F468565
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 606 | 381 | 559 | 264 |
Family's Representative Sequence
| Representative Sequence | 3300005544|Ga0070686_100276959|Ga0070686_1002769591 |
| Length | 299 |
| Sequence | MTAPRSTTETGSHGAAADRGTPVVEAKGLVKRYGPVTAIAGSDLELYPGEILAVIGDNGAGKSSLIKALSGALIPDEGTIRLEGKEVRFANPMDARRAGIETVYQTLAVAPGLDIADNLFLGREQRKPGILGSVFRMLDRKHMRDEAKRHMSELGIATLQNIGQAVESLSGGQRQGVAVARSAAFGSKVVILDEPTAALGVKEGNRVLQLIRDVRDRGLPVILISHNMPHVFEIADRIHIHRLGKRVAVVDPKEHSMHDVVGIMTGAVVHDIEHKDASEKLPQIDPKESEAPQQERPAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 2 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 3 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 4 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 5 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 6 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 7 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 8 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 9 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 10 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 11 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 12 | 2734482000 | Kineosporia rhizophila JCM 9960 | Isolate | Unclassified |
| 13 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 14 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 15 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 16 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 17 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 18 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 19 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 20 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 21 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 22 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 23 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 24 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 25 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 26 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 27 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 28 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 29 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 30 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 31 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 32 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 33 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 34 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 35 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 36 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 37 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 38 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 39 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 40 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 41 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 42 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 43 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 44 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 45 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 47 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 48 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 49 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 50 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 51 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 52 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 53 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 54 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 55 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 61 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 65 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 66 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 86 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 102 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 103 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 105 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 106 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 107 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 108 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 111 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 115 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 116 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 149 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 150 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 152 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 153 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 205 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 206 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 207 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 208 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 219 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 221 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 229 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 230 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 235 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 236 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 237 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 238 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 240 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 249 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 250 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 260 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 261 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 262 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 263 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 264 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 265 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 266 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 267 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 268 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 269 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 270 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 271 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 272 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 273 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 274 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 275 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 276 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 277 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 278 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 279 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 280 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 281 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 282 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 283 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 284 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 285 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 286 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 287 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 288 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 289 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 290 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 291 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 292 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 293 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 311 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 312 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 313 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 321 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 327 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 360 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 362 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 366 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 367 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 368 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 369 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 370 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 371 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 373 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 375 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 379 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 380 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 381 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.76 |
| Metatranscriptomes | 1.49 |
| Isolates | 7.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.09 |
| Nodule | 5.78 |
| Rhizoplane | 2.97 |
| Rhizosphere | 69.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25158J39367_1004679 | 3300002739 | Bacteria | 2045 |
| 2 | JGI25151J46595_10001549 | 3300003187 | Bacteria | 15340 |
| 3 | JGI25151J46595_10019898 | 3300003187 | Bacteria | 2839 |
| 4 | JGI25406J46586_10011982 | 3300003203 | Bacteria | 3779 |
| 5 | JGI25153J46596_10000019 | 3300003215 | Bacteria | 260291 |
| 6 | rootL2_10021095 | 3300003322 | Bacteria | 3809 |
| 7 | rootL2_10034493 | 3300003322 | Bacteria | 4930 |
| 8 | rootL2_10093034 | 3300003322 | Bacteria | 3994 |
| 9 | JGI25160J50197_1000147 | 3300003354 | Bacteria | 62036 |
| 10 | JGI25161J50226_1000675 | 3300003374 | Bacteria | 13561 |
| 11 | Ga0055540_1011431 | 3300003792 | Bacteria | 2862 |
| 12 | Ga0055531_10020939 | 3300003794 | Bacteria | 2561 |
| 13 | Ga0055543_1000129 | 3300004625 | Bacteria | 62841 |
| 14 | Ga0065165_1000477 | 3300005262 | Bacteria | 62229 |
| 15 | Ga0065715_10037373 | 3300005293 | Bacteria | 1262 |
| 16 | Ga0070658_10095230 | 3300005327 | Bacteria | 2457 |
| 17 | Ga0070676_10048599 | 3300005328 | Bacteria | 2480 |
| 18 | Ga0070683_100248793 | 3300005329 | Bacteria | 1691 |
| 19 | Ga0070683_100324179 | 3300005329 | Bacteria | 1466 |
| 20 | Ga0070670_100123458 | 3300005331 | Bacteria | 2234 |
| 21 | Ga0070677_10076918 | 3300005333 | Bacteria | 1418 |
| 22 | Ga0068869_100031209 | 3300005334 | Bacteria | 3747 |
| 23 | Ga0070666_10085138 | 3300005335 | Bacteria | 2165 |
| 24 | Ga0070680_100252252 | 3300005336 | Bacteria | 1492 |
| 25 | Ga0070680_100692360 | 3300005336 | Bacteria | 877 |
| 26 | Ga0070682_100040905 | 3300005337 | Bacteria | 2854 |
| 27 | Ga0068868_100048881 | 3300005338 | Bacteria | 3319 |
| 28 | Ga0068868_100586973 | 3300005338 | Bacteria | 986 |
| 29 | Ga0070689_100204427 | 3300005340 | Bacteria | 1614 |
| 30 | Ga0070689_100496854 | 3300005340 | Bacteria | 1044 |
| 31 | Ga0070687_100030182 | 3300005343 | Bacteria | 2648 |
| 32 | Ga0070661_100151960 | 3300005344 | Bacteria | 1750 |
| 33 | Ga0070661_100439080 | 3300005344 | Bacteria | 1037 |
| 34 | Ga0070668_100167162 | 3300005347 | Bacteria | 1788 |
| 35 | Ga0070668_100215448 | 3300005347 | Bacteria | 1581 |
| 36 | Ga0070668_100274728 | 3300005347 | Bacteria | 1405 |
| 37 | Ga0070669_100089154 | 3300005353 | Bacteria | 2310 |
