0495680_0002178 Ga0495680_0002178_13872_14699 235
29 3300031665 Ga0316575_10091944 Ga0316575_100919442 238
30 3300049585 Ga0501069_0044750 Ga0501069_0044750_1125_1961 238
31 3300049587 Ga0501071_0175852 Ga0501071_0175852_369_1205 238
32 3300049588 Ga0501072_0067789 Ga0501072_0067789_109_945 238
33 3300049590 Ga0501074_0141109 Ga0501074_0141109_358_1194 238
34 3300049591 Ga0501075_0429954 Ga0501075_0429954_26_862 238
35 3300049741 Ga0501079_0329089 Ga0501079_0329089_127_963 238
36 3300053118 Ga0500594_0100429 Ga0500594_0100429_39_788 238
37 3300054114 Ga0501084_0009489 Ga0501084_0009489_5232_6068 238
38 3300060353 Ga0501082_0517766 Ga0501082_0517766_141_977 238
39 3300005344 Ga0070661_100439080 Ga0070661_1004390802 239
40 3300005535 Ga0070684_100078361 Ga0070684_1000783612 239
41 3300005543 Ga0070672_100228822 Ga0070672_1002288222 239
42 3300006844 Ga0075428_100167804 Ga0075428_1001678042 239
43 3300006871 Ga0075434_100143599 Ga0075434_1001435991 239
44 3300006881 Ga0068865_100363688 Ga0068865_1003636882 239
45 3300009094 Ga0111539_10588167 Ga0111539_105881671 239
46 3300009147 Ga0114129_10003154 Ga0114129_1000315410 239
47 3300009148 Ga0105243_10059707 Ga0105243_100597072 239
48 3300009177 Ga0105248_10223354 Ga0105248_102233542 239
49 3300014325 Ga0163163_10102051 Ga0163163_101020513 239
50 3300014326 Ga0157380_10016085 Ga0157380_100160856 239
51 3300017792 Ga0163161_10276361 Ga0163161_102763612 239
52 3300025935 Ga0207709_10120437 Ga0207709_101204372 239
53 3300025940 Ga0207691_10215311 Ga0207691_102153112 239
54 3300025941 Ga0207711_10225018 Ga0207711_102250182 239
55 3300026075 Ga0207708_10300090 Ga0207708_103000902 239
56 3300046455 Ga0495603_0161135 Ga0495603_0161135_274_1065 239
57 3300048912 Ga0496109_0304051 Ga0496109_0304051_87_875 239
58 3300048915 Ga0496112_0180664 Ga0496112_0180664_888_1667 239
59 3300050511 nmdc:mga08y16_555291_c1 nmdc:mga08y16_555291_c1_352_1131 239
60 3300048911 Ga0496108_0530424 Ga0496108_0530424_224_1012 240
61 3300038725 Ga0400484_17835 Ga0400484_17835_6516_7334 241
62 3300042003 Ga0439443_010104 Ga0439443_010104_433_1182 241
63 3300042004 Ga0439445_0052494 Ga0439445_0052494_135_884 241
64 3300042007 Ga0439449_0042470 Ga0439449_0042470_151_900 241
65 3300042156 Ga0439446_0025891 Ga0439446_0025891_867_1616 241
66 3300042437 Ga0439444_0027935 Ga0439444_0027935_75_824 241
67 3300006844 Ga0075428_100463180 Ga0075428_1004631802 242
68 3300031456 Ga0307513_10284528 Ga0307513_102845282 242
69 3300046794 Ga0495589_0149714 Ga0495589_0149714_237_974 242
70 iso_pu_bacteria 2773857763 2774398806 242
71 iso_pu_bacteria 2937843397 2937845608 242
72 3300021441 Ga0213871_10019812 Ga0213871_100198122 243
73 3300039438 Ga0436360_0530628 Ga0436360_0530628_1929_2693 243
74 3300053151 Ga0500604_0086314 Ga0500604_0086314_229_996 243
75 iso_pu_bacteria 2795385472 2795795365 243
76 iso_pu_bacteria 2866612099 2866616210 243
77 iso_pu_bacteria 8003314358 8003314975 243
78 3300005438 Ga0070701_10233181 Ga0070701_102331812 244
79 3300005455 Ga0070663_100168329 Ga0070663_1001683292 244
80 3300005467 Ga0070706_100414727 Ga0070706_1004147272 244
81 3300005518 Ga0070699_100043875 Ga0070699_1000438752 244
82 3300005530 Ga0070679_100294514 Ga0070679_1002945142 244
83 3300005614 Ga0068856_100167274 Ga0068856_1001672743 244
84 3300005985 Ga0081539_10007415 Ga0081539_100074157 244
85 3300013105 Ga0157369_10341140 Ga0157369_103411402 244
86 3300013307 Ga0157372_10695120 Ga0157372_106951202 244
87 3300020069 Ga0197907_10385080 Ga0197907_103850803 244
88 3300020077 Ga0206351_10974719 Ga0206351_109747194 244
89 3300020080 Ga0206350_10575891 Ga0206350_105758914 244
90 3300020610 Ga0154015_1648053 Ga0154015_16480532 244
91 3300022467 Ga0224712_10001521 Ga0224712_100015214 244
92 3300025921 Ga0207652_10254170 Ga0207652_102541703 244
93 3300025922 Ga0207646_10081275 Ga0207646_100812752 244
94 3300026067 Ga0207678_10018585 Ga0207678_100185855 244
95 3300026078 Ga0207702_10222848 Ga0207702_102228482 244
96 3300031730 Ga0307516_10165195 Ga0307516_101651952 244
97 3300031995 Ga0307409_100230997 Ga0307409_1002309972 244
98 3300035692 Ga0373935_0491823 Ga0373935_0491823_38_817 244
99 3300037466 Ga0395898_0524786 Ga0395898_0524786_182_943 244
100 3300041451 Ga0451791_0926953 Ga0451791_0926953_3166_3960 244
101 3300041486 Ga0451807_0376592 Ga0451807_0376592_505_1278 244
102 3300044683 Ga0466965_0009209 Ga0466965_0009209_3237_4004 244
103 3300044683 Ga0466965_0087329 Ga0466965_0087329_534_1301 244
104 3300044694 Ga0466963_0221000 Ga0466963_0221000_264_1016 244