| 38 | Ga0070675_100247393 | 3300005354 | Bacteria | 1559 |
| 39 | Ga0070674_100146594 | 3300005356 | Bacteria | 1777 |
| 40 | Ga0070674_100229108 | 3300005356 | Bacteria | 1449 |
| 41 | Ga0070688_100077791 | 3300005365 | Bacteria | 2138 |
| 42 | Ga0070659_100039485 | 3300005366 | Bacteria | 3685 |
| 43 | Ga0070659_100086128 | 3300005366 | Bacteria | 2513 |
| 44 | Ga0070667_100378556 | 3300005367 | Bacteria | 1285 |
| 45 | Ga0070667_100594843 | 3300005367 | Bacteria | 1019 |
| 46 | Ga0070713_100070980 | 3300005436 | Bacteria | 2942 |
| 47 | Ga0070710_10252708 | 3300005437 | Bacteria | 1134 |
| 48 | Ga0070701_10233181 | 3300005438 | Bacteria | 1103 |
| 49 | Ga0070700_100021826 | 3300005441 | Bacteria | 3725 |
| 50 | Ga0070700_100238249 | 3300005441 | Bacteria | 1299 |
| 51 | Ga0070663_100168329 | 3300005455 | Bacteria | 1692 |
| 52 | Ga0070663_100281654 | 3300005455 | Bacteria | 1325 |
| 53 | Ga0070663_100527956 | 3300005455 | Bacteria | 983 |
| 54 | Ga0070662_100214147 | 3300005457 | Bacteria | 1534 |
| 55 | Ga0070685_10119841 | 3300005466 | Bacteria | 1632 |
| 56 | Ga0070706_100414727 | 3300005467 | Bacteria | 1253 |
| 57 | Ga0070706_100839208 | 3300005467 | Bacteria | 850 |
| 58 | Ga0070698_100003844 | 3300005471 | Bacteria | 16514 |
| 59 | Ga0070698_100011204 | 3300005471 | Bacteria | 9527 |
| 60 | Ga0070698_100121343 | 3300005471 | Bacteria | 2574 |
| 61 | Ga0070698_100152824 | 3300005471 | Bacteria | 2255 |
| 62 | Ga0070699_100043875 | 3300005518 | Bacteria | 3870 |
| 63 | Ga0070679_100294514 | 3300005530 | Bacteria | 1574 |
| 64 | Ga0070684_100031237 | 3300005535 | Bacteria | 4532 |
| 65 | Ga0070684_100078361 | 3300005535 | Bacteria | 2920 |
| 66 | Ga0070684_100303012 | 3300005535 | Bacteria | 1466 |
| 67 | Ga0068853_100059884 | 3300005539 | Bacteria | 3290 |
| 68 | Ga0070672_100228822 | 3300005543 | Bacteria | 1561 |
| 69 | Ga0070686_100187545 | 3300005544 | Bacteria | 1474 |
| 70 | Ga0070686_100276959 | 3300005544 | Bacteria | 1236 |
| 71 | Ga0070665_100572778 | 3300005548 | Bacteria | 1142 |
| 72 | Ga0068855_100579021 | 3300005563 | Bacteria | 1212 |
| 73 | Ga0070664_100163306 | 3300005564 | Bacteria | 1972 |
| 74 | Ga0070664_100218671 | 3300005564 | Bacteria | 1704 |
| 75 | Ga0068856_100167274 | 3300005614 | Bacteria | 2210 |
| 76 | Ga0068856_100393938 | 3300005614 | Bacteria | 1405 |
| 77 | Ga0068856_100405504 | 3300005614 | Bacteria | 1383 |
| 78 | Ga0070702_100035313 | 3300005615 | Bacteria | 2761 |
| 79 | Ga0070702_100284253 | 3300005615 | Bacteria | 1137 |
| 80 | Ga0068859_100050436 | 3300005617 | Bacteria | 4180 |
| 81 | Ga0068859_100231883 | 3300005617 | Bacteria | 1934 |
| 82 | Ga0068859_100267153 | 3300005617 | Bacteria | 1802 |
| 83 | Ga0068859_100381962 | 3300005617 | Bacteria | 1504 |
| 84 | Ga0068866_10144317 | 3300005718 | Bacteria | 1370 |
| 85 | Ga0068851_10148789 | 3300005834 | Bacteria | 1279 |
| 86 | Ga0068860_100387526 | 3300005843 | Bacteria | 1380 |
| 87 | Ga0068860_100489645 | 3300005843 | Bacteria | 1226 |
| 88 | Ga0068862_100057284 | 3300005844 | Bacteria | 3341 |
| 89 | Ga0068862_100082549 | 3300005844 | Bacteria | 2789 |
| 90 | Ga0068862_100113799 | 3300005844 | Bacteria | 2378 |
| 91 | Ga0068862_100458472 | 3300005844 | Bacteria | 1203 |
| 92 | Ga0081455_10047563 | 3300005937 | Bacteria | 3714 |
| 93 | Ga0081455_10057779 | 3300005937 | Bacteria | 3286 |
| 94 | Ga0081455_10104029 | 3300005937 | Bacteria | 2272 |
| 95 | Ga0081540_1015586 | 3300005983 | Bacteria | 4806 |
| 96 | Ga0081540_1109767 | 3300005983 | Bacteria | 1169 |
| 97 | Ga0081540_1119509 | 3300005983 | Bacteria | 1096 |
| 98 | Ga0081539_10000126 | 3300005985 | Bacteria | 180324 |
| 99 | Ga0081539_10000625 | 3300005985 | Bacteria | 71667 |
| 100 | Ga0081539_10000637 | 3300005985 | Bacteria | 70993 |
| 101 | Ga0081539_10003444 | 3300005985 | Bacteria | 19435 |
| 102 | Ga0081539_10005772 | 3300005985 | Bacteria | 12340 |
| 103 | Ga0081539_10007415 | 3300005985 | Bacteria | 10010 |
| 104 | Ga0081539_10011727 | 3300005985 | Bacteria | 6874 |
| 105 | Ga0081539_10011985 | 3300005985 | Bacteria | 6757 |
| 106 | Ga0081539_10017034 | 3300005985 | Bacteria | 5134 |
| 107 | Ga0081539_10074717 | 3300005985 | Bacteria | 1804 |
| 108 | Ga0070717_10058519 | 3300006028 | Bacteria | 3187 |
| 109 | Ga0070716_100004860 | 3300006173 | Bacteria | 6462 |
| 110 | Ga0075369_10019363 | 3300006186 | Bacteria | 2779 |
| 111 | Ga0075366_10231959 | 3300006195 | Bacteria | 1125 |
| 112 | Ga0068871_100113946 | 3300006358 | Bacteria | 2277 |
| 113 | Ga0075428_100167804 | 3300006844 | Bacteria | 2381 |
| 114 | Ga0075428_100463180 | 3300006844 | Bacteria | 1357 |
| 115 | Ga0075430_100134205 | 3300006846 | Bacteria | 2063 |
| 116 | Ga0075430_100226671 | 3300006846 | Bacteria | 1550 |
| 117 | Ga0075431_100028517 | 3300006847 | Bacteria | 5739 |
| 118 | Ga0075434_100143599 | 3300006871 | Bacteria | 2407 |
| 119 | Ga0068865_100019996 | 3300006881 | Bacteria | 4339 |
| 120 | Ga0068865_100363688 | 3300006881 | Bacteria | 1176 |
| 121 | Ga0068865_100410742 | 3300006881 | Bacteria | 1111 |
| 122 | Ga0068865_100535412 | 3300006881 | Bacteria | 982 |
| 123 | Ga0097620_100050436 | 3300006931 | Bacteria | 4180 |
| 124 | Ga0097620_100231886 | 3300006931 | Bacteria | 1934 |
| 125 | Ga0097620_100267147 | 3300006931 | Bacteria | 1802 |
| 126 | Ga0079104_1003546 | 3300006946 | Bacteria | 7174 |
| 127 | Ga0099826_10009641 | 3300006948 | Bacteria | 7211 |
| 128 | Ga0105240_10108889 | 3300009093 | Bacteria | 3356 |
| 129 | Ga0111539_10010363 | 3300009094 | Bacteria | 11736 |
| 130 | Ga0111539_10069633 | 3300009094 | Bacteria | 4154 |
| 131 | Ga0111539_10305644 | 3300009094 | Bacteria | 1851 |
| 132 | Ga0111539_10588167 | 3300009094 | Bacteria | 1296 |
| 133 | Ga0114129_10003154 | 3300009147 | Bacteria | 23134 |
| 134 | Ga0114129_10647522 | 3300009147 | Bacteria | 1364 |
| 135 | Ga0105243_10059707 | 3300009148 | Bacteria | 3044 |
| 136 | Ga0105243_10174335 | 3300009148 | Bacteria | 1865 |
| 137 | Ga0105241_10050487 | 3300009174 | Bacteria | 3170 |
| 138 | Ga0105242_10224843 | 3300009176 | Bacteria | 1679 |
| 139 | Ga0105248_10223354 | 3300009177 | Bacteria | 2120 |
| 140 | Ga0105237_10111977 | 3300009545 | Bacteria | 2721 |
| 141 | Ga0105237_10263238 | 3300009545 | Bacteria | 1727 |
| 142 | Ga0105238_10372651 | 3300009551 | Bacteria | 1418 |
| 143 | Ga0105238_10872705 | 3300009551 | Bacteria | 917 |
| 144 | Ga0105249_10105939 | 3300009553 | Bacteria | 2651 |
| 145 | Ga0105249_10124621 | 3300009553 | Bacteria | 2452 |
| 146 | Ga0105249_10437986 | 3300009553 | Bacteria | 1344 |
| 147 | Ga0105032_104024 | 3300009979 | Bacteria | 1261 |
| 148 | Ga0105239_10198574 | 3300010375 | Bacteria | 2247 |
| 149 | Ga0105239_10591175 | 3300010375 | Bacteria | 1266 |
| 150 | Ga0105246_10125784 | 3300011119 | Bacteria | 1907 |
| 151 | Ga0105246_10384664 | 3300011119 | Bacteria | 1160 |
| 152 | Ga0157371_10324675 | 3300013102 | Bacteria | 1117 |
| 153 | Ga0157369_10169849 | 3300013105 | Bacteria | 2298 |
| 154 | Ga0157369_10341140 | 3300013105 | Bacteria | 1556 |
| 155 | Ga0157369_10476009 | 3300013105 | Bacteria | 1292 |
| 156 | Ga0157374_10032892 | 3300013296 | Bacteria | 4727 |
| 157 | Ga0157374_10159632 | 3300013296 | Bacteria | 2196 |
| 158 | Ga0157374_10197379 | 3300013296 | Bacteria | 1969 |
| 159 | Ga0157378_10091360 | 3300013297 | Bacteria | 2767 |
| 160 | Ga0157378_10141186 | 3300013297 | Bacteria | 2237 |
| 161 | Ga0163162_10255599 | 3300013306 | Bacteria | 1884 |
| 162 | Ga0157372_10369368 | 3300013307 | Bacteria | 1672 |
| 163 | Ga0157372_10498852 | 3300013307 | Bacteria | 1419 |
| 164 | Ga0157372_10695120 | 3300013307 | Bacteria | 1184 |
| 165 | Ga0157375_10278171 | 3300013308 | Bacteria | 1837 |
| 166 | Ga0157375_10429746 | 3300013308 | Bacteria | 1487 |
| 167 | Ga0163163_10085665 | 3300014325 | Bacteria | 3159 |
| 168 | Ga0163163_10102051 | 3300014325 | Bacteria | 2892 |
| 169 | Ga0157380_10016085 | 3300014326 | Bacteria | 5511 |
| 170 | Ga0157380_10133460 | 3300014326 | Bacteria | 2122 |
| 171 | Ga0157377_10049872 | 3300014745 | Bacteria | 2355 |
| 172 | Ga0157377_10090477 | 3300014745 | Bacteria | 1806 |
| 173 | Ga0157379_10098680 | 3300014968 | Bacteria | 2622 |
| 174 | Ga0157376_10072154 | 3300014969 | Bacteria | 2936 |
| 175 | Ga0157376_10163440 | 3300014969 | Bacteria | 2020 |
| 176 | Ga0163161_10179140 | 3300017792 | Bacteria | 1624 |
| 177 | Ga0163161_10276361 | 3300017792 | Bacteria | 1316 |
| 178 | Ga0197907_10385080 | 3300020069 | Bacteria | 2793 |
| 179 | Ga0206351_10974719 | 3300020077 | Bacteria | 4726 |
| 180 | Ga0206350_10575891 | 3300020080 | Bacteria | 4663 |
| 181 | Ga0154015_1648053 | 3300020610 | Bacteria | 1709 |
| 182 | Ga0213874_10024230 | 3300021377 | Bacteria | 1700 |
| 183 | Ga0213876_10008246 | 3300021384 | Bacteria | 5638 |
| 184 | Ga0213875_10000999 | 3300021388 | Bacteria | 20157 |
| 185 | Ga0213871_10019812 | 3300021441 | Bacteria | 1660 |
| 186 | Ga0224712_10001521 | 3300022467 | Bacteria | 5379 |
| 187 | Ga0224712_10068507 | 3300022467 | Bacteria | 1434 |
| 188 | Ga0228711_1010705 | 3300022739 | Bacteria | 11957 |
| 189 | Ga0228710_1004002 | 3300022740 | Bacteria | 23308 |
| 190 | Ga0209436_100321 | 3300025208 | Bacteria | 21971 |
| 191 | Ga0209673_1048255 | 3300025273 | Bacteria | 1148 |
| 192 | Ga0209130_1000234 | 3300025284 | Bacteria | 71914 |
| 193 | Ga0209025_1000148 | 3300025294 | Bacteria | 179802 |
| 194 | Ga0209025_1001085 | 3300025294 | Bacteria | 39382 |
| 195 | Ga0209025_1096319 | 3300025294 | Bacteria | 951 |
| 196 | Ga0209758_1000028 | 3300025297 | Bacteria | 530102 |
| 197 | Ga0207426_1000410 | 3300025302 | Bacteria | 71914 |
| 198 | Ga0209051_1000151 | 3300025303 | Bacteria | 131835 |
| 199 | Ga0209257_1000688 | 3300025304 | Bacteria | 52564 |
| 200 | Ga0209257_1009307 | 3300025304 | Bacteria | 5306 |
| 201 | Ga0207656_10123726 | 3300025321 | Bacteria | 1206 |
| 202 | Ga0207642_10031982 | 3300025899 | Bacteria | 2210 |
| 203 | Ga0207642_10228734 | 3300025899 | Bacteria | 1043 |
| 204 | Ga0207710_10103502 | 3300025900 | Bacteria | 1345 |
| 205 | Ga0207688_10053057 | 3300025901 | Bacteria | 2273 |
| 206 | Ga0207688_10065102 | 3300025901 | Bacteria | 2059 |
| 207 | Ga0207647_10120478 | 3300025904 | Bacteria | 1547 |
| 208 | Ga0207645_10167248 | 3300025907 | Bacteria | 1440 |
| 209 | Ga0207643_10030850 | 3300025908 | Bacteria | 2986 |
| 210 | Ga0207684_10230102 | 3300025910 | Bacteria | 1599 |
| 211 | Ga0207684_10261286 | 3300025910 | Bacteria | 1494 |
| 212 | Ga0207684_10391971 | 3300025910 | Bacteria | 1194 |
| 213 | Ga0207662_10010208 | 3300025918 | Bacteria | 5179 |
| 214 | Ga0207662_10066514 | 3300025918 | Bacteria | 2172 |
| 215 | Ga0207662_10125744 | 3300025918 | Bacteria | 1612 |
| 216 | Ga0207657_10190637 | 3300025919 | Bacteria | 1654 |
| 217 | Ga0207652_10064459 | 3300025921 | Bacteria | 3171 |
| 218 | Ga0207652_10254170 | 3300025921 | Bacteria | 1585 |
| 219 | Ga0207646_10081275 | 3300025922 | Bacteria | 2897 |
| 220 | Ga0207681_10124747 | 3300025923 | Bacteria | 1894 |
| 221 | Ga0207694_10285465 | 3300025924 | Bacteria | 1356 |
| 222 | Ga0207650_10473936 | 3300025925 | Bacteria | 1044 |
| 223 | Ga0207687_10051809 | 3300025927 | Bacteria | 2862 |
| 224 | Ga0207706_10162215 | 3300025933 | Bacteria | 1965 |
| 225 | Ga0207709_10120437 | 3300025935 | Bacteria | 1771 |
| 226 | Ga0207670_10091523 | 3300025936 | Bacteria | 2151 |
| 227 | Ga0207691_10215311 | 3300025940 | Bacteria | 1667 |
| 228 | Ga0207711_10225018 | 3300025941 | Bacteria | 1717 |
| 229 | Ga0207711_10481852 | 3300025941 | Bacteria | 1156 |
| 230 | Ga0207689_10080230 | 3300025942 | Bacteria | 2682 |
| 231 | Ga0207679_10155566 | 3300025945 | Bacteria | 1866 |
| 232 | Ga0207679_10324152 | 3300025945 | Bacteria | 1335 |
| 233 | Ga0207712_10007694 | 3300025961 | Bacteria | 6813 |
| 234 | Ga0207668_10005051 | 3300025972 | Bacteria | 7765 |
| 235 | Ga0207668_10008857 | 3300025972 | Bacteria | 6017 |
| 236 | Ga0207668_10184120 | 3300025972 | Bacteria | 1650 |
| 237 | Ga0207640_10138137 | 3300025981 | Bacteria | 1772 |
| 238 | Ga0207658_10077762 | 3300025986 | Bacteria | 2533 |
| 239 | Ga0207678_10000467 | 3300026067 | Bacteria | 36612 |
| 240 | Ga0207678_10018585 | 3300026067 | Bacteria | 6103 |
| 241 | Ga0207678_10775748 | 3300026067 | Bacteria | 846 |
| 242 | Ga0207708_10012373 | 3300026075 | Bacteria | 6359 |
| 243 | Ga0207708_10099757 | 3300026075 | Bacteria | 2246 |
| 244 | Ga0207708_10205872 | 3300026075 | Bacteria | 1571 |
| 245 | Ga0207708_10300090 | 3300026075 | Bacteria | 1306 |
| 246 | Ga0207702_10075671 | 3300026078 | Bacteria | 2909 |
| 247 | Ga0207702_10222848 | 3300026078 | Bacteria | 1758 |
| 248 | Ga0207641_10278060 | 3300026088 | Bacteria | 1573 |
| 249 | Ga0207648_10361910 | 3300026089 | Bacteria | 1309 |
| 250 | Ga0207676_10077355 | 3300026095 | Bacteria | 2691 |
| 251 | Ga0207674_10054248 | 3300026116 | Bacteria | 4081 |
| 252 | Ga0207674_10247353 | 3300026116 | Bacteria | 1730 |
| 253 | Ga0207675_100138020 | 3300026118 | Bacteria | 2315 |
| 254 | Ga0207683_10218524 | 3300026121 | Bacteria | 1736 |
| 255 | Ga0207683_10552097 | 3300026121 | Bacteria | 1065 |
| 256 | Ga0207698_10146122 | 3300026142 | Bacteria | 2045 |
| 257 | Ga0209281_1002478 | 3300027111 | Bacteria | 7339 |
| 258 | Ga0209983_1055110 | 3300027665 | Bacteria | 873 |
| 259 | Ga0209282_1006327 | 3300027666 | Bacteria | 7348 |
| 260 | Ga0268266_10072249 | 3300028379 | Bacteria | 2991 |
| 261 | Ga0268266_10220387 | 3300028379 | Bacteria | 1744 |
| 262 | Ga0268265_10040511 | 3300028380 | Bacteria | 3441 |
| 263 | Ga0268265_10217404 | 3300028380 | Bacteria | 1669 |
| 264 | Ga0268265_10283063 | 3300028380 | Bacteria | 1484 |
| 265 | Ga0268264_10517697 | 3300028381 | Bacteria | 1166 |
| 266 | Ga0307517_10091100 | 3300028786 | Bacteria | 2494 |
| 267 | Ga0307517_10138535 | 3300028786 | Bacteria | 1719 |
| 268 | Ga0307515_10004370 | 3300028794 | Bacteria | 29310 |
| 269 | Ga0307515_10008974 | 3300028794 | Bacteria | 19426 |
| 270 | Ga0307515_10065639 | 3300028794 | Bacteria | 5045 |
| 271 | Ga0307515_10068670 | 3300028794 | Bacteria | 4863 |
| 272 | Ga0307515_10072941 | 3300028794 | Bacteria | 4623 |
| 273 | Ga0307515_10177356 | 3300028794 | Bacteria | 2096 |
| 274 | Ga0307515_10202591 | 3300028794 | Bacteria | 1855 |
| 275 | Ga0265338_10182629 | 3300028800 | Bacteria | 1598 |
| 276 | Ga0307511_10000018 | 3300030521 | Bacteria | 118259 |
| 277 | Ga0307512_10025405 | 3300030522 | Bacteria | 5249 |
| 278 | Ga0307512_10048766 | 3300030522 | Bacteria | 3424 |
| 279 | Ga0307512_10080563 | 3300030522 | Bacteria | 2343 |
| 280 | Ga0307512_10182825 | 3300030522 | Bacteria | 1174 |
| 281 | Ga0265325_10035191 | 3300031241 | Bacteria | 2662 |
| 282 | Ga0265340_10000264 | 3300031247 | Bacteria | 27200 |
| 283 | Ga0265340_10001252 | 3300031247 | Bacteria | 14590 |
| 284 | Ga0265339_10014693 | 3300031249 | Bacteria | 4713 |
| 285 | Ga0265316_10009686 | 3300031344 | Bacteria | 8845 |
| 286 | Ga0307513_10003112 | 3300031456 | Bacteria | 22645 |
| 287 | Ga0307513_10006535 | 3300031456 | Bacteria | 15225 |
| 288 | Ga0307513_10034606 | 3300031456 | Bacteria | 5666 |
| 289 | Ga0307513_10078136 | 3300031456 | Bacteria | 3424 |
| 290 | Ga0307513_10146342 | 3300031456 | Bacteria | 2280 |
| 291 | Ga0307513_10267271 | 3300031456 | Unclassified | 1496 |
| 292 | Ga0307513_10284528 | 3300031456 | Bacteria | 1429 |
| 293 | Ga0307509_10019257 | 3300031507 | Bacteria | 7791 |
| 294 | Ga0307509_10268801 | 3300031507 | Bacteria | 1474 |
| 295 | Ga0307509_10517374 | 3300031507 | Bacteria | 875 |
| 296 | Ga0307408_100616705 | 3300031548 | Bacteria | 966 |
| 297 | Ga0265313_10006384 | 3300031595 | Bacteria | 8365 |
| 298 | Ga0307508_10032834 | 3300031616 | Bacteria | 4687 |
| 299 | Ga0307508_10161641 | 3300031616 | Bacteria | 1843 |
| 300 | Ga0307508_10344043 | 3300031616 | Bacteria | 1083 |
| 301 | Ga0316575_10091944 | 3300031665 | Bacteria | 1229 |
| 302 | Ga0265342_10007507 | 3300031712 | Bacteria | 7977 |
| 303 | Ga0316576_10285238 | 3300031727 | Bacteria | 1236 |
| 304 | Ga0307516_10001110 | 3300031730 | Bacteria | 37506 |
| 305 | Ga0307516_10062844 | 3300031730 | Bacteria | 3596 |
| 306 | Ga0307516_10092896 | 3300031730 | Bacteria | 2844 |
| 307 | Ga0307516_10118217 | 3300031730 | Bacteria | 2445 |
| 308 | Ga0307516_10165195 | 3300031730 | Bacteria | 1959 |
| 309 | Ga0307516_10170528 | 3300031730 | Bacteria | 1917 |
| 310 | Ga0307405_10570842 | 3300031731 | Bacteria | 919 |
| 311 | Ga0316577_10001658 | 3300031733 | Bacteria | 10647 |
| 312 | Ga0307413_10092983 | 3300031824 | Bacteria | 1970 |
| 313 | Ga0307410_10013090 | 3300031852 | Bacteria | 4827 |
| 314 | Ga0307410_10027433 | 3300031852 | Bacteria | 3600 |
| 315 | Ga0307410_10032173 | 3300031852 | Bacteria | 3373 |
| 316 | Ga0307406_10060053 | 3300031901 | Bacteria | 2450 |
| 317 | Ga0307406_10444874 | 3300031901 | Bacteria | 1038 |
| 318 | Ga0307407_10030825 | 3300031903 | Bacteria | 2898 |
| 319 | Ga0307412_10728069 | 3300031911 | Bacteria | 854 |
| 320 | Ga0315914_1006088 | 3300031967 | Bacteria | 17251 |
| 321 | Ga0307409_100041508 | 3300031995 | Bacteria | 3437 |
| 322 | Ga0307409_100054873 | 3300031995 | Bacteria | 3072 |
| 323 | Ga0307409_100059667 | 3300031995 | Bacteria | 2970 |
| 324 | Ga0307409_100125537 | 3300031995 | Bacteria | 2182 |
| 325 | Ga0307409_100140161 | 3300031995 | Bacteria | 2082 |
| 326 | Ga0307409_100154556 | 3300031995 | Bacteria | 1997 |
| 327 | Ga0307409_100230997 | 3300031995 | Bacteria | 1677 |
| 328 | Ga0307409_100333330 | 3300031995 | Bacteria | 1425 |
| 329 | Ga0307409_100653347 | 3300031995 | Bacteria | 1046 |
| 330 | Ga0307416_100017610 | 3300032002 | Bacteria | 5006 |
| 331 | Ga0307416_100065503 | 3300032002 | Bacteria | 2986 |
| 332 | Ga0307416_100070045 | 3300032002 | Bacteria | 2906 |
| 333 | Ga0307416_100176676 | 3300032002 | Bacteria | 1996 |
| 334 | Ga0307411_10134806 | 3300032005 | Bacteria | 1811 |
| 335 | Ga0307411_10204669 | 3300032005 | Bacteria | 1519 |
| 336 | Ga0307415_100002826 | 3300032126 | Bacteria | 8694 |
| 337 | Ga0307415_100022456 | 3300032126 | Bacteria | 3894 |
| 338 | Ga0307415_100025086 | 3300032126 | Bacteria | 3735 |
| 339 | Ga0307415_100276505 | 3300032126 | Bacteria | 1378 |
| 340 | Ga0307507_10034587 | 3300033179 | Bacteria | 5214 |
| 341 | Ga0307507_10304869 | 3300033179 | Bacteria | 973 |
| 342 | Ga0307510_10073095 | 3300033180 | Bacteria | 3401 |
| 343 | Ga0315913_1009766 | 3300033430 | Bacteria | 11183 |
| 344 | Ga0315915_1013567 | 3300033464 | Bacteria | 8345 |
| 345 | Ga0373950_0009114 | 3300034818 | Bacteria | 1576 |
| 346 | Ga0373938_0003915 | 3300034957 | Bacteria | 2462 |
| 347 | Ga0373951_0000019 | 3300035091 | Bacteria | 63710 |
| 348 | Ga0373932_0067724 | 3300035112 | Bacteria | 1100 |
| 349 | Ga0373941_0017724 | 3300035115 | Bacteria | 1956 |
| 350 | Ga0373954_0074605 | 3300035118 | Bacteria | 1615 |
| 351 | Ga0373955_0161046 | 3300035172 | Bacteria | 1325 |
| 352 | Ga0373942_0000361 | 3300035207 | Bacteria | 12507 |
| 353 | Ga0373962_0000437 | 3300035242 | Bacteria | 9118 |
| 354 | Ga0373962_0004433 | 3300035242 | Bacteria | 3392 |
| 355 | Ga0373931_0223046 | 3300035691 | Bacteria | 1136 |
| 356 | Ga0373931_0233636 | 3300035691 | Bacteria | 1112 |
| 357 | Ga0373935_0325304 | 3300035692 | Bacteria | 1092 |
| 358 | Ga0373935_0491823 | 3300035692 | Bacteria | 890 |
| 359 | Ga0373927_0205054 | 3300035695 | Bacteria | 1295 |
| 360 | Ga0373937_0397672 | 3300036401 | Bacteria | 1307 |
| 361 | Ga0316584_0111828 | 3300036712 | Bacteria | 2044 |
| 362 | Ga0373925_0072324 | 3300037068 | Bacteria | 2609 |
| 363 | Ga0373925_0271516 | 3300037068 | Bacteria | 1364 |
| 364 | Ga0395899_0009166 | 3300037312 | Bacteria | 7601 |
| 365 | Ga0395900_0002343 | 3300037418 | Bacteria | 20976 |
| 366 | Ga0395898_0001662 | 3300037466 | Bacteria | 29830 |
| 367 | Ga0395898_0005170 | 3300037466 | Bacteria | 14117 |
| 368 | Ga0395898_0524786 | 3300037466 | Bacteria | 1126 |
| 369 | Ga0395905_0003552 | 3300037471 | Bacteria | 16606 |
| 370 | Ga0395905_0328424 | 3300037471 | Bacteria | 1420 |
| 371 | Ga0436364_0440359 | 3300037853 | Bacteria | 3349 |
| 372 | Ga0436364_0821552 | 3300037853 | Bacteria | 4804 |
| 373 | Ga0395901_0001195 | 3300038443 | Bacteria | 27615 |
| 374 | Ga0395901_0034366 | 3300038443 | Bacteria | 5235 |
| 375 | Ga0395901_0206282 | 3300038443 | Bacteria | 2059 |
| 376 | Ga0400484_07329 | 3300038725 | Bacteria | 3154 |
| 377 | Ga0400484_17835 | 3300038725 | Bacteria | 9328 |
| 378 | Ga0400490_19280 | 3300038726 | Bacteria | 13156 |
| 379 | Ga0400490_32168 | 3300038726 | Bacteria | 1453 |
| 380 | Ga0400490_50315 | 3300038726 | Bacteria | 3807 |
| 381 | Ga0400485_15476 | 3300038735 | Bacteria | 17000 |
| 382 | Ga0400488_13961 | 3300038741 | Bacteria | 16027 |
| 383 | Ga0400488_44356 | 3300038741 | Bacteria | 2613 |
| 384 | Ga0400488_55735 | 3300038741 | Bacteria | 5310 |
| 385 | Ga0400486_16545 | 3300038742 | Bacteria | 17067 |
| 386 | Ga0400483_056450 | 3300039062 | Bacteria | 5765 |
| 387 | Ga0400483_157671 | 3300039062 | Bacteria | 11039 |
| 388 | Ga0400489_00529 | 3300039093 | Bacteria | 8812 |
| 389 | Ga0400489_03098 | 3300039093 | Bacteria | 10205 |
| 390 | Ga0400487_06944 | 3300039110 | Bacteria | 16691 |
| 391 | Ga0400487_22271 | 3300039110 | Bacteria | 1839 |
| 392 | Ga0436365_0212978 | 3300039437 | Bacteria | 12450 |
| 393 | Ga0436365_1884481 | 3300039437 | Bacteria | 1483 |
| 394 | Ga0436360_0530628 | 3300039438 | Bacteria | 4361 |
| 395 | Ga0436361_0218515 | 3300039447 | Bacteria | 1838 |
| 396 | Ga0436361_0302978 | 3300039447 | Bacteria | 1550 |
| 397 | Ga0436361_0410902 | 3300039447 | Bacteria | 1253 |
| 398 | Ga0439436_0031243 | 3300041404 | Bacteria | 1546 |
| 399 | Ga0451791_0926953 | 3300041451 | Bacteria | 4546 |
| 400 | Ga0451807_0376592 | 3300041486 | Bacteria | 1480 |