105 3300045976 Ga0466967_0317524 Ga0466967_0317524_22_774 244
106 3300045976 Ga0466967_0318895 Ga0466967_0318895_85_852 244
107 3300046616 Ga0495668_0220038 Ga0495668_0220038_265_1029 244
108 3300049527 Ga0501311_011109 Ga0501311_011109_140_913 244
109 3300049568 Ga0501031_0125742 Ga0501031_0125742_174_965 244
110 3300049569 Ga0501032_0006089 Ga0501032_0006089_5004_5795 244
111 3300049570 Ga0501033_0025989 Ga0501033_0025989_1077_1868 244
112 3300049571 Ga0501034_0046126 Ga0501034_0046126_2964_3755 244
113 3300049572 Ga0501036_0103311 Ga0501036_0103311_843_1634 244
114 3300049573 Ga0501037_0022613 Ga0501037_0022613_2097_2888 244
115 3300049574 Ga0501038_0001456 Ga0501038_0001456_16857_17648 244
116 3300049575 Ga0501039_0033041 Ga0501039_0033041_2203_2994 244
117 3300049579 Ga0501043_0017631 Ga0501043_0017631_4564_5355 244
118 3300049580 Ga0501046_0009615 Ga0501046_0009615_3163_3954 244
119 3300049581 Ga0501047_0017612 Ga0501047_0017612_3091_3882 244
120 3300049582 Ga0501048_0025412 Ga0501048_0025412_3373_4164 244
121 3300049585 Ga0501069_0000186 Ga0501069_0000186_24110_24901 244
122 3300049586 Ga0501070_0009024 Ga0501070_0009024_4085_4876 244
123 3300049589 Ga0501073_0017595 Ga0501073_0017595_2447_3238 244
124 3300049590 Ga0501074_0002793 Ga0501074_0002793_4085_4876 244
125 3300049742 Ga0501080_0001486 Ga0501080_0001486_3626_4417 244
126 3300049744 Ga0501083_0010321 Ga0501083_0010321_2882_3673 244
127 3300049822 Ga0501035_0019378 Ga0501035_0019378_2176_2967 244
128 3300049823 Ga0501044_0045876 Ga0501044_0045876_3344_4135 244
129 3300053104 Ga0500556_0000469 Ga0500556_0000469_14554_15297 244
130 3300053153 Ga0500616_0001912 Ga0500616_0001912_4772_5515 244
131 3300054114 Ga0501084_0017454 Ga0501084_0017454_3854_4645 244
132 iso_pu_bacteria 2582581299 2585229458 244
133 iso_pu_bacteria 2728369276 2729910138 244
134 iso_pu_bacteria 2899359706 2899359736 244
135 3300003215 JGI25153J46596_10000019 JGI25153J46596_10000019135 245
136 3300003322 rootL2_10021095 rootL2_100210956 245
137 3300005293 Ga0065715_10037373 Ga0065715_100373732 245
138 3300005329 Ga0070683_100324179 Ga0070683_1003241792 245
139 3300005336 Ga0070680_100252252 Ga0070680_1002522522 245
140 3300005347 Ga0070668_100215448 Ga0070668_1002154482 245
141 3300005356 Ga0070674_100229108 Ga0070674_1002291082 245
142 3300005471 Ga0070698_100121343 Ga0070698_1001213433 245
143 3300005471 Ga0070698_100152824 Ga0070698_1001528241 245
144 3300005544 Ga0070686_100187545 Ga0070686_1001875451 245
145 3300005564 Ga0070664_100218671 Ga0070664_1002186712 245
146 3300005615 Ga0070702_100284253 Ga0070702_1002842531 245
147 3300005844 Ga0068862_100082549 Ga0068862_1000825493 245
148 3300005985 Ga0081539_10074717 Ga0081539_100747172 245
149 3300006846 Ga0075430_100134205 Ga0075430_1001342053 245
150 3300006847 Ga0075431_100028517 Ga0075431_1000285172 245
151 3300009094 Ga0111539_10010363 Ga0111539_100103639 245
152 3300009545 Ga0105237_10263238 Ga0105237_102632382 245
153 3300021384 Ga0213876_10008246 Ga0213876_100082463 245
154 3300025297 Ga0209758_1000028 Ga0209758_1000028335 245
155 3300025304 Ga0209257_1000688 Ga0209257_100068816 245
156 3300025910 Ga0207684_10230102 Ga0207684_102301022 245
157 3300025924 Ga0207694_10285465 Ga0207694_102854652 245
158 3300025945 Ga0207679_10324152 Ga0207679_103241522 245
159 3300025972 Ga0207668_10008857 Ga0207668_100088574 245
160 3300026067 Ga0207678_10000467 Ga0207678_100004671 245
161 3300026116 Ga0207674_10247353 Ga0207674_102473532 245
162 3300028380 Ga0268265_10217404 Ga0268265_102174042 245
163 3300028794 Ga0307515_10202591 Ga0307515_102025912 245
164 3300030522 Ga0307512_10182825 Ga0307512_101828252 245
165 3300031456 Ga0307513_10146342 Ga0307513_101463422 245
166 3300031507 Ga0307509_10268801 Ga0307509_102688012 245
167 3300031616 Ga0307508_10161641 Ga0307508_101616412 245
168 3300031616 Ga0307508_10344043 Ga0307508_103440432 245
169 3300031731 Ga0307405_10570842 Ga0307405_105708421 245
170 3300033179 Ga0307507_10304869 Ga0307507_103048691 245
171 3300034957 Ga0373938_0003915 Ga0373938_0003915_861_1655 245
172 3300035115 Ga0373941_0017724 Ga0373941_0017724_738_1532 245
173 3300035118 Ga0373954_0074605 Ga0373954_0074605_188_964 245
174 3300035172 Ga0373955_0161046 Ga0373955_0161046_116_892 245
175 3300035207 Ga0373942_0000361 Ga0373942_0000361_11422_12216 245
176 3300035242 Ga0373962_0000437 Ga0373962_0000437_673_1467 245
177 3300035691 Ga0373931_0233636 Ga0373931_0233636_193_987 245
178 3300035692 Ga0373935_0325304 Ga0373935_0325304_279_1055 245
179 3300035695 Ga0373927_0205054 Ga0373927_0205054_350_1126 245
180 3300036401 Ga0373937_0397672 Ga0373937_0397672_116_892 245
181 3300037068 Ga0373925_0271516 Ga0373925_0271516_397_1173 245
182 3300038725 Ga0400484_07329 Ga0400484_07329_85_903 245
183 3300038735 Ga0400485_15476 Ga0400485_15476_11623_12417 245
184 3300038742 Ga0400486_16545 Ga0400486_16545_11701_12495 245
185 3300039093 Ga0400489_00529 Ga0400489_00529_538_1332 245
186 3300039110 Ga0400487_06944 Ga0400487_06944_11851_12645 245
187 3300039110 Ga0400487_22271 Ga0400487_22271_916_1713 245
188 3300039437 Ga0436365_0212978 Ga0436365_0212978_1478_2281 245
189 3300044658 Ga0466972_0001381 Ga0466972_0001381_2907_3716 245
190 3300046462 Ga0495651_0174114 Ga0495651_0174114_695_1471 245
191 3300048905 Ga0496102_0175669 Ga0496102_0175669_1092_1868 245
192 3300048927 Ga0496124_0000741 Ga0496124_0000741_33338_34108 245
193 3300048928 Ga0496125_0086256 Ga0496125_0086256_1365_2135 245
194 3300048929 Ga0496126_0000418 Ga0496126_0000418_18747_19517 245
195 3300049572 Ga0501036_0133139 Ga0501036_0133139_1195_1995 245
196 3300049574 Ga0501038_0099275 Ga0501038_0099275_947_1747 245
197 3300049580 Ga0501046_0073211 Ga0501046_0073211_375_1175 245
198 3300049583 Ga0501067_0014017 Ga0501067_0014017_2916_3716 245
199 3300049583 Ga0501067_0111553 Ga0501067_0111553_254_1054 245
200 3300049584 Ga0501068_0060285 Ga0501068_0060285_878_1678 245
201 3300049586 Ga0501070_0394805 Ga0501070_0394805_292_1092 245
202 3300049589 Ga0501073_0032382 Ga0501073_0032382_305_1105 245
203 3300049742 Ga0501080_0006549 Ga0501080_0006549_3962_4762 245
204 3300049742 Ga0501080_0079992 Ga0501080_0079992_1301_2101 245
205 3300049744 Ga0501083_0005967 Ga0501083_0005967_6404_7204 245
206 3300050507 nmdc:mga05p37_669460_c1 nmdc:mga05p37_669460_c1_164_925 245
207 3300050509 nmdc:mga0qj67_17827_c2 nmdc:mga0qj67_17827_c2_1960_2727 245
208 3300050509 nmdc:mga0qj67_27984_c1 nmdc:mga0qj67_27984_c1_2471_3232 245
209 3300050510 nmdc:mga06r32_1502_c1 nmdc:mga06r32_1502_c1_12086_12847 245
210 3300050511 nmdc:mga08y16_181087_c1 nmdc:mga08y16_181087_c1_1129_1890 245
211 3300053086 Ga0500578_0015335 Ga0500578_0015335_3456_4247 245
212 3300053090 Ga0500646_0012505 Ga0500646_0012505_1216_2016 245
213 3300053119 Ga0500595_007283 Ga0500595_007283_55_846 245
214 3300053130 Ga0500642_0111052 Ga0500642_0111052_53_853 245
215 3300053151 Ga0500604_0001711 Ga0500604_0001711_2166_2966 245
216 3300053731 Ga0500609_001646 Ga0500609_001646_1929_2729 245
217 3300053731 Ga0500609_017868 Ga0500609_017868_153_932 245
218 3300053736 Ga0500599_006284 Ga0500599_006284_376_1176 245
219 3300054114 Ga0501084_0491750 Ga0501084_0491750_60_860 245
220 3300060353 Ga0501082_0013701 Ga0501082_0013701_4393_5193 245
221 iso_pu_bacteria 2643221629 2644169580 245
222 iso_pu_bacteria 2734482000 2734970072 245
223 3300003203 JGI25406J46586_10011982 JGI25406J46586_100119822 246
224 3300005340 Ga0070689_100496854 Ga0070689_1004968541 246
225 3300005366 Ga0070659_100086128 Ga0070659_1000861282 246
226 3300005367 Ga0070667_100378556 Ga0070667_1003785562 246
227 3300005367 Ga0070667_100594843 Ga0070667_1005948432 246
228 3300005441 Ga0070700_100238249 Ga0070700_1002382492 246
229 3300005455 Ga0070663_100527956 Ga0070663_1005279561 246
230 3300005467 Ga0070706_100839208 Ga0070706_1008392081 246
231 3300005471 Ga0070698_100011204 Ga0070698_1000112046 246
232 3300005539 Ga0068853_100059884 Ga0068853_1000598841 246
233 3300005548 Ga0070665_100572778 Ga0070665_1005727782 246
234 3300005563 Ga0068855_100579021 Ga0068855_1005790212 246
235 3300005564 Ga0070664_100163306 Ga0070664_1001633061 246
236 3300005617 Ga0068859_100231883 Ga0068859_1002318833 246
237 3300005617 Ga0068859_100267153 Ga0068859_1002671532 246
238 3300005843 Ga0068860_100387526 Ga0068860_1003875262 246
239 3300005843 Ga0068860_100489645 Ga0068860_1004896452 246
240 3300005844 Ga0068862_100113799 Ga0068862_1001137993 246
241 3300005983 Ga0081540_1015586 Ga0081540_10155863 246
242 3300005985 Ga0081539_10000625 Ga0081539_1000062522 246
243 3300006186 Ga0075369_10019363 Ga0075369_100193632 246
244 3300006881 Ga0068865_100410742 Ga0068865_1004107422 246
245 3300006931 Ga0097620_100231886 Ga0097620_1002318863 246
246 3300006931 Ga0097620_100267147 Ga0097620_1002671472 246
247 3300009094 Ga0111539_10069633 Ga0111539_100696334 246
248 3300009094 Ga0111539_10305644 Ga0111539_103056442 246
249 3300009148 Ga0105243_10174335 Ga0105243_101743352 246