| 401 | Ga0451837_0235358 | 3300041494 | Bacteria | 1134 |
| 402 | Ga0451853_1042061 | 3300041512 | Bacteria | 815 |
| 403 | Ga0439441_044549 | 3300042001 | Bacteria | 898 |
| 404 | Ga0439443_010104 | 3300042003 | Bacteria | 1364 |
| 405 | Ga0439445_0052494 | 3300042004 | Bacteria | 1103 |
| 406 | Ga0439449_0000640 | 3300042007 | Bacteria | 13147 |
| 407 | Ga0439449_0003455 | 3300042007 | Bacteria | 6148 |
| 408 | Ga0439449_0042470 | 3300042007 | Bacteria | 1689 |
| 409 | Ga0439463_040161 | 3300042016 | Bacteria | 1189 |
| 410 | Ga0439446_0025891 | 3300042156 | Bacteria | 1678 |
| 411 | Ga0439444_0027935 | 3300042437 | Bacteria | 1042 |
| 412 | Ga0439460_0031821 | 3300042461 | Bacteria | 1507 |
| 413 | Ga0466969_0004693 | 3300044656 | Bacteria | 7280 |
| 414 | Ga0466972_0001381 | 3300044658 | Bacteria | 11774 |
| 415 | Ga0466965_0009209 | 3300044683 | Bacteria | 4587 |
| 416 | Ga0466965_0087329 | 3300044683 | Bacteria | 1583 |
| 417 | Ga0466966_0002186 | 3300044684 | Bacteria | 12692 |
| 418 | Ga0466961_0239846 | 3300044693 | Bacteria | 1114 |
| 419 | Ga0466963_0221000 | 3300044694 | Bacteria | 1327 |
| 420 | Ga0466970_0123530 | 3300044765 | Bacteria | 1419 |
| 421 | Ga0466959_0031539 | 3300045049 | Bacteria | 3920 |
| 422 | Ga0451576_0011765 | 3300045051 | Bacteria | 9910 |
| 423 | Ga0466958_0155968 | 3300045836 | Bacteria | 1441 |
| 424 | Ga0466967_0317524 | 3300045976 | Bacteria | 1502 |
| 425 | Ga0466967_0318895 | 3300045976 | Bacteria | 1498 |
| 426 | Ga0495603_0161135 | 3300046455 | Bacteria | 1301 |
| 427 | Ga0495629_0050815 | 3300046459 | Bacteria | 2903 |
| 428 | Ga0495638_0015949 | 3300046460 | Bacteria | 5036 |
| 429 | Ga0495641_0012815 | 3300046461 | Bacteria | 4655 |
| 430 | Ga0495651_0023410 | 3300046462 | Bacteria | 4802 |
| 431 | Ga0495651_0174114 | 3300046462 | Bacteria | 1530 |
| 432 | Ga0495650_0056498 | 3300046471 | Bacteria | 1592 |
| 433 | Ga0495583_0000321 | 3300046506 | Bacteria | 75664 |
| 434 | Ga0495583_0000957 | 3300046506 | Bacteria | 33535 |
| 435 | Ga0495610_0007440 | 3300046512 | Bacteria | 7285 |
| 436 | Ga0495618_0039748 | 3300046514 | Bacteria | 2958 |
| 437 | Ga0495628_0268589 | 3300046516 | Bacteria | 1269 |
| 438 | Ga0495668_0220038 | 3300046616 | Bacteria | 1040 |
| 439 | Ga0495613_0051938 | 3300046689 | Bacteria | 3020 |
| 440 | Ga0495624_0040824 | 3300046690 | Bacteria | 2971 |
| 441 | Ga0495589_0149714 | 3300046794 | Bacteria | 1115 |
| 442 | Ga0495674_0027455 | 3300047319 | Bacteria | 5203 |
| 443 | Ga0495680_0002178 | 3300047322 | Bacteria | 20273 |
| 444 | Ga0496102_0175669 | 3300048905 | Bacteria | 2017 |
| 445 | Ga0496102_1148589 | 3300048905 | Bacteria | 696 |
| 446 | Ga0496104_0429500 | 3300048907 | Bacteria | 1233 |
| 447 | Ga0496105_0540410 | 3300048908 | Bacteria | 911 |
| 448 | Ga0496108_0000136 | 3300048911 | Bacteria | 71114 |
| 449 | Ga0496108_0074415 | 3300048911 | Bacteria | 2868 |
| 450 | Ga0496108_0530424 | 3300048911 | Bacteria | 1028 |
| 451 | Ga0496109_0042582 | 3300048912 | Bacteria | 4114 |
| 452 | Ga0496109_0304051 | 3300048912 | Bacteria | 1504 |
| 453 | Ga0496110_0050865 | 3300048913 | Bacteria | 3640 |
| 454 | Ga0496110_0185520 | 3300048913 | Bacteria | 1889 |
| 455 | Ga0496110_0241084 | 3300048913 | Bacteria | 1645 |
| 456 | Ga0496112_0180664 | 3300048915 | Bacteria | 2074 |
| 457 | Ga0496112_0745756 | 3300048915 | Bacteria | 906 |
| 458 | Ga0496113_0340715 | 3300048916 | Bacteria | 1202 |
| 459 | Ga0496114_0085841 | 3300048917 | Bacteria | 2666 |
| 460 | Ga0496117_0000912 | 3300048920 | Bacteria | 45269 |
| 461 | Ga0496122_0000364 | 3300048925 | Bacteria | 97193 |
| 462 | Ga0496123_0000094 | 3300048926 | Bacteria | 178612 |
| 463 | Ga0496124_0000741 | 3300048927 | Bacteria | 53446 |
| 464 | Ga0496125_0002252 | 3300048928 | Bacteria | 25630 |
| 465 | Ga0496125_0086256 | 3300048928 | Bacteria | 2375 |
| 466 | Ga0496126_0000418 | 3300048929 | Bacteria | 85944 |
| 467 | Ga0501308_000288 | 3300049128 | Bacteria | 3044 |
| 468 | Ga0501301_004766 | 3300049524 | Bacteria | 974 |
| 469 | Ga0501311_011109 | 3300049527 | Bacteria | 1104 |
| 470 | Ga0501031_0125742 | 3300049568 | Bacteria | 1675 |
| 471 | Ga0501032_0006089 | 3300049569 | Bacteria | 8885 |
| 472 | Ga0501033_0025989 | 3300049570 | Bacteria | 4406 |
| 473 | Ga0501033_0236042 | 3300049570 | Bacteria | 1298 |
| 474 | Ga0501033_0411059 | 3300049570 | Bacteria | 943 |
| 475 | Ga0501034_0046126 | 3300049571 | Bacteria | 4403 |
| 476 | Ga0501034_0775769 | 3300049571 | Bacteria | 853 |
| 477 | Ga0501036_0103311 | 3300049572 | Bacteria | 2410 |
| 478 | Ga0501036_0133139 | 3300049572 | Bacteria | 2098 |
| 479 | Ga0501037_0022613 | 3300049573 | Bacteria | 4649 |
| 480 | Ga0501038_0001456 | 3300049574 | Bacteria | 21753 |
| 481 | Ga0501038_0099275 | 3300049574 | Bacteria | 2427 |
| 482 | Ga0501039_0033041 | 3300049575 | Bacteria | 3991 |
| 483 | Ga0501043_0017631 | 3300049579 | Bacteria | 5599 |
| 484 | Ga0501046_0009615 | 3300049580 | Bacteria | 8338 |
| 485 | Ga0501046_0073211 | 3300049580 | Bacteria | 2659 |
| 486 | Ga0501047_0017612 | 3300049581 | Bacteria | 6845 |
| 487 | Ga0501047_0227897 | 3300049581 | Bacteria | 1718 |
| 488 | Ga0501048_0025412 | 3300049582 | Bacteria | 4316 |
| 489 | Ga0501067_0014017 | 3300049583 | Bacteria | 4440 |
| 490 | Ga0501067_0111553 | 3300049583 | Bacteria | 1521 |
| 491 | Ga0501068_0060285 | 3300049584 | Bacteria | 2304 |
| 492 | Ga0501069_0000186 | 3300049585 | Bacteria | 27883 |
| 493 | Ga0501069_0044750 | 3300049585 | Bacteria | 2451 |
| 494 | Ga0501070_0009024 | 3300049586 | Bacteria | 8436 |
| 495 | Ga0501070_0394805 | 3300049586 | Bacteria | 1119 |
| 496 | Ga0501071_0175852 | 3300049587 | Bacteria | 1603 |
| 497 | Ga0501072_0067789 | 3300049588 | Bacteria | 2816 |
| 498 | Ga0501073_0017595 | 3300049589 | Bacteria | 5176 |
| 499 | Ga0501073_0032382 | 3300049589 | Bacteria | 3726 |
| 500 | Ga0501073_0122210 | 3300049589 | Bacteria | 1804 |
| 501 | Ga0501074_0002793 | 3300049590 | Bacteria | 12217 |
| 502 | Ga0501074_0141109 | 3300049590 | Bacteria | 1723 |
| 503 | Ga0501075_0429954 | 3300049591 | Bacteria | 1007 |
| 504 | Ga0501079_0329089 | 3300049741 | Bacteria | 1196 |
| 505 | Ga0501080_0001486 | 3300049742 | Bacteria | 19779 |
| 506 | Ga0501080_0006549 | 3300049742 | Bacteria | 10467 |
| 507 | Ga0501080_0031148 | 3300049742 | Bacteria | 4970 |
| 508 | Ga0501080_0079992 | 3300049742 | Bacteria | 3038 |
| 509 | Ga0501083_0005967 | 3300049744 | Bacteria | 8624 |
| 510 | Ga0501083_0010321 | 3300049744 | Bacteria | 6578 |
| 511 | Ga0501035_0019378 | 3300049822 | Bacteria | 6258 |
| 512 | Ga0501044_0045876 | 3300049823 | Bacteria | 4526 |
| 513 | Ga0501044_0262827 | 3300049823 | Bacteria | 1664 |
| 514 | nmdc:mga05p37_611325_c1 | 3300050507 | Bacteria | 1228 |
| 515 | nmdc:mga05p37_669460_c1 | 3300050507 | Bacteria | 1159 |
| 516 | nmdc:mga05p37_70192_c1 | 3300050507 | Bacteria | 4309 |
| 517 | nmdc:mga09592_120498_c1 | 3300050508 | Bacteria | 2253 |
| 518 | nmdc:mga09592_121881_c1 | 3300050508 | Bacteria | 2240 |
| 519 | nmdc:mga09592_752817_c1 | 3300050508 | Bacteria | 826 |
| 520 | nmdc:mga0qj67_17827_c2 | 3300050509 | Bacteria | 3345 |
| 521 | nmdc:mga0qj67_27984_c1 | 3300050509 | Bacteria | 4373 |
| 522 | nmdc:mga06r32_1502_c1 | 3300050510 | Bacteria | 20961 |
| 523 | nmdc:mga08y16_181087_c1 | 3300050511 | Bacteria | 2188 |
| 524 | nmdc:mga08y16_278294_c1 | 3300050511 | Bacteria | 1726 |
| 525 | nmdc:mga08y16_555291_c1 | 3300050511 | Bacteria | 1162 |
| 526 | Ga0500578_0000683 | 3300053086 | Bacteria | 40592 |
| 527 | Ga0500578_0015335 | 3300053086 | Bacteria | 4926 |
| 528 | Ga0500644_0007215 | 3300053088 | Bacteria | 2886 |
| 529 | Ga0500644_0115506 | 3300053088 | Bacteria | 1039 |
| 530 | Ga0500646_0012505 | 3300053090 | Bacteria | 2191 |
| 531 | Ga0500651_0028674 | 3300053093 | Bacteria | 3500 |
| 532 | Ga0500641_0007723 | 3300053096 | Bacteria | 3833 |
| 533 | Ga0500641_0013554 | 3300053096 | Bacteria | 2996 |
| 534 | Ga0500556_0000469 | 3300053104 | Bacteria | 28449 |
| 535 | Ga0500556_0078962 | 3300053104 | Bacteria | 1241 |
| 536 | Ga0500562_023520 | 3300053108 | Bacteria | 1609 |
| 537 | Ga0500594_0100429 | 3300053118 | Bacteria | 890 |
| 538 | Ga0500595_007283 | 3300053119 | Bacteria | 4594 |
| 539 | Ga0500642_0111052 | 3300053130 | Bacteria | 1280 |
| 540 | Ga0500652_014571 | 3300053131 | Bacteria | 2815 |
| 541 | Ga0500604_0001711 | 3300053151 | Bacteria | 6150 |
| 542 | Ga0500604_0086314 | 3300053151 | Bacteria | 1020 |
| 543 | Ga0500616_0001651 | 3300053153 | Bacteria | 20626 |
| 544 | Ga0500616_0001912 | 3300053153 | Bacteria | 18607 |
| 545 | Ga0500616_0001922 | 3300053153 | Bacteria | 18561 |
| 546 | Ga0500616_0046551 | 3300053153 | Bacteria | 2305 |
| 547 | Ga0500636_0020970 | 3300053177 | Bacteria | 3869 |
| 548 | Ga0500636_0046727 | 3300053177 | Bacteria | 2552 |
| 549 | Ga0500609_001646 | 3300053731 | Bacteria | 3258 |
| 550 | Ga0500609_017868 | 3300053731 | Bacteria | 964 |
| 551 | Ga0500599_006284 | 3300053736 | Bacteria | 1512 |
| 552 | Ga0501084_0009489 | 3300054114 | Bacteria | 8053 |
| 553 | Ga0501084_0017454 | 3300054114 | Bacteria | 5966 |
| 554 | Ga0501084_0491750 | 3300054114 | Bacteria | 1037 |
| 555 | Ga0587069_019247 | 3300059642 | Bacteria | 1007 |
| 556 | Ga0501082_0013701 | 3300060353 | Bacteria | 6969 |
| 557 | Ga0501082_0103648 | 3300060353 | Bacteria | 2461 |
| 558 | Ga0501082_0517766 | 3300060353 | Bacteria | 1043 |
| 559 | Ga0466962_0054728 | 3300061719 | Bacteria | 1907 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048905 | Ga0496102_1148589 | Ga0496102_1148589_15_683 | 212 |
| 2 | 3300048908 | Ga0496105_0540410 | Ga0496105_0540410_99_854 | 213 |
| 3 | 3300041512 | Ga0451853_1042061 | Ga0451853_1042061_28_768 | 215 |
| 4 | 3300053104 | Ga0500556_0078962 | Ga0500556_0078962_332_1144 | 217 |
| 5 | 3300006028 | Ga0070717_10058519 | Ga0070717_100585192 | 221 |
| 6 | 3300046506 | Ga0495583_0000957 | Ga0495583_0000957_6451_7305 | 221 |
| 7 | 3300050508 | nmdc:mga09592_752817_c1 | nmdc:mga09592_752817_c1_145_810 | 221 |
| 8 | 3300005985 | Ga0081539_10011985 | Ga0081539_100119853 | 223 |
| 9 | 3300037853 | Ga0436364_0821552 | Ga0436364_0821552_2119_2925 | 227 |
| 10 | 3300050508 | nmdc:mga09592_121881_c1 | nmdc:mga09592_121881_c1_1193_1888 | 228 |
| 11 | 3300005937 | Ga0081455_10047563 | Ga0081455_100475633 | 231 |
| 12 | 3300014745 | Ga0157377_10049872 | Ga0157377_100498723 | 231 |
| 13 | 3300005535 | Ga0070684_100303012 | Ga0070684_1003030122 | 232 |
| 14 | 3300005614 | Ga0068856_100393938 | Ga0068856_1003939382 | 232 |
| 15 | 3300025945 | Ga0207679_10155566 | Ga0207679_101555662 | 232 |
| 16 | 3300026067 | Ga0207678_10775748 | Ga0207678_107757482 | 232 |
| 17 | 3300026078 | Ga0207702_10075671 | Ga0207702_100756713 | 232 |
| 18 | 3300003322 | rootL2_10034493 | rootL2_100344933 | 233 |
| 19 | 3300005937 | Ga0081455_10057779 | Ga0081455_100577792 | 233 |
| 20 | 3300005535 | Ga0070684_100031237 | Ga0070684_1000312373 | 234 |
| 21 | 3300025921 | Ga0207652_10064459 | Ga0207652_100644593 | 235 |
| 22 | 3300046459 | Ga0495629_0050815 | Ga0495629_0050815_48_875 | 235 |
| 23 | 3300046461 | Ga0495641_0012815 | Ga0495641_0012815_1972_2799 | 235 |
| 24 | 3300046514 | Ga0495618_0039748 | Ga0495618_0039748_216_1043 | 235 |
| 25 | 3300046689 | Ga0495613_0051938 | Ga0495613_0051938_1503_2330 | 235 |
| 26 | 3300046690 | Ga0495624_0040824 | Ga0495624_0040824_229_1056 | 235 |
| 27 | 3300047319 | Ga0495674_0027455 | Ga0495674_0027455_2085_2912 | 235 |
| 28 | 3300047322 | Ga0495680_0002178 | Ga0495680_0002178_13872_14699 | 235 |
| 29 | 3300031665 | Ga0316575_10091944 | Ga0316575_100919442 | 238 |
| 30 | 3300049585 | Ga0501069_0044750 | Ga0501069_0044750_1125_1961 | 238 |
| 31 | 3300049587 | Ga0501071_0175852 | Ga0501071_0175852_369_1205 | 238 |
| 32 | 3300049588 | Ga0501072_0067789 | Ga0501072_0067789_109_945 | 238 |
| 33 | 3300049590 | Ga0501074_0141109 | Ga0501074_0141109_358_1194 | 238 |
| 34 | 3300049591 | Ga0501075_0429954 | Ga0501075_0429954_26_862 | 238 |
| 35 | 3300049741 | Ga0501079_0329089 | Ga0501079_0329089_127_963 | 238 |
| 36 | 3300053118 | Ga0500594_0100429 | Ga0500594_0100429_39_788 | 238 |
| 37 | 3300054114 | Ga0501084_0009489 | Ga0501084_0009489_5232_6068 | 238 |
| 38 | 3300060353 | Ga0501082_0517766 | Ga0501082_0517766_141_977 | 238 |
| 39 | 3300005344 | Ga0070661_100439080 | Ga0070661_1004390802 | 239 |
| 40 | 3300005535 | Ga0070684_100078361 | Ga0070684_1000783612 | 239 |
| 41 | 3300005543 | Ga0070672_100228822 | Ga0070672_1002288222 | 239 |
| 42 | 3300006844 | Ga0075428_100167804 | Ga0075428_1001678042 | 239 |
| 43 | 3300006871 | Ga0075434_100143599 | Ga0075434_1001435991 | 239 |
| 44 | 3300006881 | Ga0068865_100363688 | Ga0068865_1003636882 | 239 |
| 45 | 3300009094 | Ga0111539_10588167 | Ga0111539_105881671 | 239 |
| 46 | 3300009147 | Ga0114129_10003154 | Ga0114129_1000315410 | 239 |
| 47 | 3300009148 | Ga0105243_10059707 | Ga0105243_100597072 | 239 |
| 48 | 3300009177 | Ga0105248_10223354 | Ga0105248_102233542 | 239 |
| 49 | 3300014325 | Ga0163163_10102051 | Ga0163163_101020513 | 239 |
| 50 | 3300014326 | Ga0157380_10016085 | Ga0157380_100160856 | 239 |
| 51 | 3300017792 | Ga0163161_10276361 | Ga0163161_102763612 | 239 |
| 52 | 3300025935 | Ga0207709_10120437 | Ga0207709_101204372 | 239 |
| 53 | 3300025940 | Ga0207691_10215311 | Ga0207691_102153112 | 239 |
| 54 | 3300025941 | Ga0207711_10225018 | Ga0207711_102250182 | 239 |
| 55 | 3300026075 | Ga0207708_10300090 | Ga0207708_103000902 | 239 |
| 56 | 3300046455 | Ga0495603_0161135 | Ga0495603_0161135_274_1065 | 239 |
| 57 | 3300048912 | Ga0496109_0304051 | Ga0496109_0304051_87_875 | 239 |
| 58 | 3300048915 | Ga0496112_0180664 | Ga0496112_0180664_888_1667 | 239 |
| 59 | 3300050511 | nmdc:mga08y16_555291_c1 | nmdc:mga08y16_555291_c1_352_1131 | 239 |
| 60 | 3300048911 | Ga0496108_0530424 | Ga0496108_0530424_224_1012 | 240 |
| 61 | 3300038725 | Ga0400484_17835 | Ga0400484_17835_6516_7334 | 241 |
| 62 | 3300042003 | Ga0439443_010104 | Ga0439443_010104_433_1182 | 241 |
| 63 | 3300042004 | Ga0439445_0052494 | Ga0439445_0052494_135_884 | 241 |
| 64 | 3300042007 | Ga0439449_0042470 | Ga0439449_0042470_151_900 | 241 |
| 65 | 3300042156 | Ga0439446_0025891 | Ga0439446_0025891_867_1616 | 241 |
| 66 | 3300042437 | Ga0439444_0027935 | Ga0439444_0027935_75_824 | 241 |
| 67 | 3300006844 | Ga0075428_100463180 | Ga0075428_1004631802 | 242 |
| 68 | 3300031456 | Ga0307513_10284528 | Ga0307513_102845282 | 242 |
| 69 | 3300046794 | Ga0495589_0149714 | Ga0495589_0149714_237_974 | 242 |
| 70 | iso_pu_bacteria | 2773857763 | 2774398806 | 242 |
| 71 | iso_pu_bacteria | 2937843397 | 2937845608 | 242 |
| 72 | 3300021441 | Ga0213871_10019812 | Ga0213871_100198122 | 243 |
| 73 | 3300039438 | Ga0436360_0530628 | Ga0436360_0530628_1929_2693 | 243 |
| 74 | 3300053151 | Ga0500604_0086314 | Ga0500604_0086314_229_996 | 243 |
| 75 | iso_pu_bacteria | 2795385472 | 2795795365 | 243 |
| 76 | iso_pu_bacteria | 2866612099 | 2866616210 | 243 |
| 77 | iso_pu_bacteria | 8003314358 | 8003314975 | 243 |
| 78 | 3300005438 | Ga0070701_10233181 | Ga0070701_102331812 | 244 |
| 79 | 3300005455 | Ga0070663_100168329 | Ga0070663_1001683292 | 244 |
| 80 | 3300005467 | Ga0070706_100414727 | Ga0070706_1004147272 | 244 |
| 81 | 3300005518 | Ga0070699_100043875 | Ga0070699_1000438752 | 244 |
| 82 | 3300005530 | Ga0070679_100294514 | Ga0070679_1002945142 | 244 |
| 83 | 3300005614 | Ga0068856_100167274 | Ga0068856_1001672743 | 244 |
| 84 | 3300005985 | Ga0081539_10007415 | Ga0081539_100074157 | 244 |
| 85 | 3300013105 | Ga0157369_10341140 | Ga0157369_103411402 | 244 |
| 86 | 3300013307 | Ga0157372_10695120 | Ga0157372_106951202 | 244 |
| 87 | 3300020069 | Ga0197907_10385080 | Ga0197907_103850803 | 244 |
| 88 | 3300020077 | Ga0206351_10974719 | Ga0206351_109747194 | 244 |
| 89 | 3300020080 | Ga0206350_10575891 | Ga0206350_105758914 | 244 |
| 90 | 3300020610 | Ga0154015_1648053 | Ga0154015_16480532 | 244 |
| 91 | 3300022467 | Ga0224712_10001521 | Ga0224712_100015214 | 244 |
| 92 | 3300025921 | Ga0207652_10254170 | Ga0207652_102541703 | 244 |
| 93 | 3300025922 | Ga0207646_10081275 | Ga0207646_100812752 | 244 |
| 94 | 3300026067 | Ga0207678_10018585 | Ga0207678_100185855 | 244 |
| 95 | 3300026078 | Ga0207702_10222848 | Ga0207702_102228482 | 244 |
| 96 | 3300031730 | Ga0307516_10165195 | Ga0307516_101651952 | 244 |
| 97 | 3300031995 | Ga0307409_100230997 | Ga0307409_1002309972 | 244 |
| 98 | 3300035692 | Ga0373935_0491823 | Ga0373935_0491823_38_817 | 244 |
| 99 | 3300037466 | Ga0395898_0524786 | Ga0395898_0524786_182_943 | 244 |
| 100 | 3300041451 | Ga0451791_0926953 | Ga0451791_0926953_3166_3960 | 244 |
| 101 | 3300041486 | Ga0451807_0376592 | Ga0451807_0376592_505_1278 | 244 |
| 102 | 3300044683 | Ga0466965_0009209 | Ga0466965_0009209_3237_4004 | 244 |
| 103 | 3300044683 | Ga0466965_0087329 | Ga0466965_0087329_534_1301 | 244 |
| 104 | 3300044694 | Ga0466963_0221000 | Ga0466963_0221000_264_1016 | 244 |
| 105 | 3300045976 | Ga0466967_0317524 | Ga0466967_0317524_22_774 | 244 |
| 106 | 3300045976 | Ga0466967_0318895 | Ga0466967_0318895_85_852 | 244 |
| 107 | 3300046616 | Ga0495668_0220038 | Ga0495668_0220038_265_1029 | 244 |
| 108 | 3300049527 | Ga0501311_011109 | Ga0501311_011109_140_913 | 244 |
| 109 | 3300049568 | Ga0501031_0125742 | Ga0501031_0125742_174_965 | 244 |
| 110 | 3300049569 | Ga0501032_0006089 | Ga0501032_0006089_5004_5795 | 244 |
| 111 | 3300049570 | Ga0501033_0025989 | Ga0501033_0025989_1077_1868 | 244 |
| 112 | 3300049571 | Ga0501034_0046126 | Ga0501034_0046126_2964_3755 | 244 |
| 113 | 3300049572 | Ga0501036_0103311 | Ga0501036_0103311_843_1634 | 244 |
| 114 | 3300049573 | Ga0501037_0022613 | Ga0501037_0022613_2097_2888 | 244 |
| 115 | 3300049574 | Ga0501038_0001456 | Ga0501038_0001456_16857_17648 | 244 |
| 116 | 3300049575 | Ga0501039_0033041 | Ga0501039_0033041_2203_2994 | 244 |
| 117 | 3300049579 | Ga0501043_0017631 | Ga0501043_0017631_4564_5355 | 244 |
| 118 | 3300049580 | Ga0501046_0009615 | Ga0501046_0009615_3163_3954 | 244 |
| 119 | 3300049581 | Ga0501047_0017612 | Ga0501047_0017612_3091_3882 | 244 |
| 120 | 3300049582 | Ga0501048_0025412 | Ga0501048_0025412_3373_4164 | 244 |
| 121 | 3300049585 | Ga0501069_0000186 | Ga0501069_0000186_24110_24901 | 244 |
| 122 | 3300049586 | Ga0501070_0009024 | Ga0501070_0009024_4085_4876 | 244 |
| 123 | 3300049589 | Ga0501073_0017595 | Ga0501073_0017595_2447_3238 | 244 |
| 124 | 3300049590 | Ga0501074_0002793 | Ga0501074_0002793_4085_4876 | 244 |
| 125 | 3300049742 | Ga0501080_0001486 | Ga0501080_0001486_3626_4417 | 244 |
| 126 | 3300049744 | Ga0501083_0010321 | Ga0501083_0010321_2882_3673 | 244 |
| 127 | 3300049822 | Ga0501035_0019378 | Ga0501035_0019378_2176_2967 | 244 |
| 128 | 3300049823 | Ga0501044_0045876 | Ga0501044_0045876_3344_4135 | 244 |
| 129 | 3300053104 | Ga0500556_0000469 | Ga0500556_0000469_14554_15297 | 244 |
| 130 | 3300053153 | Ga0500616_0001912 | Ga0500616_0001912_4772_5515 | 244 |
| 131 | 3300054114 | Ga0501084_0017454 | Ga0501084_0017454_3854_4645 | 244 |
| 132 | iso_pu_bacteria | 2582581299 | 2585229458 | 244 |
| 133 | iso_pu_bacteria | 2728369276 | 2729910138 | 244 |
| 134 | iso_pu_bacteria | 2899359706 | 2899359736 | 244 |
| 135 | 3300003215 | JGI25153J46596_10000019 | JGI25153J46596_10000019135 | 245 |
| 136 | 3300003322 | rootL2_10021095 | rootL2_100210956 | 245 |
| 137 | 3300005293 | Ga0065715_10037373 | Ga0065715_100373732 | 245 |
| 138 | 3300005329 | Ga0070683_100324179 | Ga0070683_1003241792 | 245 |
| 139 | 3300005336 | Ga0070680_100252252 | Ga0070680_1002522522 | 245 |
| 140 | 3300005347 | Ga0070668_100215448 | Ga0070668_1002154482 | 245 |
| 141 | 3300005356 | Ga0070674_100229108 | Ga0070674_1002291082 | 245 |
| 142 | 3300005471 | Ga0070698_100121343 | Ga0070698_1001213433 | 245 |
| 143 | 3300005471 | Ga0070698_100152824 | Ga0070698_1001528241 | 245 |
| 144 | 3300005544 | Ga0070686_100187545 | Ga0070686_1001875451 | 245 |
| 145 | 3300005564 | Ga0070664_100218671 | Ga0070664_1002186712 | 245 |
| 146 | 3300005615 | Ga0070702_100284253 | Ga0070702_1002842531 | 245 |
| 147 | 3300005844 | Ga0068862_100082549 | Ga0068862_1000825493 | 245 |
| 148 | 3300005985 | Ga0081539_10074717 | Ga0081539_100747172 | 245 |
| 149 | 3300006846 | Ga0075430_100134205 | Ga0075430_1001342053 | 245 |
| 150 | 3300006847 | Ga0075431_100028517 | Ga0075431_1000285172 | 245 |
| 151 | 3300009094 | Ga0111539_10010363 | Ga0111539_100103639 | 245 |
| 152 | 3300009545 | Ga0105237_10263238 | Ga0105237_102632382 | 245 |
| 153 | 3300021384 | Ga0213876_10008246 | Ga0213876_100082463 | 245 |
| 154 | 3300025297 | Ga0209758_1000028 | Ga0209758_1000028335 | 245 |
| 155 | 3300025304 | Ga0209257_1000688 | Ga0209257_100068816 | 245 |
| 156 | 3300025910 | Ga0207684_10230102 | Ga0207684_102301022 | 245 |
| 157 | 3300025924 | Ga0207694_10285465 | Ga0207694_102854652 | 245 |
| 158 | 3300025945 | Ga0207679_10324152 | Ga0207679_103241522 | 245 |
| 159 | 3300025972 | Ga0207668_10008857 | Ga0207668_100088574 | 245 |
| 160 | 3300026067 | Ga0207678_10000467 | Ga0207678_100004671 | 245 |
| 161 | 3300026116 | Ga0207674_10247353 | Ga0207674_102473532 | 245 |
| 162 | 3300028380 | Ga0268265_10217404 | Ga0268265_102174042 | 245 |
| 163 | 3300028794 | Ga0307515_10202591 | Ga0307515_102025912 | 245 |
| 164 | 3300030522 | Ga0307512_10182825 | Ga0307512_101828252 | 245 |
| 165 | 3300031456 | Ga0307513_10146342 | Ga0307513_101463422 | 245 |
| 166 | 3300031507 | Ga0307509_10268801 | Ga0307509_102688012 | 245 |
| 167 | 3300031616 | Ga0307508_10161641 | Ga0307508_101616412 | 245 |
| 168 | 3300031616 | Ga0307508_10344043 | Ga0307508_103440432 | 245 |
| 169 | 3300031731 | Ga0307405_10570842 | Ga0307405_105708421 | 245 |
| 170 | 3300033179 | Ga0307507_10304869 | Ga0307507_103048691 | 245 |
| 171 | 3300034957 | Ga0373938_0003915 | Ga0373938_0003915_861_1655 | 245 |