250 3300009545 Ga0105237_10111977 Ga0105237_101119773 246
251 3300009551 Ga0105238_10872705 Ga0105238_108727051 246
252 3300009553 Ga0105249_10437986 Ga0105249_104379862 246
253 3300010375 Ga0105239_10198574 Ga0105239_101985742 246
254 3300011119 Ga0105246_10384664 Ga0105246_103846642 246
255 3300013102 Ga0157371_10324675 Ga0157371_103246752 246
256 3300013297 Ga0157378_10091360 Ga0157378_100913604 246
257 3300013307 Ga0157372_10498852 Ga0157372_104988522 246
258 3300013308 Ga0157375_10429746 Ga0157375_104297462 246
259 3300014325 Ga0163163_10085665 Ga0163163_100856653 246
260 3300017792 Ga0163161_10179140 Ga0163161_101791403 246
261 3300021388 Ga0213875_10000999 Ga0213875_1000099916 246
262 3300025900 Ga0207710_10103502 Ga0207710_101035022 246
263 3300025910 Ga0207684_10261286 Ga0207684_102612863 246
264 3300025925 Ga0207650_10473936 Ga0207650_104739361 246
265 3300025972 Ga0207668_10005051 Ga0207668_100050517 246
266 3300026075 Ga0207708_10205872 Ga0207708_102058722 246
267 3300026121 Ga0207683_10218524 Ga0207683_102185242 246
268 3300027665 Ga0209983_1055110 Ga0209983_10551101 246
269 3300028379 Ga0268266_10220387 Ga0268266_102203872 246
270 3300028380 Ga0268265_10040511 Ga0268265_100405114 246
271 3300028380 Ga0268265_10283063 Ga0268265_102830632 246
272 3300028794 Ga0307515_10068670 Ga0307515_100686702 246
273 3300030521 Ga0307511_10000018 Ga0307511_1000001882 246
274 3300031456 Ga0307513_10006535 Ga0307513_100065358 246
275 3300031507 Ga0307509_10019257 Ga0307509_100192575 246
276 3300031507 Ga0307509_10517374 Ga0307509_105173741 246
277 3300031616 Ga0307508_10032834 Ga0307508_100328342 246
278 3300031727 Ga0316576_10285238 Ga0316576_102852382 246
279 3300031730 Ga0307516_10170528 Ga0307516_101705282 246
280 3300031733 Ga0316577_10001658 Ga0316577_1000165811 246
281 3300031901 Ga0307406_10060053 Ga0307406_100600532 246
282 3300031911 Ga0307412_10728069 Ga0307412_107280691 246
283 3300031995 Ga0307409_100041508 Ga0307409_1000415082 246
284 3300031995 Ga0307409_100154556 Ga0307409_1001545561 246
285 3300032002 Ga0307416_100176676 Ga0307416_1001766762 246
286 3300032126 Ga0307415_100022456 Ga0307415_1000224563 246
287 3300032126 Ga0307415_100276505 Ga0307415_1002765052 246
288 3300033179 Ga0307507_10034587 Ga0307507_100345872 246
289 3300033180 Ga0307510_10073095 Ga0307510_100730954 246
290 3300034818 Ga0373950_0009114 Ga0373950_0009114_235_1032 246
291 3300035112 Ga0373932_0067724 Ga0373932_0067724_87_884 246
292 3300035242 Ga0373962_0004433 Ga0373962_0004433_2071_2868 246
293 3300036712 Ga0316584_0111828 Ga0316584_0111828_671_1504 246
294 3300037312 Ga0395899_0009166 Ga0395899_0009166_2797_3585 246
295 3300037418 Ga0395900_0002343 Ga0395900_0002343_3261_4049 246
296 3300037466 Ga0395898_0001662 Ga0395898_0001662_3756_4544 246
297 3300037466 Ga0395898_0005170 Ga0395898_0005170_1961_2740 246
298 3300037471 Ga0395905_0003552 Ga0395905_0003552_3960_4748 246
299 3300037853 Ga0436364_0440359 Ga0436364_0440359_1885_2679 246
300 3300038443 Ga0395901_0001195 Ga0395901_0001195_22777_23556 246
301 3300038443 Ga0395901_0034366 Ga0395901_0034366_3897_4685 246
302 3300038726 Ga0400490_19280 Ga0400490_19280_1351_2175 246
303 3300038726 Ga0400490_32168 Ga0400490_32168_153_977 246
304 3300038726 Ga0400490_50315 Ga0400490_50315_1743_2558 246
305 3300038741 Ga0400488_13961 Ga0400488_13961_13108_13947 246
306 3300038741 Ga0400488_55735 Ga0400488_55735_780_1598 246
307 3300039062 Ga0400483_056450 Ga0400483_056450_1677_2495 246
308 3300039062 Ga0400483_157671 Ga0400483_157671_8371_9189 246
309 3300039093 Ga0400489_03098 Ga0400489_03098_8282_9121 246
310 3300039437 Ga0436365_1884481 Ga0436365_1884481_27_797 246
311 3300042007 Ga0439449_0003455 Ga0439449_0003455_4425_5213 246
312 3300044656 Ga0466969_0004693 Ga0466969_0004693_6326_7156 246
313 3300044684 Ga0466966_0002186 Ga0466966_0002186_10467_11297 246
314 3300044693 Ga0466961_0239846 Ga0466961_0239846_120_950 246
315 3300045049 Ga0466959_0031539 Ga0466959_0031539_2963_3793 246
316 3300048911 Ga0496108_0000136 Ga0496108_0000136_43974_44765 246
317 3300049570 Ga0501033_0411059 Ga0501033_0411059_137_919 246
318 3300049571 Ga0501034_0775769 Ga0501034_0775769_58_840 246
319 3300049581 Ga0501047_0227897 Ga0501047_0227897_560_1342 246
320 3300049823 Ga0501044_0262827 Ga0501044_0262827_869_1651 246
321 3300053153 Ga0500616_0046551 Ga0500616_0046551_847_1629 246
322 3300061719 Ga0466962_0054728 Ga0466962_0054728_85_915 246
323 iso_pu_bacteria 2582581316 2585336376 246
324 iso_pu_bacteria 2687453743 2689996557 246