| 172 | 3300035115 | Ga0373941_0017724 | Ga0373941_0017724_738_1532 | 245 |
| 173 | 3300035118 | Ga0373954_0074605 | Ga0373954_0074605_188_964 | 245 |
| 174 | 3300035172 | Ga0373955_0161046 | Ga0373955_0161046_116_892 | 245 |
| 175 | 3300035207 | Ga0373942_0000361 | Ga0373942_0000361_11422_12216 | 245 |
| 176 | 3300035242 | Ga0373962_0000437 | Ga0373962_0000437_673_1467 | 245 |
| 177 | 3300035691 | Ga0373931_0233636 | Ga0373931_0233636_193_987 | 245 |
| 178 | 3300035692 | Ga0373935_0325304 | Ga0373935_0325304_279_1055 | 245 |
| 179 | 3300035695 | Ga0373927_0205054 | Ga0373927_0205054_350_1126 | 245 |
| 180 | 3300036401 | Ga0373937_0397672 | Ga0373937_0397672_116_892 | 245 |
| 181 | 3300037068 | Ga0373925_0271516 | Ga0373925_0271516_397_1173 | 245 |
| 182 | 3300038725 | Ga0400484_07329 | Ga0400484_07329_85_903 | 245 |
| 183 | 3300038735 | Ga0400485_15476 | Ga0400485_15476_11623_12417 | 245 |
| 184 | 3300038742 | Ga0400486_16545 | Ga0400486_16545_11701_12495 | 245 |
| 185 | 3300039093 | Ga0400489_00529 | Ga0400489_00529_538_1332 | 245 |
| 186 | 3300039110 | Ga0400487_06944 | Ga0400487_06944_11851_12645 | 245 |
| 187 | 3300039110 | Ga0400487_22271 | Ga0400487_22271_916_1713 | 245 |
| 188 | 3300039437 | Ga0436365_0212978 | Ga0436365_0212978_1478_2281 | 245 |
| 189 | 3300044658 | Ga0466972_0001381 | Ga0466972_0001381_2907_3716 | 245 |
| 190 | 3300046462 | Ga0495651_0174114 | Ga0495651_0174114_695_1471 | 245 |
| 191 | 3300048905 | Ga0496102_0175669 | Ga0496102_0175669_1092_1868 | 245 |
| 192 | 3300048927 | Ga0496124_0000741 | Ga0496124_0000741_33338_34108 | 245 |
| 193 | 3300048928 | Ga0496125_0086256 | Ga0496125_0086256_1365_2135 | 245 |
| 194 | 3300048929 | Ga0496126_0000418 | Ga0496126_0000418_18747_19517 | 245 |
| 195 | 3300049572 | Ga0501036_0133139 | Ga0501036_0133139_1195_1995 | 245 |
| 196 | 3300049574 | Ga0501038_0099275 | Ga0501038_0099275_947_1747 | 245 |
| 197 | 3300049580 | Ga0501046_0073211 | Ga0501046_0073211_375_1175 | 245 |
| 198 | 3300049583 | Ga0501067_0014017 | Ga0501067_0014017_2916_3716 | 245 |
| 199 | 3300049583 | Ga0501067_0111553 | Ga0501067_0111553_254_1054 | 245 |
| 200 | 3300049584 | Ga0501068_0060285 | Ga0501068_0060285_878_1678 | 245 |
| 201 | 3300049586 | Ga0501070_0394805 | Ga0501070_0394805_292_1092 | 245 |
| 202 | 3300049589 | Ga0501073_0032382 | Ga0501073_0032382_305_1105 | 245 |
| 203 | 3300049742 | Ga0501080_0006549 | Ga0501080_0006549_3962_4762 | 245 |
| 204 | 3300049742 | Ga0501080_0079992 | Ga0501080_0079992_1301_2101 | 245 |
| 205 | 3300049744 | Ga0501083_0005967 | Ga0501083_0005967_6404_7204 | 245 |
| 206 | 3300050507 | nmdc:mga05p37_669460_c1 | nmdc:mga05p37_669460_c1_164_925 | 245 |
| 207 | 3300050509 | nmdc:mga0qj67_17827_c2 | nmdc:mga0qj67_17827_c2_1960_2727 | 245 |
| 208 | 3300050509 | nmdc:mga0qj67_27984_c1 | nmdc:mga0qj67_27984_c1_2471_3232 | 245 |
| 209 | 3300050510 | nmdc:mga06r32_1502_c1 | nmdc:mga06r32_1502_c1_12086_12847 | 245 |
| 210 | 3300050511 | nmdc:mga08y16_181087_c1 | nmdc:mga08y16_181087_c1_1129_1890 | 245 |
| 211 | 3300053086 | Ga0500578_0015335 | Ga0500578_0015335_3456_4247 | 245 |
| 212 | 3300053090 | Ga0500646_0012505 | Ga0500646_0012505_1216_2016 | 245 |
| 213 | 3300053119 | Ga0500595_007283 | Ga0500595_007283_55_846 | 245 |
| 214 | 3300053130 | Ga0500642_0111052 | Ga0500642_0111052_53_853 | 245 |
| 215 | 3300053151 | Ga0500604_0001711 | Ga0500604_0001711_2166_2966 | 245 |
| 216 | 3300053731 | Ga0500609_001646 | Ga0500609_001646_1929_2729 | 245 |
| 217 | 3300053731 | Ga0500609_017868 | Ga0500609_017868_153_932 | 245 |
| 218 | 3300053736 | Ga0500599_006284 | Ga0500599_006284_376_1176 | 245 |
| 219 | 3300054114 | Ga0501084_0491750 | Ga0501084_0491750_60_860 | 245 |
| 220 | 3300060353 | Ga0501082_0013701 | Ga0501082_0013701_4393_5193 | 245 |
| 221 | iso_pu_bacteria | 2643221629 | 2644169580 | 245 |
| 222 | iso_pu_bacteria | 2734482000 | 2734970072 | 245 |
| 223 | 3300003203 | JGI25406J46586_10011982 | JGI25406J46586_100119822 | 246 |
| 224 | 3300005340 | Ga0070689_100496854 | Ga0070689_1004968541 | 246 |
| 225 | 3300005366 | Ga0070659_100086128 | Ga0070659_1000861282 | 246 |
| 226 | 3300005367 | Ga0070667_100378556 | Ga0070667_1003785562 | 246 |
| 227 | 3300005367 | Ga0070667_100594843 | Ga0070667_1005948432 | 246 |
| 228 | 3300005441 | Ga0070700_100238249 | Ga0070700_1002382492 | 246 |
| 229 | 3300005455 | Ga0070663_100527956 | Ga0070663_1005279561 | 246 |
| 230 | 3300005467 | Ga0070706_100839208 | Ga0070706_1008392081 | 246 |
| 231 | 3300005471 | Ga0070698_100011204 | Ga0070698_1000112046 | 246 |
| 232 | 3300005539 | Ga0068853_100059884 | Ga0068853_1000598841 | 246 |
| 233 | 3300005548 | Ga0070665_100572778 | Ga0070665_1005727782 | 246 |
| 234 | 3300005563 | Ga0068855_100579021 | Ga0068855_1005790212 | 246 |
| 235 | 3300005564 | Ga0070664_100163306 | Ga0070664_1001633061 | 246 |
| 236 | 3300005617 | Ga0068859_100231883 | Ga0068859_1002318833 | 246 |
| 237 | 3300005617 | Ga0068859_100267153 | Ga0068859_1002671532 | 246 |
| 238 | 3300005843 | Ga0068860_100387526 | Ga0068860_1003875262 | 246 |
| 239 | 3300005843 | Ga0068860_100489645 | Ga0068860_1004896452 | 246 |
| 240 | 3300005844 | Ga0068862_100113799 | Ga0068862_1001137993 | 246 |
| 241 | 3300005983 | Ga0081540_1015586 | Ga0081540_10155863 | 246 |
| 242 | 3300005985 | Ga0081539_10000625 | Ga0081539_1000062522 | 246 |
| 243 | 3300006186 | Ga0075369_10019363 | Ga0075369_100193632 | 246 |
| 244 | 3300006881 | Ga0068865_100410742 | Ga0068865_1004107422 | 246 |
| 245 | 3300006931 | Ga0097620_100231886 | Ga0097620_1002318863 | 246 |
| 246 | 3300006931 | Ga0097620_100267147 | Ga0097620_1002671472 | 246 |
| 247 | 3300009094 | Ga0111539_10069633 | Ga0111539_100696334 | 246 |
| 248 | 3300009094 | Ga0111539_10305644 | Ga0111539_103056442 | 246 |
| 249 | 3300009148 | Ga0105243_10174335 | Ga0105243_101743352 | 246 |
| 250 | 3300009545 | Ga0105237_10111977 | Ga0105237_101119773 | 246 |
| 251 | 3300009551 | Ga0105238_10872705 | Ga0105238_108727051 | 246 |
| 252 | 3300009553 | Ga0105249_10437986 | Ga0105249_104379862 | 246 |
| 253 | 3300010375 | Ga0105239_10198574 | Ga0105239_101985742 | 246 |
| 254 | 3300011119 | Ga0105246_10384664 | Ga0105246_103846642 | 246 |
| 255 | 3300013102 | Ga0157371_10324675 | Ga0157371_103246752 | 246 |
| 256 | 3300013297 | Ga0157378_10091360 | Ga0157378_100913604 | 246 |
| 257 | 3300013307 | Ga0157372_10498852 | Ga0157372_104988522 | 246 |
| 258 | 3300013308 | Ga0157375_10429746 | Ga0157375_104297462 | 246 |
| 259 | 3300014325 | Ga0163163_10085665 | Ga0163163_100856653 | 246 |
| 260 | 3300017792 | Ga0163161_10179140 | Ga0163161_101791403 | 246 |
| 261 | 3300021388 | Ga0213875_10000999 | Ga0213875_1000099916 | 246 |
| 262 | 3300025900 | Ga0207710_10103502 | Ga0207710_101035022 | 246 |
| 263 | 3300025910 | Ga0207684_10261286 | Ga0207684_102612863 | 246 |
| 264 | 3300025925 | Ga0207650_10473936 | Ga0207650_104739361 | 246 |
| 265 | 3300025972 | Ga0207668_10005051 | Ga0207668_100050517 | 246 |
| 266 | 3300026075 | Ga0207708_10205872 | Ga0207708_102058722 | 246 |
| 267 | 3300026121 | Ga0207683_10218524 | Ga0207683_102185242 | 246 |
| 268 | 3300027665 | Ga0209983_1055110 | Ga0209983_10551101 | 246 |
| 269 | 3300028379 | Ga0268266_10220387 | Ga0268266_102203872 | 246 |
| 270 | 3300028380 | Ga0268265_10040511 | Ga0268265_100405114 | 246 |
| 271 | 3300028380 | Ga0268265_10283063 | Ga0268265_102830632 | 246 |
| 272 | 3300028794 | Ga0307515_10068670 | Ga0307515_100686702 | 246 |
| 273 | 3300030521 | Ga0307511_10000018 | Ga0307511_1000001882 | 246 |
| 274 | 3300031456 | Ga0307513_10006535 | Ga0307513_100065358 | 246 |
| 275 | 3300031507 | Ga0307509_10019257 | Ga0307509_100192575 | 246 |
| 276 | 3300031507 | Ga0307509_10517374 | Ga0307509_105173741 | 246 |
| 277 | 3300031616 | Ga0307508_10032834 | Ga0307508_100328342 | 246 |
| 278 | 3300031727 | Ga0316576_10285238 | Ga0316576_102852382 | 246 |
| 279 | 3300031730 | Ga0307516_10170528 | Ga0307516_101705282 | 246 |
| 280 | 3300031733 | Ga0316577_10001658 | Ga0316577_1000165811 | 246 |
| 281 | 3300031901 | Ga0307406_10060053 | Ga0307406_100600532 | 246 |
| 282 | 3300031911 | Ga0307412_10728069 | Ga0307412_107280691 | 246 |
| 283 | 3300031995 | Ga0307409_100041508 | Ga0307409_1000415082 | 246 |
| 284 | 3300031995 | Ga0307409_100154556 | Ga0307409_1001545561 | 246 |
| 285 | 3300032002 | Ga0307416_100176676 | Ga0307416_1001766762 | 246 |
| 286 | 3300032126 | Ga0307415_100022456 | Ga0307415_1000224563 | 246 |
| 287 | 3300032126 | Ga0307415_100276505 | Ga0307415_1002765052 | 246 |
| 288 | 3300033179 | Ga0307507_10034587 | Ga0307507_100345872 | 246 |
| 289 | 3300033180 | Ga0307510_10073095 | Ga0307510_100730954 | 246 |
| 290 | 3300034818 | Ga0373950_0009114 | Ga0373950_0009114_235_1032 | 246 |
| 291 | 3300035112 | Ga0373932_0067724 | Ga0373932_0067724_87_884 | 246 |
| 292 | 3300035242 | Ga0373962_0004433 | Ga0373962_0004433_2071_2868 | 246 |
| 293 | 3300036712 | Ga0316584_0111828 | Ga0316584_0111828_671_1504 | 246 |
| 294 | 3300037312 | Ga0395899_0009166 | Ga0395899_0009166_2797_3585 | 246 |
| 295 | 3300037418 | Ga0395900_0002343 | Ga0395900_0002343_3261_4049 | 246 |
| 296 | 3300037466 | Ga0395898_0001662 | Ga0395898_0001662_3756_4544 | 246 |
| 297 | 3300037466 | Ga0395898_0005170 | Ga0395898_0005170_1961_2740 | 246 |
| 298 | 3300037471 | Ga0395905_0003552 | Ga0395905_0003552_3960_4748 | 246 |
| 299 | 3300037853 | Ga0436364_0440359 | Ga0436364_0440359_1885_2679 | 246 |
| 300 | 3300038443 | Ga0395901_0001195 | Ga0395901_0001195_22777_23556 | 246 |
| 301 | 3300038443 | Ga0395901_0034366 | Ga0395901_0034366_3897_4685 | 246 |
| 302 | 3300038726 | Ga0400490_19280 | Ga0400490_19280_1351_2175 | 246 |
| 303 | 3300038726 | Ga0400490_32168 | Ga0400490_32168_153_977 | 246 |
| 304 | 3300038726 | Ga0400490_50315 | Ga0400490_50315_1743_2558 | 246 |
| 305 | 3300038741 | Ga0400488_13961 | Ga0400488_13961_13108_13947 | 246 |
| 306 | 3300038741 | Ga0400488_55735 | Ga0400488_55735_780_1598 | 246 |
| 307 | 3300039062 | Ga0400483_056450 | Ga0400483_056450_1677_2495 | 246 |
| 308 | 3300039062 | Ga0400483_157671 | Ga0400483_157671_8371_9189 | 246 |
| 309 | 3300039093 | Ga0400489_03098 | Ga0400489_03098_8282_9121 | 246 |
| 310 | 3300039437 | Ga0436365_1884481 | Ga0436365_1884481_27_797 | 246 |
| 311 | 3300042007 | Ga0439449_0003455 | Ga0439449_0003455_4425_5213 | 246 |
| 312 | 3300044656 | Ga0466969_0004693 | Ga0466969_0004693_6326_7156 | 246 |
| 313 | 3300044684 | Ga0466966_0002186 | Ga0466966_0002186_10467_11297 | 246 |
| 314 | 3300044693 | Ga0466961_0239846 | Ga0466961_0239846_120_950 | 246 |
| 315 | 3300045049 | Ga0466959_0031539 | Ga0466959_0031539_2963_3793 | 246 |
| 316 | 3300048911 | Ga0496108_0000136 | Ga0496108_0000136_43974_44765 | 246 |
| 317 | 3300049570 | Ga0501033_0411059 | Ga0501033_0411059_137_919 | 246 |
| 318 | 3300049571 | Ga0501034_0775769 | Ga0501034_0775769_58_840 | 246 |
| 319 | 3300049581 | Ga0501047_0227897 | Ga0501047_0227897_560_1342 | 246 |
| 320 | 3300049823 | Ga0501044_0262827 | Ga0501044_0262827_869_1651 | 246 |
| 321 | 3300053153 | Ga0500616_0046551 | Ga0500616_0046551_847_1629 | 246 |
| 322 | 3300061719 | Ga0466962_0054728 | Ga0466962_0054728_85_915 | 246 |
| 323 | iso_pu_bacteria | 2582581316 | 2585336376 | 246 |
| 324 | iso_pu_bacteria | 2687453743 | 2689996557 | 246 |
| 325 | iso_pu_bacteria | 2891373044 | 2891375423 | 246 |
| 326 | iso_pu_bacteria | 2898795034 | 2898795788 | 246 |
| 327 | iso_pu_bacteria | 2909042592 | 2909044963 | 246 |
| 328 | 3300005338 | Ga0068868_100586973 | Ga0068868_1005869731 | 247 |
| 329 | 3300005340 | Ga0070689_100204427 | Ga0070689_1002044272 | 247 |
| 330 | 3300005437 | Ga0070710_10252708 | Ga0070710_102527081 | 247 |
| 331 | 3300005455 | Ga0070663_100281654 | Ga0070663_1002816541 | 247 |
| 332 | 3300005937 | Ga0081455_10104029 | Ga0081455_101040292 | 247 |
| 333 | 3300005985 | Ga0081539_10000126 | Ga0081539_100001266 | 247 |
| 334 | 3300006846 | Ga0075430_100226671 | Ga0075430_1002266712 | 247 |
| 335 | 3300009093 | Ga0105240_10108889 | Ga0105240_101088892 | 247 |
| 336 | 3300009553 | Ga0105249_10105939 | Ga0105249_101059393 | 247 |
| 337 | 3300013296 | Ga0157374_10032892 | Ga0157374_100328924 | 247 |
| 338 | 3300021377 | Ga0213874_10024230 | Ga0213874_100242302 | 247 |
| 339 | 3300025294 | Ga0209025_1096319 | Ga0209025_10963191 | 247 |
| 340 | 3300025899 | Ga0207642_10228734 | Ga0207642_102287342 | 247 |
| 341 | 3300028786 | Ga0307517_10138535 | Ga0307517_101385353 | 247 |
| 342 | 3300028800 | Ga0265338_10182629 | Ga0265338_101826292 | 247 |
| 343 | 3300031241 | Ga0265325_10035191 | Ga0265325_100351913 | 247 |
| 344 | 3300031247 | Ga0265340_10000264 | Ga0265340_100002645 | 247 |
| 345 | 3300031249 | Ga0265339_10014693 | Ga0265339_100146937 | 247 |
| 346 | 3300031344 | Ga0265316_10009686 | Ga0265316_100096866 | 247 |
| 347 | 3300031548 | Ga0307408_100616705 | Ga0307408_1006167052 | 247 |
| 348 | 3300031595 | Ga0265313_10006384 | Ga0265313_100063847 | 247 |
| 349 | 3300031712 | Ga0265342_10007507 | Ga0265342_100075077 | 247 |
| 350 | 3300031730 | Ga0307516_10118217 | Ga0307516_101182173 | 247 |
| 351 | 3300031903 | Ga0307407_10030825 | Ga0307407_100308252 | 247 |
| 352 | 3300031995 | Ga0307409_100333330 | Ga0307409_1003333301 | 247 |
| 353 | 3300032005 | Ga0307411_10204669 | Ga0307411_102046692 | 247 |
| 354 | 3300037068 | Ga0373925_0072324 | Ga0373925_0072324_155_976 | 247 |
| 355 | 3300038741 | Ga0400488_44356 | Ga0400488_44356_759_1562 | 247 |
| 356 | 3300039447 | Ga0436361_0218515 | Ga0436361_0218515_1057_1821 | 247 |
| 357 | 3300039447 | Ga0436361_0410902 | Ga0436361_0410902_185_1012 | 247 |
| 358 | 3300042001 | Ga0439441_044549 | Ga0439441_044549_80_886 | 247 |
| 359 | 3300042461 | Ga0439460_0031821 | Ga0439460_0031821_92_898 | 247 |
| 360 | 3300044765 | Ga0466970_0123530 | Ga0466970_0123530_268_1077 | 247 |
| 361 | 3300045836 | Ga0466958_0155968 | Ga0466958_0155968_237_1037 | 247 |
| 362 | 3300046462 | Ga0495651_0023410 | Ga0495651_0023410_860_1681 | 247 |
| 363 | 3300046516 | Ga0495628_0268589 | Ga0495628_0268589_246_1067 | 247 |
| 364 | 3300048911 | Ga0496108_0074415 | Ga0496108_0074415_1132_1938 | 247 |
| 365 | 3300048912 | Ga0496109_0042582 | Ga0496109_0042582_1554_2360 | 247 |
| 366 | 3300049589 | Ga0501073_0122210 | Ga0501073_0122210_232_1041 | 247 |
| 367 | 3300049742 | Ga0501080_0031148 | Ga0501080_0031148_2029_2838 | 247 |
| 368 | 3300050508 | nmdc:mga09592_120498_c1 | nmdc:mga09592_120498_c1_256_1050 | 247 |
| 369 | 3300053096 | Ga0500641_0007723 | Ga0500641_0007723_218_1033 | 247 |
| 370 | 3300053153 | Ga0500616_0001651 | Ga0500616_0001651_7566_8381 | 247 |
| 371 | 3300053177 | Ga0500636_0046727 | Ga0500636_0046727_816_1622 | 247 |
| 372 | 3300060353 | Ga0501082_0103648 | Ga0501082_0103648_1450_2259 | 247 |
| 373 | iso_pu_bacteria | 2643221616 | 2644094651 | 247 |
| 374 | iso_pu_bacteria | 2939669807 | 2939673097 | 247 |
| 375 | iso_pu_bacteria | 2952252522 | 2952253759 | 247 |
| 376 | iso_pu_bacteria | 8002745576 | 8002748099 | 247 |
| 377 | 3300003322 | rootL2_10093034 | rootL2_100930343 | 248 |
| 378 | 3300005327 | Ga0070658_10095230 | Ga0070658_100952302 | 248 |
| 379 | 3300005328 | Ga0070676_10048599 | Ga0070676_100485991 | 248 |
| 380 | 3300005329 | Ga0070683_100248793 | Ga0070683_1002487931 | 248 |
| 381 | 3300005331 | Ga0070670_100123458 | Ga0070670_1001234582 | 248 |
| 382 | 3300005334 | Ga0068869_100031209 | Ga0068869_1000312092 | 248 |
| 383 | 3300005335 | Ga0070666_10085138 | Ga0070666_100851382 | 248 |
| 384 | 3300005336 | Ga0070680_100692360 | Ga0070680_1006923601 | 248 |
| 385 | 3300005337 | Ga0070682_100040905 | Ga0070682_1000409053 | 248 |
| 386 | 3300005338 | Ga0068868_100048881 | Ga0068868_1000488812 | 248 |
| 387 | 3300005343 | Ga0070687_100030182 | Ga0070687_1000301822 | 248 |
| 388 | 3300005344 | Ga0070661_100151960 | Ga0070661_1001519602 | 248 |
| 389 | 3300005347 | Ga0070668_100167162 | Ga0070668_1001671622 | 248 |
| 390 | 3300005353 | Ga0070669_100089154 | Ga0070669_1000891542 | 248 |
| 391 | 3300005354 | Ga0070675_100247393 | Ga0070675_1002473932 | 248 |
| 392 | 3300005356 | Ga0070674_100146594 | Ga0070674_1001465942 | 248 |
| 393 | 3300005365 | Ga0070688_100077791 | Ga0070688_1000777911 | 248 |
| 394 | 3300005366 | Ga0070659_100039485 | Ga0070659_1000394853 | 248 |
| 395 | 3300005436 | Ga0070713_100070980 | Ga0070713_1000709802 | 248 |
| 396 | 3300005441 | Ga0070700_100021826 | Ga0070700_1000218262 | 248 |
| 397 | 3300005457 | Ga0070662_100214147 | Ga0070662_1002141472 | 248 |
| 398 | 3300005466 | Ga0070685_10119841 | Ga0070685_101198412 | 248 |
| 399 | 3300005544 | Ga0070686_100276959 | Ga0070686_1002769591 | 248 |
| 400 | 3300005614 | Ga0068856_100405504 | Ga0068856_1004055042 | 248 |
| 401 | 3300005615 | Ga0070702_100035313 | Ga0070702_1000353132 | 248 |
| 402 | 3300005617 | Ga0068859_100050436 | Ga0068859_1000504362 | 248 |
| 403 | 3300005617 | Ga0068859_100381962 | Ga0068859_1003819622 | 248 |
| 404 | 3300005718 | Ga0068866_10144317 | Ga0068866_101443172 | 248 |
| 405 | 3300005834 | Ga0068851_10148789 | Ga0068851_101487892 | 248 |
| 406 | 3300005844 | Ga0068862_100057284 | Ga0068862_1000572842 | 248 |
| 407 | 3300005983 | Ga0081540_1119509 | Ga0081540_11195092 | 248 |
| 408 | 3300005985 | Ga0081539_10000637 | Ga0081539_1000063712 | 248 |
| 409 | 3300005985 | Ga0081539_10003444 | Ga0081539_100034444 | 248 |
| 410 | 3300005985 | Ga0081539_10005772 | Ga0081539_1000577210 | 248 |
| 411 | 3300005985 | Ga0081539_10011727 | Ga0081539_100117275 | 248 |
| 412 | 3300005985 | Ga0081539_10017034 | Ga0081539_100170345 | 248 |
| 413 | 3300006173 | Ga0070716_100004860 | Ga0070716_1000048606 | 248 |
| 414 | 3300006195 | Ga0075366_10231959 | Ga0075366_102319592 | 248 |
| 415 | 3300006358 | Ga0068871_100113946 | Ga0068871_1001139462 | 248 |
| 416 | 3300006881 | Ga0068865_100019996 | Ga0068865_1000199962 | 248 |
| 417 | 3300006931 | Ga0097620_100050436 | Ga0097620_1000504362 | 248 |
| 418 | 3300006946 | Ga0079104_1003546 | Ga0079104_10035464 | 248 |
| 419 | 3300006948 | Ga0099826_10009641 | Ga0099826_100096414 | 248 |
| 420 | 3300009147 | Ga0114129_10647522 | Ga0114129_106475222 | 248 |
| 421 | 3300009174 | Ga0105241_10050487 | Ga0105241_100504872 | 248 |
| 422 | 3300009176 | Ga0105242_10224843 | Ga0105242_102248432 | 248 |
| 423 | 3300009553 | Ga0105249_10124621 | Ga0105249_101246212 | 248 |
| 424 | 3300009979 | Ga0105032_104024 | Ga0105032_1040242 | 248 |
| 425 | 3300010375 | Ga0105239_10591175 | Ga0105239_105911752 | 248 |
| 426 | 3300011119 | Ga0105246_10125784 | Ga0105246_101257842 | 248 |
| 427 | 3300013105 | Ga0157369_10169849 | Ga0157369_101698491 | 248 |
| 428 | 3300013105 | Ga0157369_10476009 | Ga0157369_104760092 | 248 |
| 429 | 3300013296 | Ga0157374_10159632 | Ga0157374_101596323 | 248 |
| 430 | 3300013297 | Ga0157378_10141186 | Ga0157378_101411861 | 248 |
| 431 | 3300013306 | Ga0163162_10255599 | Ga0163162_102555992 | 248 |
| 432 | 3300013307 | Ga0157372_10369368 | Ga0157372_103693682 | 248 |
| 433 | 3300013308 | Ga0157375_10278171 | Ga0157375_102781712 | 248 |
| 434 | 3300014745 | Ga0157377_10090477 | Ga0157377_100904771 | 248 |
| 435 | 3300014968 | Ga0157379_10098680 | Ga0157379_100986803 | 248 |
| 436 | 3300014969 | Ga0157376_10072154 | Ga0157376_100721543 | 248 |
| 437 | 3300014969 | Ga0157376_10163440 | Ga0157376_101634402 | 248 |
| 438 | 3300022467 | Ga0224712_10068507 | Ga0224712_100685072 | 248 |
| 439 | 3300022739 | Ga0228711_1010705 | Ga0228711_10107054 | 248 |
| 440 | 3300022740 | Ga0228710_1004002 | Ga0228710_100400210 | 248 |
| 441 | 3300025321 | Ga0207656_10123726 | Ga0207656_101237262 | 248 |
| 442 | 3300025899 | Ga0207642_10031982 | Ga0207642_100319822 | 248 |
| 443 | 3300025901 | Ga0207688_10053057 | Ga0207688_100530572 | 248 |
| 444 | 3300025901 | Ga0207688_10065102 | Ga0207688_100651021 | 248 |
| 445 | 3300025904 | Ga0207647_10120478 | Ga0207647_101204782 | 248 |
| 446 | 3300025907 | Ga0207645_10167248 | Ga0207645_101672482 | 248 |
| 447 | 3300025908 | Ga0207643_10030850 | Ga0207643_100308502 | 248 |
| 448 | 3300025918 | Ga0207662_10010208 | Ga0207662_100102084 | 248 |
| 449 | 3300025918 | Ga0207662_10125744 | Ga0207662_101257442 | 248 |
| 450 | 3300025919 | Ga0207657_10190637 | Ga0207657_101906372 | 248 |
| 451 | 3300025923 | Ga0207681_10124747 | Ga0207681_101247472 | 248 |
| 452 | 3300025927 | Ga0207687_10051809 | Ga0207687_100518093 | 248 |
| 453 | 3300025933 | Ga0207706_10162215 | Ga0207706_101622152 | 248 |
| 454 | 3300025936 | Ga0207670_10091523 | Ga0207670_100915232 | 248 |
| 455 | 3300025941 | Ga0207711_10481852 | Ga0207711_104818522 | 248 |
| 456 | 3300025942 | Ga0207689_10080230 | Ga0207689_100802302 | 248 |
| 457 | 3300025961 | Ga0207712_10007694 | Ga0207712_100076945 | 248 |
| 458 | 3300025972 | Ga0207668_10184120 | Ga0207668_101841203 | 248 |
| 459 | 3300025981 | Ga0207640_10138137 | Ga0207640_101381372 | 248 |
| 460 | 3300025986 | Ga0207658_10077762 | Ga0207658_100777622 | 248 |
| 461 | 3300026075 | Ga0207708_10012373 | Ga0207708_100123733 | 248 |
| 462 | 3300026088 | Ga0207641_10278060 | Ga0207641_102780602 | 248 |
| 463 | 3300026095 | Ga0207676_10077355 | Ga0207676_100773553 | 248 |
| 464 | 3300026116 | Ga0207674_10054248 | Ga0207674_100542484 | 248 |
| 465 | 3300026142 | Ga0207698_10146122 | Ga0207698_101461222 | 248 |
| 466 | 3300027111 | Ga0209281_1002478 | Ga0209281_10024784 | 248 |
| 467 | 3300027666 | Ga0209282_1006327 | Ga0209282_10063274 | 248 |
| 468 | 3300028379 | Ga0268266_10072249 | Ga0268266_100722492 | 248 |
| 469 | 3300028381 | Ga0268264_10517697 | Ga0268264_105176972 | 248 |
| 470 | 3300028786 | Ga0307517_10091100 | Ga0307517_100911002 | 248 |
| 471 | 3300028794 | Ga0307515_10004370 | Ga0307515_1000437021 | 248 |
| 472 | 3300028794 | Ga0307515_10072941 | Ga0307515_100729414 | 248 |
| 473 | 3300028794 | Ga0307515_10177356 | Ga0307515_101773561 | 248 |