325 iso_pu_bacteria 2891373044 2891375423 246
326 iso_pu_bacteria 2898795034 2898795788 246
327 iso_pu_bacteria 2909042592 2909044963 246
328 3300005338 Ga0068868_100586973 Ga0068868_1005869731 247
329 3300005340 Ga0070689_100204427 Ga0070689_1002044272 247
330 3300005437 Ga0070710_10252708 Ga0070710_102527081 247
331 3300005455 Ga0070663_100281654 Ga0070663_1002816541 247
332 3300005937 Ga0081455_10104029 Ga0081455_101040292 247
333 3300005985 Ga0081539_10000126 Ga0081539_100001266 247
334 3300006846 Ga0075430_100226671 Ga0075430_1002266712 247
335 3300009093 Ga0105240_10108889 Ga0105240_101088892 247
336 3300009553 Ga0105249_10105939 Ga0105249_101059393 247
337 3300013296 Ga0157374_10032892 Ga0157374_100328924 247
338 3300021377 Ga0213874_10024230 Ga0213874_100242302 247
339 3300025294 Ga0209025_1096319 Ga0209025_10963191 247
340 3300025899 Ga0207642_10228734 Ga0207642_102287342 247
341 3300028786 Ga0307517_10138535 Ga0307517_101385353 247
342 3300028800 Ga0265338_10182629 Ga0265338_101826292 247
343 3300031241 Ga0265325_10035191 Ga0265325_100351913 247
344 3300031247 Ga0265340_10000264 Ga0265340_100002645 247
345 3300031249 Ga0265339_10014693 Ga0265339_100146937 247
346 3300031344 Ga0265316_10009686 Ga0265316_100096866 247
347 3300031548 Ga0307408_100616705 Ga0307408_1006167052 247
348 3300031595 Ga0265313_10006384 Ga0265313_100063847 247
349 3300031712 Ga0265342_10007507 Ga0265342_100075077 247
350 3300031730 Ga0307516_10118217 Ga0307516_101182173 247
351 3300031903 Ga0307407_10030825 Ga0307407_100308252 247
352 3300031995 Ga0307409_100333330 Ga0307409_1003333301 247
353 3300032005 Ga0307411_10204669 Ga0307411_102046692 247
354 3300037068 Ga0373925_0072324 Ga0373925_0072324_155_976 247
355 3300038741 Ga0400488_44356 Ga0400488_44356_759_1562 247
356 3300039447 Ga0436361_0218515 Ga0436361_0218515_1057_1821 247
357 3300039447 Ga0436361_0410902 Ga0436361_0410902_185_1012 247
358 3300042001 Ga0439441_044549 Ga0439441_044549_80_886 247
359 3300042461 Ga0439460_0031821 Ga0439460_0031821_92_898 247
360 3300044765 Ga0466970_0123530 Ga0466970_0123530_268_1077 247
361 3300045836 Ga0466958_0155968 Ga0466958_0155968_237_1037 247
362 3300046462 Ga0495651_0023410 Ga0495651_0023410_860_1681 247
363 3300046516 Ga0495628_0268589 Ga0495628_0268589_246_1067 247
364 3300048911 Ga0496108_0074415 Ga0496108_0074415_1132_1938 247
365 3300048912 Ga0496109_0042582 Ga0496109_0042582_1554_2360 247
366 3300049589 Ga0501073_0122210 Ga0501073_0122210_232_1041 247
367 3300049742 Ga0501080_0031148 Ga0501080_0031148_2029_2838 247
368 3300050508 nmdc:mga09592_120498_c1 nmdc:mga09592_120498_c1_256_1050 247
369 3300053096 Ga0500641_0007723 Ga0500641_0007723_218_1033 247
370 3300053153 Ga0500616_0001651 Ga0500616_0001651_7566_8381 247
371 3300053177 Ga0500636_0046727 Ga0500636_0046727_816_1622 247
372 3300060353 Ga0501082_0103648 Ga0501082_0103648_1450_2259 247
373 iso_pu_bacteria 2643221616 2644094651 247
374 iso_pu_bacteria 2939669807 2939673097 247
375 iso_pu_bacteria 2952252522 2952253759 247
376 iso_pu_bacteria 8002745576 8002748099 247
377 3300003322 rootL2_10093034 rootL2_100930343 248
378 3300005327 Ga0070658_10095230 Ga0070658_100952302 248
379 3300005328 Ga0070676_10048599 Ga0070676_100485991 248
380 3300005329 Ga0070683_100248793 Ga0070683_1002487931 248
381 3300005331 Ga0070670_100123458 Ga0070670_1001234582 248
382 3300005334 Ga0068869_100031209 Ga0068869_1000312092 248
383 3300005335 Ga0070666_10085138 Ga0070666_100851382 248
384 3300005336 Ga0070680_100692360 Ga0070680_1006923601 248
385 3300005337 Ga0070682_100040905 Ga0070682_1000409053 248
386 3300005338 Ga0068868_100048881 Ga0068868_1000488812 248
387 3300005343 Ga0070687_100030182 Ga0070687_1000301822 248
388 3300005344 Ga0070661_100151960 Ga0070661_1001519602 248
389 3300005347 Ga0070668_100167162 Ga0070668_1001671622 248
390 3300005353 Ga0070669_100089154 Ga0070669_1000891542 248
391 3300005354 Ga0070675_100247393 Ga0070675_1002473932 248
392 3300005356 Ga0070674_100146594 Ga0070674_1001465942 248
393 3300005365 Ga0070688_100077791 Ga0070688_1000777911 248
394 3300005366 Ga0070659_100039485 Ga0070659_1000394853 248
395 3300005436 Ga0070713_100070980 Ga0070713_1000709802 248
396 3300005441 Ga0070700_100021826 Ga0070700_1000218262 248
397 3300005457 Ga0070662_100214147 Ga0070662_1002141472 248
398 3300005466 Ga0070685_10119841 Ga0070685_101198412 248
399 3300005544 Ga0070686_100276959 Ga0070686_1002769591 248
400 3300005614 Ga0068856_100405504 Ga0068856_1004055042 248
401 3300005615 Ga0070702_100035313 Ga0070702_1000353132 248
402 3300005617 Ga0068859_100050436 Ga0068859_1000504362 248
403 3300005617 Ga0068859_100381962 Ga0068859_1003819622 248
404 3300005718 Ga0068866_10144317 Ga0068866_101443172 248
405 3300005834 Ga0068851_10148789 Ga0068851_101487892 248
406 3300005844 Ga0068862_100057284 Ga0068862_1000572842 248
407 3300005983 Ga0081540_1119509 Ga0081540_11195092 248
408 3300005985 Ga0081539_10000637 Ga0081539_1000063712 248
409 3300005985 Ga0081539_10003444 Ga0081539_100034444 248
410 3300005985 Ga0081539_10005772 Ga0081539_1000577210 248
411 3300005985 Ga0081539_10011727 Ga0081539_100117275 248
412 3300005985 Ga0081539_10017034 Ga0081539_100170345 248
413 3300006173 Ga0070716_100004860 Ga0070716_1000048606 248
414 3300006195 Ga0075366_10231959 Ga0075366_102319592 248
415 3300006358 Ga0068871_100113946 Ga0068871_1001139462 248
416 3300006881 Ga0068865_100019996 Ga0068865_1000199962 248
417 3300006931 Ga0097620_100050436 Ga0097620_1000504362 248
418 3300006946 Ga0079104_1003546 Ga0079104_10035464 248
419 3300006948 Ga0099826_10009641 Ga0099826_100096414 248
420 3300009147 Ga0114129_10647522 Ga0114129_106475222 248
421 3300009174 Ga0105241_10050487 Ga0105241_100504872 248
422 3300009176 Ga0105242_10224843 Ga0105242_102248432 248
423 3300009553 Ga0105249_10124621 Ga0105249_101246212 248
424 3300009979 Ga0105032_104024 Ga0105032_1040242 248
425 3300010375 Ga0105239_10591175 Ga0105239_105911752 248
426 3300011119 Ga0105246_10125784 Ga0105246_101257842 248
427 3300013105 Ga0157369_10169849 Ga0157369_101698491 248
428 3300013105 Ga0157369_10476009 Ga0157369_104760092 248
429 3300013296 Ga0157374_10159632 Ga0157374_101596323 248
430 3300013297 Ga0157378_10141186 Ga0157378_101411861 248
431 3300013306 Ga0163162_10255599 Ga0163162_102555992 248
432 3300013307 Ga0157372_10369368 Ga0157372_103693682 248
433 3300013308 Ga0157375_10278171 Ga0157375_102781712 248
434 3300014745 Ga0157377_10090477 Ga0157377_100904771 248
435 3300014968 Ga0157379_10098680 Ga0157379_100986803 248
436 3300014969 Ga0157376_10072154 Ga0157376_100721543 248
437 3300014969 Ga0157376_10163440 Ga0157376_101634402 248
438 3300022467 Ga0224712_10068507 Ga0224712_100685072 248
439 3300022739 Ga0228711_1010705 Ga0228711_10107054 248
440 3300022740 Ga0228710_1004002 Ga0228710_100400210 248
441 3300025321 Ga0207656_10123726 Ga0207656_101237262 248
442 3300025899 Ga0207642_10031982 Ga0207642_100319822 248
443 3300025901 Ga0207688_10053057 Ga0207688_100530572 248
444 3300025901 Ga0207688_10065102 Ga0207688_100651021 248
445 3300025904 Ga0207647_10120478 Ga0207647_101204782 248
446 3300025907 Ga0207645_10167248 Ga0207645_101672482 248
447 3300025908 Ga0207643_10030850 Ga0207643_100308502 248
448 3300025918 Ga0207662_10010208 Ga0207662_100102084 248
449 3300025918 Ga0207662_10125744 Ga0207662_101257442 248
450 3300025919 Ga0207657_10190637 Ga0207657_101906372 248
451 3300025923 Ga0207681_10124747 Ga0207681_101247472 248
452 3300025927 Ga0207687_10051809 Ga0207687_100518093 248
453 3300025933 Ga0207706_10162215 Ga0207706_101622152 248
454 3300025936 Ga0207670_10091523 Ga0207670_100915232 248
455 3300025941 Ga0207711_10481852 Ga0207711_104818522 248
456 3300025942 Ga0207689_10080230 Ga0207689_100802302 248
457 3300025961 Ga0207712_10007694 Ga0207712_100076945 248
458 3300025972 Ga0207668_10184120 Ga0207668_101841203 248
459 3300025981 Ga0207640_10138137 Ga0207640_101381372 248
460 3300025986 Ga0207658_10077762 Ga0207658_100777622 248
461 3300026075 Ga0207708_10012373 Ga0207708_100123733 248
462 3300026088 Ga0207641_10278060 Ga0207641_102780602 248
463 3300026095 Ga0207676_10077355 Ga0207676_100773553 248
464 3300026116 Ga0207674_10054248 Ga0207674_100542484 248
465 3300026142 Ga0207698_10146122 Ga0207698_101461222 248
466 3300027111 Ga0209281_1002478 Ga0209281_10024784 248
467 3300027666 Ga0209282_1006327 Ga0209282_10063274 248
468 3300028379 Ga0268266_10072249 Ga0268266_100722492 248
469 3300028381 Ga0268264_10517697 Ga0268264_105176972 248
470 3300028786 Ga0307517_10091100 Ga0307517_100911002 248
471 3300028794 Ga0307515_10004370 Ga0307515_1000437021 248
472 3300028794 Ga0307515_10072941 Ga0307515_100729414 248
473 3300028794 Ga0307515_10177356 Ga0307515_101773561 248
474 3300030522 Ga0307512_10025405 Ga0307512_100254055 248
475 3300030522 Ga0307512_10048766 Ga0307512_100487662 248
476 3300030522 Ga0307512_10080563 Ga0307512_100805631 248
477 3300031247 Ga0265340_10001252 Ga0265340_100012523 248
478 3300031456 Ga0307513_10034606 Ga0307513_100346064 248
479 3300031456 Ga0307513_10078136 Ga0307513_100781362 248
480 3300031730 Ga0307516_10001110 Ga0307516_1000111031 248
481 3300031730 Ga0307516_10062844 Ga0307516_100628442 248
482 3300031730 Ga0307516_10092896 Ga0307516_100928962 248
483 3300031852 Ga0307410_10027433 Ga0307410_100274333 248
484 3300031852 Ga0307410_10032173 Ga0307410_100321735 248
485 3300031901 Ga0307406_10444874 Ga0307406_104448742 248
486 3300031967 Ga0315914_1006088 Ga0315914_10060884 248
487 3300031995 Ga0307409_100054873 Ga0307409_1000548732 248
488 3300031995 Ga0307409_100059667 Ga0307409_1000596672 248
489 3300031995 Ga0307409_100125537 Ga0307409_1001255372 248
490 3300031995 Ga0307409_100653347 Ga0307409_1006533472 248
491 3300032002 Ga0307416_100065503 Ga0307416_1000655033 248
492 3300032002 Ga0307416_100070045 Ga0307416_1000700452 248
493 3300032005 Ga0307411_10134806 Ga0307411_101348062 248
494 3300032126 Ga0307415_100025086 Ga0307415_1000250863 248
495 3300033430 Ga0315913_1009766 Ga0315913_10097667 248
496 3300033464 Ga0315915_1013567 Ga0315915_10135674 248
497 3300035091 Ga0373951_0000019 Ga0373951_0000019_19386_20168 248
498 3300035691 Ga0373931_0223046 Ga0373931_0223046_198_1007 248
499 3300037471 Ga0395905_0328424 Ga0395905_0328424_181_942 248
500 3300038443 Ga0395901_0206282 Ga0395901_0206282_983_1834 248
501 3300041404 Ga0439436_0031243 Ga0439436_0031243_195_995 248
502 3300041494 Ga0451837_0235358 Ga0451837_0235358_308_1114 248
503 3300042016 Ga0439463_040161 Ga0439463_040161_88_903 248
504 3300046471 Ga0495650_0056498 Ga0495650_0056498_506_1342 248
505 3300048907 Ga0496104_0429500 Ga0496104_0429500_240_1040 248
506 3300048913 Ga0496110_0050865 Ga0496110_0050865_1185_2021 248
507 3300048913 Ga0496110_0185520 Ga0496110_0185520_905_1714 248
508 3300048915 Ga0496112_0745756 Ga0496112_0745756_37_873 248
509 3300048916 Ga0496113_0340715 Ga0496113_0340715_253_1086 248
510 3300049128 Ga0501308_000288 Ga0501308_000288_2053_2847 248
511 3300049524 Ga0501301_004766 Ga0501301_004766_57_851 248
512 3300050507 nmdc:mga05p37_611325_c1 nmdc:mga05p37_611325_c1_140_958 248
513 3300050507 nmdc:mga05p37_70192_c1 nmdc:mga05p37_70192_c1_1348_2148 248
514 3300050511 nmdc:mga08y16_278294_c1 nmdc:mga08y16_278294_c1_110_907 248
515 3300053086 Ga0500578_0000683 Ga0500578_0000683_35365_36153 248
516 3300053088 Ga0500644_0007215 Ga0500644_0007215_574_1380 248
517 3300053088 Ga0500644_0115506 Ga0500644_0115506_87_869 248
518 3300053093 Ga0500651_0028674 Ga0500651_0028674_1067_1873 248
519 3300053096 Ga0500641_0013554 Ga0500641_0013554_1594_2400 248
520 3300053108 Ga0500562_023520 Ga0500562_023520_744_1550 248
521 3300053131 Ga0500652_014571 Ga0500652_014571_315_1121 248
522 3300053153 Ga0500616_0001922 Ga0500616_0001922_8653_9489 248
523 3300059642 Ga0587069_019247 Ga0587069_019247_14_829 248
524 iso_pu_bacteria 2512047086 2512529795 248
525 iso_pu_bacteria 2512875026 2512969962 248
526 iso_pu_bacteria 2513237089 2513602566 248
527 iso_pu_bacteria 2513237160 2514005677 248
528 iso_pu_bacteria 2643221689 2644498238 248
529 iso_pu_bacteria 2802428858 2802716387 248
530 iso_pu_bacteria 2802428859 2802722575 248
531 iso_pu_bacteria 2802428860 2802729283 248
532 iso_pu_bacteria 2802428861 2802735675 248
533 iso_pu_bacteria 2802428862 2802741750 248
534 iso_pu_bacteria 2816332139 2816505474 248
535 iso_pu_bacteria 2915980308 2915984645 248
536 iso_pu_bacteria 2937029754 2937030830 248
537 iso_pu_bacteria 2937036028 2937041795 248
538 iso_pu_bacteria 2937078374 2937080951 248
539 iso_pu_bacteria 2937084907 2937085100 248
540 iso_pu_bacteria 2960680706 2960682849 248
541 iso_pu_bacteria 2960693952 2960696084 248
542 iso_pu_bacteria 2967686174 2967686841 248
543 iso_pu_bacteria 2967728569 2967731575 248
544 iso_pu_bacteria 2970122695 2970126844 248
545 iso_pu_bacteria 2970143518 2970148234 248
546 iso_pu_bacteria 2977530762 2977532948 248
547 iso_pu_bacteria 2977544691 2977548402 248
548 iso_pu_bacteria 8003999396 8004003636 248
549 3300003187 JGI25151J46595_10019898 JGI25151J46595_100198982 249
550 3300005471 Ga0070698_100003844 Ga0070698_1000038446 249
551 3300005983 Ga0081540_1109767 Ga0081540_11097672 249
552 3300025294 Ga0209025_1000148 Ga0209025_1000148121 249
553 3300031824 Ga0307413_10092983 Ga0307413_100929832 249
554 3300031852 Ga0307410_10013090 Ga0307410_100130905 249
555 3300031995 Ga0307409_100140161 Ga0307409_1001401612 249
556 3300032002 Ga0307416_100017610 Ga0307416_1000176105 249
557 3300032126 Ga0307415_100002826 Ga0307415_1000028263 249
558 3300039447 Ga0436361_0302978 Ga0436361_0302978_276_1103 249
559 3300045051 Ga0451576_0011765 Ga0451576_0011765_3501_4307 249
560 3300048920 Ga0496117_0000912 Ga0496117_0000912_6699_7493 249
561 3300048925 Ga0496122_0000364 Ga0496122_0000364_83275_84069 249
562 3300048926 Ga0496123_0000094 Ga0496123_0000094_83275_84069 249
563 3300048928 Ga0496125_0002252 Ga0496125_0002252_6137_6931 249
564 iso_pu_bacteria 2891373044 2891375779 249
565 3300005333 Ga0070677_10076918 Ga0070677_100769181 250
566 3300005347 Ga0070668_100274728 Ga0070668_1002747282 250
567 3300005844 Ga0068862_100458472 Ga0068862_1004584721 250
568 3300014326 Ga0157380_10133460 Ga0157380_101334602 250
569 3300025918 Ga0207662_10066514 Ga0207662_100665141 250
570 3300026089 Ga0207648_10361910 Ga0207648_103619101 250
571 3300026118 Ga0207675_100138020 Ga0207675_1001380203 250
572 3300042007 Ga0439449_0000640 Ga0439449_0000640_3018_3845 250
573 3300048917 Ga0496114_0085841 Ga0496114_0085841_1379_2242 250
574 3300002739 JGI25158J39367_1004679 JGI25158J39367_10046793 251
575 3300003187 JGI25151J46595_10001549 JGI25151J46595_1000154910 251
576 3300003354 JGI25160J50197_1000147 JGI25160J50197_100014713 251
577 3300003374 JGI25161J50226_1000675 JGI25161J50226_10006752 251
578 3300003792 Ga0055540_1011431 Ga0055540_10114313 251
579 3300003794 Ga0055531_10020939 Ga0055531_100209392 251
580 3300004625 Ga0055543_1000129 Ga0055543_100012954 251
581 3300005262 Ga0065165_1000477 Ga0065165_100047713 251
582 3300006881 Ga0068865_100535412 Ga0068865_1005354121 251
583 3300009551 Ga0105238_10372651 Ga0105238_103726511 251
584 3300013296 Ga0157374_10197379 Ga0157374_101973791 251
585 3300025208 Ga0209436_100321 Ga0209436_10032111 251
586 3300025273 Ga0209673_1048255 Ga0209673_10482551 251
587 3300025284 Ga0209130_1000234 Ga0209130_100023451 251
588 3300025294 Ga0209025_1001085 Ga0209025_100108527 251
589 3300025302 Ga0207426_1000410 Ga0207426_100041051 251
590 3300025303 Ga0209051_1000151 Ga0209051_100015191 251
591 3300025304 Ga0209257_1009307 Ga0209257_10093074 251
592 3300025910 Ga0207684_10391971 Ga0207684_103919712 251
593 3300026075 Ga0207708_10099757 Ga0207708_100997572 251
594 3300026121 Ga0207683_10552097 Ga0207683_105520972 251
595 3300028794 Ga0307515_10008974 Ga0307515_100089745 251
596 3300028794 Ga0307515_10065639 Ga0307515_100656393 251
597 3300031456 Ga0307513_10003112 Ga0307513_1000311211 251
598 3300031456 Ga0307513_10267271 Ga0307513_102672711 251
599 3300046460 Ga0495638_0015949 Ga0495638_0015949_974_1729 251
600 3300046506 Ga0495583_0000321 Ga0495583_0000321_42549_43376 251
601 3300046512 Ga0495610_0007440 Ga0495610_0007440_3743_4570 251
602 3300048913 Ga0496110_0241084 Ga0496110_0241084_696_1577 251
603 3300049570 Ga0501033_0236042 Ga0501033_0236042_186_992 251
604 3300053177 Ga0500636_0020970 Ga0500636_0020970_1549_2409 251
605 iso_pu_bacteria 2582581316 2585331924 251
606 iso_pu_bacteria 2937822353 2937825518 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

197

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.886 9 235
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8824 9 235
6z67-assembly3.cif.gz_E ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.8817 7 234
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.8806 9 249
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.8786 7 231
ID Description Score Start End Superfamily
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.945 7 248 3.40.50.300
af_Q6BEX0_1_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9408 3 248 3.40.50.300
af_P37388_2_240_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9374 7 248 3.40.50.300
af_P77257_8_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9337 6 246 3.40.50.300
af_P04983_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9256 7 248 3.40.50.300
ID Description Score Start End GO Terms
AF-I7BYM0-F1-model_v4 ABC transporter related protein 0.9762 147 248 GO:0005524
GO:0016887
AF-A0A2T0UCU5-F1-model_v4 Monosaccharide ABC transporter ATP-binding protein (CUT2 family) 0.9713 9 249 GO:0005524
GO:0016887
AF-A0A099WJU8-F1-model_v4 Heme ABC transporter ATP-binding protein 0.9643 6 248 GO:0005524
GO:0016887
AF-A0A3A9F3A8-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9641 4 248 GO:0005524
GO:0016887
AF-A0A2N3FF34-F1-model_v4 Sugar ABC transporter ATP-binding protein 0.9604 1 248 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
91.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map