| 474 | 3300030522 | Ga0307512_10025405 | Ga0307512_100254055 | 248 |
| 475 | 3300030522 | Ga0307512_10048766 | Ga0307512_100487662 | 248 |
| 476 | 3300030522 | Ga0307512_10080563 | Ga0307512_100805631 | 248 |
| 477 | 3300031247 | Ga0265340_10001252 | Ga0265340_100012523 | 248 |
| 478 | 3300031456 | Ga0307513_10034606 | Ga0307513_100346064 | 248 |
| 479 | 3300031456 | Ga0307513_10078136 | Ga0307513_100781362 | 248 |
| 480 | 3300031730 | Ga0307516_10001110 | Ga0307516_1000111031 | 248 |
| 481 | 3300031730 | Ga0307516_10062844 | Ga0307516_100628442 | 248 |
| 482 | 3300031730 | Ga0307516_10092896 | Ga0307516_100928962 | 248 |
| 483 | 3300031852 | Ga0307410_10027433 | Ga0307410_100274333 | 248 |
| 484 | 3300031852 | Ga0307410_10032173 | Ga0307410_100321735 | 248 |
| 485 | 3300031901 | Ga0307406_10444874 | Ga0307406_104448742 | 248 |
| 486 | 3300031967 | Ga0315914_1006088 | Ga0315914_10060884 | 248 |
| 487 | 3300031995 | Ga0307409_100054873 | Ga0307409_1000548732 | 248 |
| 488 | 3300031995 | Ga0307409_100059667 | Ga0307409_1000596672 | 248 |
| 489 | 3300031995 | Ga0307409_100125537 | Ga0307409_1001255372 | 248 |
| 490 | 3300031995 | Ga0307409_100653347 | Ga0307409_1006533472 | 248 |
| 491 | 3300032002 | Ga0307416_100065503 | Ga0307416_1000655033 | 248 |
| 492 | 3300032002 | Ga0307416_100070045 | Ga0307416_1000700452 | 248 |
| 493 | 3300032005 | Ga0307411_10134806 | Ga0307411_101348062 | 248 |
| 494 | 3300032126 | Ga0307415_100025086 | Ga0307415_1000250863 | 248 |
| 495 | 3300033430 | Ga0315913_1009766 | Ga0315913_10097667 | 248 |
| 496 | 3300033464 | Ga0315915_1013567 | Ga0315915_10135674 | 248 |
| 497 | 3300035091 | Ga0373951_0000019 | Ga0373951_0000019_19386_20168 | 248 |
| 498 | 3300035691 | Ga0373931_0223046 | Ga0373931_0223046_198_1007 | 248 |
| 499 | 3300037471 | Ga0395905_0328424 | Ga0395905_0328424_181_942 | 248 |
| 500 | 3300038443 | Ga0395901_0206282 | Ga0395901_0206282_983_1834 | 248 |
| 501 | 3300041404 | Ga0439436_0031243 | Ga0439436_0031243_195_995 | 248 |
| 502 | 3300041494 | Ga0451837_0235358 | Ga0451837_0235358_308_1114 | 248 |
| 503 | 3300042016 | Ga0439463_040161 | Ga0439463_040161_88_903 | 248 |
| 504 | 3300046471 | Ga0495650_0056498 | Ga0495650_0056498_506_1342 | 248 |
| 505 | 3300048907 | Ga0496104_0429500 | Ga0496104_0429500_240_1040 | 248 |
| 506 | 3300048913 | Ga0496110_0050865 | Ga0496110_0050865_1185_2021 | 248 |
| 507 | 3300048913 | Ga0496110_0185520 | Ga0496110_0185520_905_1714 | 248 |
| 508 | 3300048915 | Ga0496112_0745756 | Ga0496112_0745756_37_873 | 248 |
| 509 | 3300048916 | Ga0496113_0340715 | Ga0496113_0340715_253_1086 | 248 |
| 510 | 3300049128 | Ga0501308_000288 | Ga0501308_000288_2053_2847 | 248 |
| 511 | 3300049524 | Ga0501301_004766 | Ga0501301_004766_57_851 | 248 |
| 512 | 3300050507 | nmdc:mga05p37_611325_c1 | nmdc:mga05p37_611325_c1_140_958 | 248 |
| 513 | 3300050507 | nmdc:mga05p37_70192_c1 | nmdc:mga05p37_70192_c1_1348_2148 | 248 |
| 514 | 3300050511 | nmdc:mga08y16_278294_c1 | nmdc:mga08y16_278294_c1_110_907 | 248 |
| 515 | 3300053086 | Ga0500578_0000683 | Ga0500578_0000683_35365_36153 | 248 |
| 516 | 3300053088 | Ga0500644_0007215 | Ga0500644_0007215_574_1380 | 248 |
| 517 | 3300053088 | Ga0500644_0115506 | Ga0500644_0115506_87_869 | 248 |
| 518 | 3300053093 | Ga0500651_0028674 | Ga0500651_0028674_1067_1873 | 248 |
| 519 | 3300053096 | Ga0500641_0013554 | Ga0500641_0013554_1594_2400 | 248 |
| 520 | 3300053108 | Ga0500562_023520 | Ga0500562_023520_744_1550 | 248 |
| 521 | 3300053131 | Ga0500652_014571 | Ga0500652_014571_315_1121 | 248 |
| 522 | 3300053153 | Ga0500616_0001922 | Ga0500616_0001922_8653_9489 | 248 |
| 523 | 3300059642 | Ga0587069_019247 | Ga0587069_019247_14_829 | 248 |
| 524 | iso_pu_bacteria | 2512047086 | 2512529795 | 248 |
| 525 | iso_pu_bacteria | 2512875026 | 2512969962 | 248 |
| 526 | iso_pu_bacteria | 2513237089 | 2513602566 | 248 |
| 527 | iso_pu_bacteria | 2513237160 | 2514005677 | 248 |
| 528 | iso_pu_bacteria | 2643221689 | 2644498238 | 248 |
| 529 | iso_pu_bacteria | 2802428858 | 2802716387 | 248 |
| 530 | iso_pu_bacteria | 2802428859 | 2802722575 | 248 |
| 531 | iso_pu_bacteria | 2802428860 | 2802729283 | 248 |
| 532 | iso_pu_bacteria | 2802428861 | 2802735675 | 248 |
| 533 | iso_pu_bacteria | 2802428862 | 2802741750 | 248 |
| 534 | iso_pu_bacteria | 2816332139 | 2816505474 | 248 |
| 535 | iso_pu_bacteria | 2915980308 | 2915984645 | 248 |
| 536 | iso_pu_bacteria | 2937029754 | 2937030830 | 248 |
| 537 | iso_pu_bacteria | 2937036028 | 2937041795 | 248 |
| 538 | iso_pu_bacteria | 2937078374 | 2937080951 | 248 |
| 539 | iso_pu_bacteria | 2937084907 | 2937085100 | 248 |
| 540 | iso_pu_bacteria | 2960680706 | 2960682849 | 248 |
| 541 | iso_pu_bacteria | 2960693952 | 2960696084 | 248 |
| 542 | iso_pu_bacteria | 2967686174 | 2967686841 | 248 |
| 543 | iso_pu_bacteria | 2967728569 | 2967731575 | 248 |
| 544 | iso_pu_bacteria | 2970122695 | 2970126844 | 248 |
| 545 | iso_pu_bacteria | 2970143518 | 2970148234 | 248 |
| 546 | iso_pu_bacteria | 2977530762 | 2977532948 | 248 |
| 547 | iso_pu_bacteria | 2977544691 | 2977548402 | 248 |
| 548 | iso_pu_bacteria | 8003999396 | 8004003636 | 248 |
| 549 | 3300003187 | JGI25151J46595_10019898 | JGI25151J46595_100198982 | 249 |
| 550 | 3300005471 | Ga0070698_100003844 | Ga0070698_1000038446 | 249 |
| 551 | 3300005983 | Ga0081540_1109767 | Ga0081540_11097672 | 249 |
| 552 | 3300025294 | Ga0209025_1000148 | Ga0209025_1000148121 | 249 |
| 553 | 3300031824 | Ga0307413_10092983 | Ga0307413_100929832 | 249 |
| 554 | 3300031852 | Ga0307410_10013090 | Ga0307410_100130905 | 249 |
| 555 | 3300031995 | Ga0307409_100140161 | Ga0307409_1001401612 | 249 |
| 556 | 3300032002 | Ga0307416_100017610 | Ga0307416_1000176105 | 249 |
| 557 | 3300032126 | Ga0307415_100002826 | Ga0307415_1000028263 | 249 |
| 558 | 3300039447 | Ga0436361_0302978 | Ga0436361_0302978_276_1103 | 249 |
| 559 | 3300045051 | Ga0451576_0011765 | Ga0451576_0011765_3501_4307 | 249 |
| 560 | 3300048920 | Ga0496117_0000912 | Ga0496117_0000912_6699_7493 | 249 |
| 561 | 3300048925 | Ga0496122_0000364 | Ga0496122_0000364_83275_84069 | 249 |
| 562 | 3300048926 | Ga0496123_0000094 | Ga0496123_0000094_83275_84069 | 249 |
| 563 | 3300048928 | Ga0496125_0002252 | Ga0496125_0002252_6137_6931 | 249 |
| 564 | iso_pu_bacteria | 2891373044 | 2891375779 | 249 |
| 565 | 3300005333 | Ga0070677_10076918 | Ga0070677_100769181 | 250 |
| 566 | 3300005347 | Ga0070668_100274728 | Ga0070668_1002747282 | 250 |
| 567 | 3300005844 | Ga0068862_100458472 | Ga0068862_1004584721 | 250 |
| 568 | 3300014326 | Ga0157380_10133460 | Ga0157380_101334602 | 250 |
| 569 | 3300025918 | Ga0207662_10066514 | Ga0207662_100665141 | 250 |
| 570 | 3300026089 | Ga0207648_10361910 | Ga0207648_103619101 | 250 |
| 571 | 3300026118 | Ga0207675_100138020 | Ga0207675_1001380203 | 250 |
| 572 | 3300042007 | Ga0439449_0000640 | Ga0439449_0000640_3018_3845 | 250 |
| 573 | 3300048917 | Ga0496114_0085841 | Ga0496114_0085841_1379_2242 | 250 |
| 574 | 3300002739 | JGI25158J39367_1004679 | JGI25158J39367_10046793 | 251 |
| 575 | 3300003187 | JGI25151J46595_10001549 | JGI25151J46595_1000154910 | 251 |
| 576 | 3300003354 | JGI25160J50197_1000147 | JGI25160J50197_100014713 | 251 |
| 577 | 3300003374 | JGI25161J50226_1000675 | JGI25161J50226_10006752 | 251 |
| 578 | 3300003792 | Ga0055540_1011431 | Ga0055540_10114313 | 251 |
| 579 | 3300003794 | Ga0055531_10020939 | Ga0055531_100209392 | 251 |
| 580 | 3300004625 | Ga0055543_1000129 | Ga0055543_100012954 | 251 |
| 581 | 3300005262 | Ga0065165_1000477 | Ga0065165_100047713 | 251 |
| 582 | 3300006881 | Ga0068865_100535412 | Ga0068865_1005354121 | 251 |
| 583 | 3300009551 | Ga0105238_10372651 | Ga0105238_103726511 | 251 |
| 584 | 3300013296 | Ga0157374_10197379 | Ga0157374_101973791 | 251 |
| 585 | 3300025208 | Ga0209436_100321 | Ga0209436_10032111 | 251 |
| 586 | 3300025273 | Ga0209673_1048255 | Ga0209673_10482551 | 251 |
| 587 | 3300025284 | Ga0209130_1000234 | Ga0209130_100023451 | 251 |
| 588 | 3300025294 | Ga0209025_1001085 | Ga0209025_100108527 | 251 |
| 589 | 3300025302 | Ga0207426_1000410 | Ga0207426_100041051 | 251 |
| 590 | 3300025303 | Ga0209051_1000151 | Ga0209051_100015191 | 251 |
| 591 | 3300025304 | Ga0209257_1009307 | Ga0209257_10093074 | 251 |
| 592 | 3300025910 | Ga0207684_10391971 | Ga0207684_103919712 | 251 |
| 593 | 3300026075 | Ga0207708_10099757 | Ga0207708_100997572 | 251 |
| 594 | 3300026121 | Ga0207683_10552097 | Ga0207683_105520972 | 251 |
| 595 | 3300028794 | Ga0307515_10008974 | Ga0307515_100089745 | 251 |
| 596 | 3300028794 | Ga0307515_10065639 | Ga0307515_100656393 | 251 |
| 597 | 3300031456 | Ga0307513_10003112 | Ga0307513_1000311211 | 251 |
| 598 | 3300031456 | Ga0307513_10267271 | Ga0307513_102672711 | 251 |
| 599 | 3300046460 | Ga0495638_0015949 | Ga0495638_0015949_974_1729 | 251 |
| 600 | 3300046506 | Ga0495583_0000321 | Ga0495583_0000321_42549_43376 | 251 |
| 601 | 3300046512 | Ga0495610_0007440 | Ga0495610_0007440_3743_4570 | 251 |
| 602 | 3300048913 | Ga0496110_0241084 | Ga0496110_0241084_696_1577 | 251 |
| 603 | 3300049570 | Ga0501033_0236042 | Ga0501033_0236042_186_992 | 251 |
| 604 | 3300053177 | Ga0500636_0020970 | Ga0500636_0020970_1549_2409 | 251 |
| 605 | iso_pu_bacteria | 2582581316 | 2585331924 | 251 |
| 606 | iso_pu_bacteria | 2937822353 | 2937825518 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.886 | 9 | 235 |
| 2awo-assembly2.cif.gz_D | crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) | 0.8824 | 9 | 235 |
| 6z67-assembly3.cif.gz_E | ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution | 0.8817 | 7 | 234 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.8806 | 9 | 249 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.8786 | 7 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37388_2_240_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.945 | 7 | 248 | 3.40.50.300 |
| af_Q6BEX0_1_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9408 | 3 | 248 | 3.40.50.300 |
| af_P37388_2_240_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9374 | 7 | 248 | 3.40.50.300 |
| af_P77257_8_237_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9337 | 6 | 246 | 3.40.50.300 |
| af_P04983_1_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9256 | 7 | 248 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I7BYM0-F1-model_v4 | ABC transporter related protein | 0.9762 | 147 | 248 |
GO:0005524
GO:0016887 |
| AF-A0A2T0UCU5-F1-model_v4 | Monosaccharide ABC transporter ATP-binding protein (CUT2 family) | 0.9713 | 9 | 249 |
GO:0005524
GO:0016887 |
| AF-A0A099WJU8-F1-model_v4 | Heme ABC transporter ATP-binding protein | 0.9643 | 6 | 248 |
GO:0005524
GO:0016887 |
| AF-A0A3A9F3A8-F1-model_v4 | Sugar ABC transporter ATP-binding protein | 0.9641 | 4 | 248 |
GO:0005524
GO:0016887 |
| AF-A0A2N3FF34-F1-model_v4 | Sugar ABC transporter ATP-binding protein | 0.9604 | 1 | 248 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar