F468373

General Info

Members Datasets Scaffolds Average Seq Length
604 332 1208 130

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10929455|Ga0105242_109294551
Length 147
Sequence MPAEHTYDYAIIRVVPRVERGELINVGVILSCPEVDFLEARIEFDPSRLLALDPTLDVEATRGNLQTIPVVCRGGAAAGPIGQLPQRSRFHWLVSPRSTIIQFSPVHTGRTGDPAAALERLLDTMVRPVTPASQFAMPTVNGKEGHS

Samples

Sample ID Description Type Environment
1 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
147 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
148 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
165 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
194 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
195 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
229 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
265 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
285 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
286 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
289 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
290 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
291 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
292 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
293 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
294 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
295 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
296 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
297 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
300 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
301 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
302 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
303 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
304 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
305 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
308 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
309 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
310 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
313 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
314 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
315 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
316 2858882152 Micromonospora noduli MED15 Isolate Nodule
317 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
318 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
319 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
320 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
321 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
322 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
323 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
324 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
325 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
326 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
327 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
328 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
329 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
330 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
331 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
332 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.97
Nodule 0.5
Rhizoplane 2.32
Rhizosphere 87.91
Stem 0
Stem Tuber 0
Unclassified 10.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105242_10929455 3300009176 Bacteria 872
2 rootH2_10046567 3300003320 Bacteria 4797
3 Ga0065712_10412246 3300005290 Unclassified 720
4 Ga0065715_10209307 3300005293 Bacteria 1322
5 Ga0065707_10105018 3300005295 Bacteria 2643
6 Ga0070683_100852253 3300005329 Unclassified 874
7 Ga0070690_100511366 3300005330 Bacteria 900
8 Ga0070670_100116114 3300005331 Bacteria 2308
9 Ga0070670_100423182 3300005331 Unclassified 1177
10 Ga0070670_101323377 3300005331 Unclassified 660
11 Ga0068869_100070672 3300005334 Bacteria 2583
12 Ga0068869_100589304 3300005334 Bacteria 938
13 Ga0070666_10354801 3300005335 Bacteria 1050
14 Ga0070666_10721141 3300005335 Bacteria 732
15 Ga0070680_100002419 3300005336 Bacteria 13828
16 Ga0070682_100548447 3300005337 Bacteria 904
17 Ga0068868_100056967 3300005338 Bacteria 3087
18 Ga0068868_100128806 3300005338 Bacteria 2069
19 Ga0068868_100694305 3300005338 Bacteria 910
20 Ga0068868_100789877 3300005338 Bacteria 856
21 Ga0070689_100617469 3300005340 Bacteria 940
22 Ga0070661_100891202 3300005344 Unclassified 734
23 Ga0070692_10101563 3300005345 Bacteria 1577
24 Ga0070668_100764588 3300005347 Bacteria 856
25 Ga0070669_100021910 3300005353 Bacteria 4569
26 Ga0070669_101423714 3300005353 Unclassified 602
27 Ga0070675_100000001 3300005354 Bacteria 448137
28 Ga0070675_100358138 3300005354 Bacteria 1295
29 Ga0070675_100645364 3300005354 Bacteria 962
30 Ga0070675_101133304 3300005354 Unclassified 720
31 Ga0070675_101546215 3300005354 Bacteria 612
32 Ga0070675_101886491 3300005354 Bacteria 551
33 Ga0070671_101933921 3300005355 Bacteria 525
34 Ga0070674_100172184 3300005356 Bacteria 1652
35 Ga0070674_101299740 3300005356 Unclassified 648
36 Ga0070673_100407174 3300005364 Unclassified 1217
37 Ga0070673_100858597 3300005364 Bacteria 840
38 Ga0070673_101119062 3300005364 Unclassified 736
39 Ga0070659_101381182 3300005366 Unclassified 626
40 Ga0070667_100049623 3300005367 Bacteria 3535
41 Ga0070701_10254437 3300005438 Bacteria 1062
42 Ga0070705_100016566 3300005440 Unclassified 3829
43 Ga0070705_100777807 3300005440 Unclassified 759
44 Ga0070700_100046901 3300005441 Bacteria 2672
45 Ga0070700_101294758 3300005441 Bacteria 612
46 Ga0070694_101178993 3300005444 Bacteria 641
47 Ga0070678_100486144 3300005456 Bacteria 1087
48 Ga0070678_101294271 3300005456 Unclassified 678
49 Ga0070662_101426673 3300005457 Bacteria 597
50 Ga0070662_101828319 3300005457 Bacteria 525
51 Ga0070681_10000976 3300005458 Bacteria 24193
52 Ga0070681_10004897 3300005458 Bacteria 12851
53 Ga0068867_100030799 3300005459 Bacteria 3870
54 Ga0068867_100054655 3300005459 Bacteria 2950
55 Ga0068867_100217355 3300005459 Bacteria 1538
56 Ga0070707_101580407 3300005468 Bacteria 623
57 Ga0070698_100294148 3300005471 Bacteria 1555
58 Ga0070699_100346897 3300005518 Bacteria 1337
59 Ga0070679_100003894 3300005530 Bacteria 13726
60 Ga0068853_100040896 3300005539 Bacteria 3958
61 Ga0068853_100504894 3300005539 Bacteria 1142
62 Ga0068853_101040118 3300005539 Bacteria 789
63 Ga0068853_101098457 3300005539 Bacteria 767
64 Ga0070672_100021382 3300005543 Bacteria 4733
65 Ga0070686_100271472 3300005544 Bacteria 1247
66 Ga0070686_100501055 3300005544 Bacteria 942
67 Ga0070686_100777637 3300005544 Bacteria 770
68 Ga0070695_100007379 3300005545 Bacteria 6520
69 Ga0070695_100073967 3300005545 Unclassified 2238
70 Ga0070695_100169489 3300005545 Bacteria 1539
71 Ga0070695_100239760 3300005545 Unclassified 1315
72 Ga0070695_100325653 3300005545 Bacteria 1144
73 Ga0070695_100612212 3300005545 Bacteria 856
74 Ga0070696_100238385 3300005546 Bacteria 1371
75 Ga0070696_100451397 3300005546 Bacteria 1014
76 Ga0070696_100741982 3300005546 Bacteria 804
77 Ga0070693_100425868 3300005547 Bacteria 926
78 Ga0070665_100004843 3300005548 Bacteria 13984
79 Ga0070665_100174214 3300005548 Bacteria 2152
80 Ga0070665_100835503 3300005548 Bacteria 934
81 Ga0070704_100178142 3300005549 Bacteria 1698
82 Ga0068855_101762135 3300005563 Bacteria 630
83 Ga0070664_100552168 3300005564 Bacteria 1065
84 Ga0068857_100037214 3300005577 Bacteria 4310
85 Ga0068857_101686500 3300005577 Unclassified 619
86 Ga0068854_101349824 3300005578 Bacteria 643
87 Ga0068854_101652850 3300005578 Bacteria 585
88 Ga0068856_100032049 3300005614 Bacteria 5143
89 Ga0068856_100504329 3300005614 Bacteria 1231
90 Ga0068856_100668767 3300005614 Bacteria 1059
91 Ga0070702_100295800 3300005615 Unclassified 1118
92 Ga0068852_100762906 3300005616 Bacteria 980
93 Ga0068859_100965768 3300005617 Bacteria 935
94 Ga0068859_101416844 3300005617 Bacteria 766
95 Ga0068859_102540128 3300005617 Bacteria 564
96 Ga0068864_100020649 3300005618 Bacteria 5511
97 Ga0068864_101538491 3300005618 Bacteria 669
98 Ga0068864_101764137 3300005618 Unclassified 624
99 Ga0068866_10416917 3300005718 Bacteria 870
100 Ga0068863_100070639 3300005841 Bacteria 3302
101 Ga0068863_100086164 3300005841 Bacteria 2976
102 Ga0068863_100448742 3300005841 Bacteria 1266
103 Ga0068863_100677194 3300005841 Bacteria 1024
104 Ga0068863_101850518 3300005841 Bacteria 613
105 Ga0068858_100040190 3300005842 Bacteria 4336
106 Ga0068858_100096870 3300005842 Bacteria 2749
107 Ga0068858_101349864 3300005842 Bacteria 702
108 Ga0068858_101676693 3300005842 Bacteria 628
109 Ga0068860_100720936 3300005843 Bacteria 1008
110 Ga0068860_101112070 3300005843 Unclassified 810
111 Ga0068860_101168036 3300005843 Bacteria 790
112 Ga0068860_101194749 3300005843 Unclassified 781
113 Ga0068860_102108941 3300005843 Unclassified 585
114 Ga0068862_100153110 3300005844 Bacteria 2053
115 Ga0068862_100441320 3300005844 Bacteria 1225
116 Ga0068862_100539305 3300005844 Bacteria 1113
117 Ga0068862_100712460 3300005844 Bacteria 973
118 Ga0068862_102392899 3300005844 Unclassified 540
119 Ga0081538_10351601 3300005981 Unclassified 533
120 Ga0081539_10023367 3300005985 Bacteria 4052
121 Ga0081539_10026273 3300005985 Bacteria 3721
122 Ga0081539_10057489 3300005985 Bacteria 2152
123 Ga0070716_100055702 3300006173 Bacteria 2264
124 Ga0070716_100775108 3300006173 Bacteria 740
125 Ga0097621_100003847 3300006237 Bacteria 10398
126 Ga0097621_100721666 3300006237 Bacteria 919
127 Ga0068871_100014279 3300006358 Bacteria 5916
128 Ga0068871_100098689 3300006358 Bacteria 2444
129 Ga0068871_100325981 3300006358 Bacteria 1353
130 Ga0075428_100750714 3300006844 Bacteria 1038
131 Ga0075431_100006122 3300006847 Bacteria 11936
132 Ga0075433_11070148 3300006852 Unclassified 702
133 Ga0075434_100083578 3300006871 Bacteria 3190
134 Ga0075434_100257816 3300006871 Bacteria 1763
135 Ga0075434_100442266 3300006871 Bacteria 1321
136 Ga0075434_101502069 3300006871 Unclassified 683
137 Ga0068865_100009329 3300006881 Bacteria 6078
138 Ga0075436_100110166 3300006914 Bacteria 1921
139 Ga0075436_100610635 3300006914 Bacteria 804
140 Ga0097620_100965573 3300006931 Bacteria 935
141 Ga0097620_101416827 3300006931 Bacteria 766
142 Ga0097620_102539440 3300006931 Bacteria 564
143 Ga0075435_100000728 3300007076 Bacteria 20409
144 Ga0075435_100049909 3300007076 Bacteria 3367
145 Ga0075435_100202913 3300007076 Bacteria 1680
146 Ga0075435_100332708 3300007076 Unclassified 1301
147 Ga0075435_100841232 3300007076 Bacteria 799
148 Ga0075435_101063547 3300007076 Bacteria 707
149 Ga0075435_101105425 3300007076 Unclassified 693
150 Ga0105250_10419495 3300009092 Bacteria 596
151 Ga0105240_10248389 3300009093 Bacteria 2059
152 Ga0105240_10347406 3300009093 Bacteria 1684
153 Ga0105240_10505104 3300009093 Bacteria 1344
154 Ga0105240_11422072 3300009093 Unclassified 729
155 Ga0111539_11787673 3300009094 Bacteria 713
156 Ga0105245_10024491 3300009098 Bacteria 5300
157 Ga0105245_10059010 3300009098 Bacteria 3454
158 Ga0105245_10796308 3300009098 Bacteria 983
159 Ga0105247_10015695 3300009101 Bacteria 4535
160 Ga0114129_11802872 3300009147 Bacteria 744
161 Ga0105243_10027141 3300009148 Bacteria 4385
162 Ga0105243_10542987 3300009148 Bacteria 1109
163 Ga0105243_10584348 3300009148 Bacteria 1073
164 Ga0105241_11157120 3300009174 Bacteria 731
165 Ga0105241_11698507 3300009174 Bacteria 613
166 Ga0105242_10002576 3300009176 Bacteria 14196
167 Ga0105242_10008373 3300009176 Bacteria 7946
168 Ga0105242_10482813 3300009176 Unclassified 1175
169 Ga0105242_11055705 3300009176 Bacteria 824
170 Ga0105248_10001850 3300009177 Bacteria 23456
171 Ga0105248_10088597 3300009177 Bacteria 3483
172 Ga0105248_12754244 3300009177 Unclassified 561
173 Ga0105248_13345130 3300009177 Bacteria 510
174 Ga0105237_10022496 3300009545 Bacteria 6467
175 Ga0105237_10062196 3300009545 Bacteria 3733
176 Ga0105238_10876176 3300009551 Bacteria 916
177 Ga0105249_10065497 3300009553 Bacteria 3342
178 Ga0105249_10184008 3300009553 Bacteria 2035
179 Ga0105249_10293116 3300009553 Bacteria 1629
180 Ga0105249_10299873 3300009553 Unclassified 1611
181 Ga0105249_10739086 3300009553 Bacteria 1046
182 Ga0105249_10969953 3300009553 Bacteria 918
183 Ga0105239_10078105 3300010375 Bacteria 3643
184 Ga0105246_10193811 3300011119 Bacteria 1575
185 Ga0105246_10369481 3300011119 Bacteria 1181
186 Ga0157373_10522884 3300013100 Bacteria 859
187 Ga0157378_10000335 3300013297 Bacteria 46123
188 Ga0157378_10000904 3300013297 Bacteria 27354
189 Ga0157378_10062675 3300013297 Bacteria 3320
190 Ga0157378_10267381 3300013297 Bacteria 1643
191 Ga0157378_10874521 3300013297 Bacteria 928
192 Ga0163162_10068544 3300013306 Bacteria 3599
193 Ga0163162_10152799 3300013306 Bacteria 2427
194 Ga0163162_10598001 3300013306 Bacteria 1229
195 Ga0163162_11129133 3300013306 Bacteria 888
196 Ga0163162_12030541 3300013306 Bacteria 659
197 Ga0157372_10079674 3300013307 Bacteria 3704
198 Ga0157372_11525609 3300013307 Bacteria 770
199 Ga0157375_10439831 3300013308 Bacteria 1470
200 Ga0157375_10703480 3300013308 Bacteria 1164
201 Ga0157375_11524740 3300013308 Bacteria 789
202 Ga0163163_10455104 3300014325 Bacteria 1340
203 Ga0163163_10992842 3300014325 Bacteria 903
204 Ga0157380_10025757 3300014326 Bacteria 4463
205 Ga0157380_10053838 3300014326 Bacteria 3192
206 Ga0182008_10557922 3300014497 Bacteria 637
207 Ga0157377_10138057 3300014745 Unclassified 1495
208 Ga0157377_10172154 3300014745 Bacteria 1355
209 Ga0157379_10042286 3300014968 Bacteria 4068
210 Ga0157379_10119837 3300014968 Bacteria 2367
211 Ga0157379_11884689 3300014968 Bacteria 589
212 Ga0157376_10063608 3300014969 Bacteria 3109
213 Ga0157376_10235932 3300014969 Bacteria 1702
214 Ga0157376_10524895 3300014969 Bacteria 1168
215 Ga0157376_10734959 3300014969 Bacteria 995
216 Ga0157376_11472907 3300014969 Bacteria 713
217 Ga0213875_10000026 3300021388 Bacteria 196301
218 Ga0207426_1071658 3300025302 Bacteria 964
219 Ga0207642_10327078 3300025899 Bacteria 897
220 Ga0207710_10012027 3300025900 Bacteria 3638
221 Ga0207688_10167143 3300025901 Bacteria 1307
222 Ga0207680_10030984 3300025903 Bacteria 3025
223 Ga0207680_10803450 3300025903 Bacteria 674
224 Ga0207680_10957313 3300025903 Unclassified 613
225 Ga0207699_10696498 3300025906 Bacteria 743
226 Ga0207643_10267718 3300025908 Bacteria 1057
227 Ga0207707_10000188 3300025912 Bacteria 65222
228 Ga0207707_10006073 3300025912 Bacteria 10571
229 Ga0207695_10986155 3300025913 Bacteria 722
230 Ga0207671_10190096 3300025914 Unclassified 1601
231 Ga0207671_10268703 3300025914 Bacteria 1343
232 Ga0207671_10714027 3300025914 Bacteria 797
233 Ga0207660_10001919 3300025917 Bacteria 13860
234 Ga0207652_10002100 3300025921 Bacteria 17110
235 Ga0207646_10285286 3300025922 Bacteria 1492
236 Ga0207646_10508923 3300025922 Unclassified 1084
237 Ga0207681_10110021 3300025923 Bacteria 2002
238 Ga0207694_11737196 3300025924 Bacteria 525
239 Ga0207650_10127114 3300025925 Bacteria 1991
240 Ga0207659_10000004 3300025926 Bacteria 476977
241 Ga0207659_10242940 3300025926 Bacteria 1457
242 Ga0207659_10279234 3300025926 Bacteria 1365
243 Ga0207659_10302590 3300025926 Bacteria 1314
244 Ga0207659_11627456 3300025926 Bacteria 551
245 Ga0207687_10019256 3300025927 Bacteria 4520
246 Ga0207687_10088730 3300025927 Bacteria 2250
247 Ga0207687_11074437 3300025927 Unclassified 691
248 Ga0207687_11942207 3300025927 Bacteria 503
249 Ga0207644_11270955 3300025931 Bacteria 619
250 Ga0207690_11357360 3300025932 Unclassified 594
251 Ga0207706_11429011 3300025933 Bacteria 567
252 Ga0207686_10006039 3300025934 Bacteria 6502
253 Ga0207686_10409771 3300025934 Bacteria 1034
254 Ga0207686_10883559 3300025934 Unclassified 720
255 Ga0207686_11168940 3300025934 Bacteria 629
256 Ga0207670_10463065 3300025936 Bacteria 1024
257 Ga0207669_10135184 3300025937 Bacteria 1701
258 Ga0207669_10279095 3300025937 Unclassified 1259
259 Ga0207704_10413514 3300025938 Bacteria 1067
260 Ga0207704_10528018 3300025938 Bacteria 956
261 Ga0207704_10622608 3300025938 Bacteria 886
262 Ga0207704_10639935 3300025938 Bacteria 875
263 Ga0207665_10130760 3300025939 Bacteria 1782
264 Ga0207665_10198428 3300025939 Bacteria 1461
265 Ga0207665_10372923 3300025939 Bacteria 1081
266 Ga0207691_10055966 3300025940 Bacteria 3594
267 Ga0207691_10549929 3300025940 Bacteria 979
268 Ga0207711_10007204 3300025941 Bacteria 9320
269 Ga0207711_11410342 3300025941 Bacteria 639
270 Ga0207689_10166675 3300025942 Unclassified 1815
271 Ga0207689_10202763 3300025942 Bacteria 1638
272 Ga0207689_10375316 3300025942 Bacteria 1184
273 Ga0207689_10479516 3300025942 Bacteria 1041
274 Ga0207651_10675208 3300025960 Bacteria 908
275 Ga0207712_10146846 3300025961 Bacteria 1817
276 Ga0207712_10156458 3300025961 Unclassified 1766
277 Ga0207712_11024780 3300025961 Bacteria 733
278 Ga0207668_10109942 3300025972 Bacteria 2066
279 Ga0207640_11376778 3300025981 Bacteria 632
280 Ga0207658_10410029 3300025986 Bacteria 1193
281 Ga0207677_10163562 3300026023 Bacteria 1732
282 Ga0207677_10360518 3300026023 Bacteria 1221
283 Ga0207703_10099015 3300026035 Bacteria 2467
284 Ga0207639_11100599 3300026041 Unclassified 745
285 Ga0207708_10162849 3300026075 Bacteria 1762
286 Ga0207702_10152382 3300026078 Bacteria 2104
287 Ga0207702_10409247 3300026078 Bacteria 1309
288 Ga0207641_10192960 3300026088 Bacteria 1873
289 Ga0207641_10323372 3300026088 Bacteria 1463
290 Ga0207641_10397455 3300026088 Bacteria 1323
291 Ga0207641_10583440 3300026088 Bacteria 1093
292 Ga0207641_10725221 3300026088 Bacteria 980
293 Ga0207648_10062173 3300026089 Bacteria 3256
294 Ga0207648_11328091 3300026089 Bacteria 676
295 Ga0207676_10003118 3300026095 Bacteria 11824
296 Ga0207676_12202112 3300026095 Unclassified 549
297 Ga0207676_12599902 3300026095 Unclassified 502
298 Ga0207674_10019245 3300026116 Bacteria 7401
299 Ga0207674_11405775 3300026116 Unclassified 667
300 Ga0207675_100051723 3300026118 Bacteria 3833
301 Ga0207675_100472525 3300026118 Bacteria 1245
302 Ga0207675_102153591 3300026118 Bacteria 573
303 Ga0207683_10076878 3300026121 Bacteria 2956
304 Ga0207683_11226771 3300026121 Bacteria 695
305 Ga0268266_10148048 3300028379 Bacteria 2113
306 Ga0268266_10902718 3300028379 Bacteria 854
307 Ga0268265_10073116 3300028380 Bacteria 2676
308 Ga0268265_10197557 3300028380 Bacteria 1742
309 Ga0268265_10852991 3300028380 Bacteria 891
310 Ga0268265_12596286 3300028380 Bacteria 512
311 Ga0268264_10122496 3300028381 Bacteria 2294
312 Ga0268264_11421264 3300028381 Bacteria 704
313 Ga0268264_11593747 3300028381 Unclassified 663
314 Ga0307517_10004517 3300028786 Bacteria 21354
315 Ga0307511_10005460 3300030521 Bacteria 12926
316 Ga0316180_1061576 3300030736 Bacteria 689
317 Ga0307513_10862590 3300031456 Bacteria 612
318 Ga0307508_10101445 3300031616 Bacteria 2473
319 Ga0307508_10230602 3300031616 Bacteria 1450
320 Ga0307508_10281585 3300031616 Bacteria 1256
321 Ga0307514_10272431 3300031649 Bacteria 978
322 Ga0307514_10374787 3300031649 Bacteria 743
323 Ga0307516_10072531 3300031730 Bacteria 3302
324 Ga0307516_10193210 3300031730 Bacteria 1760
325 Ga0307405_11347058 3300031731 Unclassified 622
326 Ga0307413_10053607 3300031824 Bacteria 2442
327 Ga0307413_10382637 3300031824 Bacteria 1097
328 Ga0307413_10640700 3300031824 Bacteria 875
329 Ga0307410_10371206 3300031852 Bacteria 1149
330 Ga0307410_11149899 3300031852 Bacteria 675
331 Ga0326468_10000875 3300031889 Bacteria 2965
332 Ga0307407_10459996 3300031903 Bacteria 925
333 Ga0307412_10909519 3300031911 Unclassified 772
334 Ga0307409_100055915 3300031995 Bacteria 3050
335 Ga0307416_100598782 3300032002 Bacteria 1182
336 Ga0307414_10977398 3300032004 Bacteria 779
337 Ga0307411_11059614 3300032005 Bacteria 729
338 Ga0307415_100887569 3300032126 Bacteria 821
339 Ga0307507_10266819 3300033179 Bacteria 1086
340 Ga0307507_10487658 3300033179 Bacteria 668
341 Ga0373948_0004276 3300034817 Bacteria 2249
342 Ga0373940_0005282 3300035088 Bacteria 2787
343 Ga0373940_0013678 3300035088 Unclassified 1969
344 Ga0373951_0059067 3300035091 Bacteria 957
345 Ga0373951_0130953 3300035091 Bacteria 690
346 Ga0373943_0804824 3300035170 Bacteria 559
347 Ga0373955_0451838 3300035172 Bacteria 783
348 Ga0373935_0909892 3300035692 Bacteria 652
349 Ga0373937_0174740 3300036401 Bacteria 2016
350 Ga0373937_1806194 3300036401 Unclassified 558
351 Ga0373925_0179337 3300037068 Bacteria 1676
352 Ga0395900_0590140 3300037418 Unclassified 1052
353 Ga0395905_0709928 3300037471 Unclassified 908
354 Ga0395905_1471402 3300037471 Bacteria 585
355 Ga0436364_1267075 3300037853 Bacteria 62015
356 Ga0395901_2010142 3300038443 Unclassified 524
357 Ga0242420_002938 3300038996 Bacteria 2480
358 Ga0436365_0671969 3300039437 Archaea 558
359 Ga0451853_0623857 3300041512 Bacteria 563
360 Ga0439448_0119408 3300042005 Bacteria 904
361 Ga0439455_0013663 3300042012 Bacteria 1843
362 Ga0439458_0006220 3300042157 Bacteria 2664
363 Ga0439459_0189667 3300042438 Bacteria 556
364 Ga0451577_0005526 3300042876 Bacteria 12886
365 Ga0453684_0019490 3300044712 Bacteria 10323
366 Ga0451576_0394961 3300045051 Bacteria 1450
367 Ga0451576_0474743 3300045051 Bacteria 1313
368 Ga0466967_0062255 3300045976 Bacteria 3312
369 Ga0466967_0066870 3300045976 Bacteria 3204
370 Ga0495627_026626 3300046453 Bacteria 1863
371 Ga0495592_0021376 3300046454 Bacteria 4920
372 Ga0495629_0034374 3300046459 Bacteria 3584
373 Ga0495638_0045883 3300046460 Bacteria 2747
374 Ga0495651_0107186 3300046462 Bacteria 2070
375 Ga0495582_0162959 3300046473 Bacteria 1269
376 Ga0495639_0606145 3300046475 Bacteria 563
377 Ga0495639_0706232 3300046475 Bacteria 521
378 Ga0495662_0277484 3300046476 Bacteria 825
379 Ga0495662_0532094 3300046476 Bacteria 576
380 Ga0495664_0272907 3300046477 Bacteria 1022
381 Ga0495585_0145570 3300046492 Bacteria 1238
382 Ga0495594_0075088 3300046499 Bacteria 1884
383 Ga0495594_0086294 3300046499 Bacteria 1756
384 Ga0495594_0128489 3300046499 Bacteria 1434
385 Ga0495607_0086339 3300046501 Bacteria 1711
386 Ga0495618_0016423 3300046514 Bacteria 4529
387 Ga0495628_0012375 3300046516 Bacteria 7195
388 Ga0495631_0124560 3300046518 Bacteria 1108
389 Ga0495632_0015622 3300046519 Bacteria 4246
390 Ga0495643_0004558 3300046522 Bacteria 9651
391 Ga0495643_0009206 3300046522 Bacteria 6162
392 Ga0495652_0038412 3300046529 Bacteria 4148
393 Ga0495652_0765037 3300046529 Bacteria 645
394 Ga0495640_0027517 3300046533 Bacteria 4099
395 Ga0495640_0153555 3300046533 Bacteria 1478
396 Ga0495586_0131961 3300046535 Bacteria 1399
397 Ga0495621_0167721 3300046539 Bacteria 871
398 Ga0495621_0176516 3300046539 Unclassified 851
399 Ga0495633_0036196 3300046558 Bacteria 2366
400 Ga0495667_0061715 3300046559 Bacteria 2457
401 Ga0495634_0003641 3300046642 Bacteria 12294
402 Ga0495634_0655908 3300046642 Bacteria 606
403 Ga0495657_0025084 3300046675 Bacteria 4236
404 Ga0495647_0103701 3300046681 Unclassified 1180
405 Ga0495658_0199460 3300046683 Bacteria 1247
406 Ga0495658_0296331 3300046683 Bacteria 1022
407 Ga0495669_0150802 3300046684 Bacteria 1100
408 Ga0495613_0003683 3300046689 Bacteria 11487
409 Ga0495613_0471240 3300046689 Unclassified 849
410 Ga0495613_0574327 3300046689 Bacteria 752
411 Ga0495613_0819091 3300046689 Bacteria 607
412 Ga0495624_0019056 3300046690 Bacteria 4584
413 Ga0495670_0101414 3300046691 Bacteria 1482
414 Ga0495589_0161450 3300046794 Bacteria 1067
415 Ga0495600_0052912 3300046809 Bacteria 2651
416 Ga0495600_0654975 3300046809 Bacteria 634
417 Ga0495660_0045601 3300046810 Bacteria 2406
418 Ga0495604_0004211 3300047317 Bacteria 11389
419 Ga0495604_0053853 3300047317 Bacteria 3107
420 Ga0495604_0227213 3300047317 Bacteria 1282
421 Ga0495674_0979546 3300047319 Bacteria 649
422 Ga0495676_0045145 3300047321 Bacteria 3589
423 Ga0495687_184150 3300047443 Bacteria 678
424 Ga0495675_0045305 3300047444 Bacteria 2801
425 Ga0495675_0552471 3300047444 Bacteria 657
426 Ga0495679_048186 3300047446 Bacteria 1289
427 Ga0495685_000298 3300047447 Bacteria 16313
428 Ga0495681_0004865 3300047470 Bacteria 9080
429 Ga0495686_0134261 3300047472 Bacteria 1465
430 Ga0495614_0656002 3300048089 Bacteria 506
431 Ga0496101_0830723 3300048904 Bacteria 728
432 Ga0496102_0044479 3300048905 Bacteria 4030
433 Ga0496104_1288917 3300048907 Bacteria 634
434 Ga0496106_0127721 3300048909 Bacteria 1992
435 Ga0496106_0183256 3300048909 Bacteria 1663
436 Ga0496106_0891441 3300048909 Bacteria 703
437 Ga0496109_0121018 3300048912 Bacteria 2439
438 Ga0496109_1984509 3300048912 Unclassified 514
439 Ga0496112_0025781 3300048915 Bacteria 5647
440 Ga0496112_1333982 3300048915 Unclassified 633
441 Ga0496113_0985755 3300048916 Unclassified 664
442 Ga0496114_0168277 3300048917 Bacteria 1909
443 Ga0496114_0598642 3300048917 Bacteria 972
444 Ga0496115_0013757 3300048918 Bacteria 6126
445 Ga0496124_0805796 3300048927 Bacteria 581
446 Ga0501031_0012385 3300049568 Bacteria 5561
447 Ga0501031_0018907 3300049568 Bacteria 4485
448 Ga0501031_0050094 3300049568 Bacteria 2722
449 Ga0501031_0193340 3300049568 Bacteria 1328
450 Ga0501032_0004249 3300049569 Bacteria 10821
451 Ga0501032_0023244 3300049569 Bacteria 4289
452 Ga0501032_0031523 3300049569 Bacteria 3634
453 Ga0501032_0053234 3300049569 Bacteria 2726
454 Ga0501033_0011270 3300049570 Bacteria 6843
455 Ga0501033_0035783 3300049570 Bacteria 3722
456 Ga0501033_0049563 3300049570 Bacteria 3117
457 Ga0501033_0088922 3300049570 Bacteria 2259
458 Ga0501033_0136672 3300049570 Bacteria 1773
459 Ga0501034_0010168 3300049571 Bacteria 9816
460 Ga0501034_0019648 3300049571 Bacteria 6908
461 Ga0501034_0072036 3300049571 Bacteria 3465
462 Ga0501034_0191648 3300049571 Bacteria 2006
463 Ga0501034_0218423 3300049571 Bacteria 1859
464 Ga0501036_0007378 3300049572 Bacteria 8957
465 Ga0501036_0026721 3300049572 Bacteria 4876
466 Ga0501036_0190942 3300049572 Bacteria 1723
467 Ga0501036_0714850 3300049572 Bacteria 827
468 Ga0501037_0001093 3300049573 Bacteria 20095
469 Ga0501037_0025531 3300049573 Bacteria 4365
470 Ga0501037_0451278 3300049573 Bacteria 877
471 Ga0501038_0008707 3300049574 Bacteria 9315
472 Ga0501038_0014410 3300049574 Bacteria 7204
473 Ga0501038_0019824 3300049574 Bacteria 6054
474 Ga0501038_0028516 3300049574 Bacteria 4960
475 Ga0501038_0362805 3300049574 Bacteria 1126
476 Ga0501039_0018803 3300049575 Bacteria 5303
477 Ga0501039_0078442 3300049575 Bacteria 2569
478 Ga0501039_0194624 3300049575 Bacteria 1594
479 Ga0501039_0311511 3300049575 Bacteria 1237
480 Ga0501040_0004845 3300049576 Bacteria 8718
481 Ga0501040_0010006 3300049576 Bacteria 6195
482 Ga0501041_0007768 3300049577 Bacteria 6298
483 Ga0501042_0068091 3300049578 Bacteria 2545
484 Ga0501042_0110588 3300049578 Bacteria 1978
485 Ga0501043_0003118 3300049579 Bacteria 13748
486 Ga0501043_0008442 3300049579 Bacteria 8109
487 Ga0501043_0039031 3300049579 Bacteria 3732
488 Ga0501043_0120607 3300049579 Bacteria 2056
489 Ga0501046_0007953 3300049580 Bacteria 9276
490 Ga0501047_0000191 3300049581 Bacteria 74396
491 Ga0501047_0001262 3300049581 Bacteria 25039
492 Ga0501047_0026506 3300049581 Bacteria 5576
493 Ga0501047_0061518 3300049581 Bacteria 3623
494 Ga0501047_0096827 3300049581 Bacteria 2829
495 Ga0501047_0295397 3300049581 Bacteria 1463
496 Ga0501047_0357569 3300049581 Bacteria 1296
497 Ga0501047_1378197 3300049581 Bacteria 520
498 Ga0501048_0008693 3300049582 Bacteria 7654
499 Ga0501048_0491250 3300049582 Bacteria 880
500 Ga0501067_0001260 3300049583 Bacteria 13764
501 Ga0501069_0007121 3300049585 Bacteria 5862
502 Ga0501070_0042463 3300049586 Bacteria 3788
503 Ga0501070_0069872 3300049586 Bacteria 2908
504 Ga0501070_0132403 3300049586 Bacteria 2059
505 Ga0501070_0215753 3300049586 Bacteria 1574
506 Ga0501071_0000235 3300049587 Bacteria 25360
507 Ga0501072_0784048 3300049588 Bacteria 747
508 Ga0501073_0019029 3300049589 Bacteria 4962
509 Ga0501075_0461910 3300049591 Bacteria 968
510 Ga0501076_0126753 3300049592 Bacteria 2069
511 Ga0501077_0017752 3300049593 Bacteria 4495
512 Ga0501077_0147852 3300049593 Bacteria 1491
513 Ga0501079_0139317 3300049741 Bacteria 1889
514 Ga0501080_0015279 3300049742 Bacteria 7077
515 Ga0501081_0475913 3300049743 Unclassified 929
516 Ga0501083_0046610 3300049744 Bacteria 2930
517 Ga0501035_0003355 3300049822 Bacteria 15340
518 Ga0501035_0004948 3300049822 Bacteria 12634
519 Ga0501035_0018221 3300049822 Bacteria 6467
520 Ga0501035_0020925 3300049822 Bacteria 6011
521 Ga0501035_0034369 3300049822 Bacteria 4606
522 Ga0501035_0315063 3300049822 Bacteria 1315
523 Ga0501044_0004705 3300049823 Bacteria 15256
524 Ga0501044_0004929 3300049823 Bacteria 14924
525 Ga0501044_0080631 3300049823 Bacteria 3296
526 Ga0501044_0122938 3300049823 Bacteria 2594
527 Ga0501044_0156647 3300049823 Bacteria 2257
528 Ga0501044_0201457 3300049823 Bacteria 1948
529 Ga0501044_0818588 3300049823 Bacteria 809
530 Ga0501044_1138901 3300049823 Bacteria 649
531 Ga0501045_0018474 3300049824 Bacteria 4959
532 Ga0501045_0337043 3300049824 Bacteria 1122
533 nmdc:mga06z11_815898_c1 3300050494 Bacteria 568
534 nmdc:mga05p37_1324426_c1 3300050507 Bacteria 732
535 nmdc:mga06r32_5058_c1 3300050510 Bacteria 11875
536 nmdc:mga08y16_481284_c1 3300050511 Bacteria 1263
537 nmdc:mga0n895_1270308_c1 3300050512 Bacteria 708
538 nmdc:mga0n895_247447_c1 3300050512 Bacteria 1809
539 nmdc:mga0n895_43392_c1 3300050512 Bacteria 4382
540 nmdc:mga0rr50_1763379_c1 3300050513 Bacteria 521
541 nmdc:mga0rr50_42200_c1 3300050513 Bacteria 3330
542 nmdc:mga0rr50_6659_c1 3300050513 Bacteria 7063
543 nmdc:mga0rr50_902_c1 3300050513 Bacteria 16056
544 nmdc:mga08x19_152513_c1 3300050514 Bacteria 1566
545 nmdc:mga08x19_197890_c1 3300050514 Bacteria 1377
546 nmdc:mga0a205_1008177_c1 3300050515 Bacteria 680
547 Ga0495601_0287891 3300053077 Bacteria 1071
548 Ga0495655_0016242 3300053083 Bacteria 1599
549 Ga0495595_0207079 3300053084 Bacteria 977
550 Ga0495619_0160446 3300053085 Unclassified 1553
551 Ga0495619_0917851 3300053085 Bacteria 588
552 Ga0500578_0118445 3300053086 Bacteria 1665
553 Ga0500646_0042702 3300053090 Bacteria 1282
554 Ga0500641_0009253 3300053096 Bacteria 3539
555 Ga0500654_020689 3300053099 Bacteria 4209
556 Ga0500660_019729 3300053100 Bacteria 3602
557 Ga0500553_081337 3300053101 Bacteria 1455
558 Ga0500560_046560 3300053107 Bacteria 1379
559 Ga0500569_016780 3300053109 Bacteria 1861
560 Ga0500580_183588 3300053113 Bacteria 708
561 Ga0500594_0011618 3300053118 Bacteria 2058
562 Ga0500628_004053 3300053129 Bacteria 2420
563 Ga0500628_013399 3300053129 Bacteria 1530
564 Ga0500652_001177 3300053131 Bacteria 8350
565 Ga0500655_079840 3300053133 Bacteria 673
566 Ga0500658_0034585 3300053134 Bacteria 1995
567 Ga0500573_0026804 3300053140 Bacteria 3313
568 Ga0500579_061996 3300053143 Bacteria 2214
569 Ga0500600_0028226 3300053149 Bacteria 3321
570 Ga0500616_0010652 3300053153 Bacteria 5486
571 Ga0500633_0018288 3300053160 Bacteria 2074
572 Ga0500634_0008964 3300053161 Bacteria 5030
573 Ga0500656_019964 3300053732 Bacteria 822
574 Ga0501084_0019549 3300054114 Bacteria 5643
575 Ga0501084_0064670 3300054114 Bacteria 3061
576 Ga0590071_000357 3300059421 Bacteria 13494
577 Ga0590074_000645 3300059423 Bacteria 5262
578 Ga0590075_000133 3300059424 Bacteria 19395
579 Ga0590077_000027 3300059426 Bacteria 33787
580 Ga0501082_0019393 3300060353 Bacteria 5861
581 Ga0501082_0072544 3300060353 Bacteria 2965
582 Ga0501082_0350449 3300060353 Unclassified 1287
583 Ga0530510_0073606 3300061734 Bacteria 2480
584 Ga0530510_0422397 3300061734 Bacteria 1006
585 2855677577 2855676851 Bacteria 7063653
586 2857293234 2857288857 Bacteria 7189066
587 2858852913 2858848962 Bacteria 6963058
588 2858883338 2858882152 Bacteria 7230291
589 2858891362 2858888857 Bacteria 7060307
590 2858901417 2858895516 Bacteria 7378898
591 2867302745 2867302475 Bacteria 7087181
592 2869051873 2869048445 Bacteria 6875584
593 2869064503 2869061728 Bacteria 7112407
594 2869074358 2869068681 Bacteria 7205615
595 2880490024 2880489317 Bacteria 7096270
596 2880502536 2880495981 Bacteria 7340502
597 2923516987 2923516293 Bacteria 3716336
598 2929224375 2929219909 Bacteria 6984360
599 2929230969 2929226422 Bacteria 7248583
600 3006327530 3006321560 Bacteria 8247479
601 8003836382 8003830390 Bacteria 6541657
602 8003873175 8003870546 Bacteria 7396674
603 8054733285 8054727385 Bacteria 7558670
604 8054738835 8054734606 Bacteria 6947278
605 Ga0105242_10929455
606 rootH2_10046567
607 Ga0065712_10412246
608 Ga0065715_10209307
609 Ga0065707_10105018
610 Ga0070683_100852253
611 Ga0070690_100511366
612 Ga0070670_100116114
613 Ga0070670_100423182
614 Ga0070670_101323377
615 Ga0068869_100070672
616 Ga0068869_100589304
617 Ga0070666_10354801
618 Ga0070666_10721141
619 Ga0070680_100002419
620 Ga0070682_100548447
621 Ga0068868_100056967
622 Ga0068868_100128806
623 Ga0068868_100694305
624 Ga0068868_100789877
625 Ga0070689_100617469
626 Ga0070661_100891202
627 Ga0070692_10101563
628 Ga0070668_100764588
629 Ga0070669_100021910
630 Ga0070669_101423714
631 Ga0070675_100000001
632 Ga0070675_100358138
633 Ga0070675_100645364
634 Ga0070675_101133304
635 Ga0070675_101546215
636 Ga0070675_101886491
637 Ga0070671_101933921
638 Ga0070674_100172184
639 Ga0070674_101299740
640 Ga0070673_100407174
641 Ga0070673_100858597
642 Ga0070673_101119062
643 Ga0070659_101381182
644 Ga0070667_100049623
645 Ga0070701_10254437
646 Ga0070705_100016566
647 Ga0070705_100777807
648 Ga0070700_100046901
649 Ga0070700_101294758
650 Ga0070694_101178993
651 Ga0070678_100486144
652 Ga0070678_101294271
653 Ga0070662_101426673
654 Ga0070662_101828319
655 Ga0070681_10000976
656 Ga0070681_10004897
657 Ga0068867_100030799
658 Ga0068867_100054655
659 Ga0068867_100217355
660 Ga0070707_101580407
661 Ga0070698_100294148
662 Ga0070699_100346897
663 Ga0070679_100003894
664 Ga0068853_100040896
665 Ga0068853_100504894
666 Ga0068853_101040118
667 Ga0068853_101098457
668 Ga0070672_100021382
669 Ga0070686_100271472
670 Ga0070686_100501055
671 Ga0070686_100777637
672 Ga0070695_100007379
673 Ga0070695_100073967
674 Ga0070695_100169489
675 Ga0070695_100239760
676 Ga0070695_100325653
677 Ga0070695_100612212
678 Ga0070696_100238385
679 Ga0070696_100451397
680 Ga0070696_100741982
681 Ga0070693_100425868
682 Ga0070665_100004843
683 Ga0070665_100174214
684 Ga0070665_100835503
685 Ga0070704_100178142
686 Ga0068855_101762135
687 Ga0070664_100552168
688 Ga0068857_100037214
689 Ga0068857_101686500
690 Ga0068854_101349824
691 Ga0068854_101652850
692 Ga0068856_100032049
693 Ga0068856_100504329
694 Ga0068856_100668767
695 Ga0070702_100295800
696 Ga0068852_100762906
697 Ga0068859_100965768
698 Ga0068859_101416844
699 Ga0068859_102540128
700 Ga0068864_100020649
701 Ga0068864_101538491
702 Ga0068864_101764137
703 Ga0068866_10416917
704 Ga0068863_100070639
705 Ga0068863_100086164
706 Ga0068863_100448742
707 Ga0068863_100677194
708 Ga0068863_101850518
709 Ga0068858_100040190
710 Ga0068858_100096870
711 Ga0068858_101349864
712 Ga0068858_101676693
713 Ga0068860_100720936
714 Ga0068860_101112070
715 Ga0068860_101168036
716 Ga0068860_101194749
717 Ga0068860_102108941
718 Ga0068862_100153110
719 Ga0068862_100441320
720 Ga0068862_100539305
721 Ga0068862_100712460
722 Ga0068862_102392899
723 Ga0081538_10351601
724 Ga0081539_10023367
725 Ga0081539_10026273
726 Ga0081539_10057489
727 Ga0070716_100055702
728 Ga0070716_100775108
729 Ga0097621_100003847
730 Ga0097621_100721666
731 Ga0068871_100014279
732 Ga0068871_100098689
733 Ga0068871_100325981
734 Ga0075428_100750714
735 Ga0075431_100006122
736 Ga0075433_11070148
737 Ga0075434_100083578
738 Ga0075434_100257816
739 Ga0075434_100442266
740 Ga0075434_101502069
741 Ga0068865_100009329
742 Ga0075436_100110166
743 Ga0075436_100610635
744 Ga0097620_100965573
745 Ga0097620_101416827
746 Ga0097620_102539440
747 Ga0075435_100000728
748 Ga0075435_100049909
749 Ga0075435_100202913
750 Ga0075435_100332708
751 Ga0075435_100841232
752 Ga0075435_101063547
753 Ga0075435_101105425
754 Ga0105250_10419495
755 Ga0105240_10248389
756 Ga0105240_10347406
757 Ga0105240_10505104
758 Ga0105240_11422072
759 Ga0111539_11787673
760 Ga0105245_10024491
761 Ga0105245_10059010
762 Ga0105245_10796308
763 Ga0105247_10015695
764 Ga0114129_11802872
765 Ga0105243_10027141
766 Ga0105243_10542987
767 Ga0105243_10584348
768 Ga0105241_11157120
769 Ga0105241_11698507
770 Ga0105242_10002576
771 Ga0105242_10008373
772 Ga0105242_10482813
773 Ga0105242_11055705
774 Ga0105248_10001850
775 Ga0105248_10088597
776 Ga0105248_12754244
777 Ga0105248_13345130
778 Ga0105237_10022496
779 Ga0105237_10062196
780 Ga0105238_10876176
781 Ga0105249_10065497
782 Ga0105249_10184008
783 Ga0105249_10293116
784 Ga0105249_10299873
785 Ga0105249_10739086
786 Ga0105249_10969953
787 Ga0105239_10078105
788 Ga0105246_10193811
789 Ga0105246_10369481
790 Ga0157373_10522884
791 Ga0157378_10000335
792 Ga0157378_10000904
793 Ga0157378_10062675
794 Ga0157378_10267381
795 Ga0157378_10874521
796 Ga0163162_10068544
797 Ga0163162_10152799
798 Ga0163162_10598001
799 Ga0163162_11129133
800 Ga0163162_12030541
801 Ga0157372_10079674
802 Ga0157372_11525609
803 Ga0157375_10439831
804 Ga0157375_10703480
805 Ga0157375_11524740
806 Ga0163163_10455104
807 Ga0163163_10992842
808 Ga0157380_10025757
809 Ga0157380_10053838
810 Ga0182008_10557922
811 Ga0157377_10138057
812 Ga0157377_10172154
813 Ga0157379_10042286
814 Ga0157379_10119837
815 Ga0157379_11884689
816 Ga0157376_10063608
817 Ga0157376_10235932
818 Ga0157376_10524895
819 Ga0157376_10734959
820 Ga0157376_11472907
821 Ga0213875_10000026
822 Ga0207426_1071658
823 Ga0207642_10327078
824 Ga0207710_10012027
825 Ga0207688_10167143
826 Ga0207680_10030984
827 Ga0207680_10803450
828 Ga0207680_10957313
829 Ga0207699_10696498
830 Ga0207643_10267718
831 Ga0207707_10000188
832 Ga0207707_10006073
833 Ga0207695_10986155
834 Ga0207671_10190096
835 Ga0207671_10268703
836 Ga0207671_10714027
837 Ga0207660_10001919
838 Ga0207652_10002100
839 Ga0207646_10285286
840 Ga0207646_10508923
841 Ga0207681_10110021
842 Ga0207694_11737196
843 Ga0207650_10127114
844 Ga0207659_10000004
845 Ga0207659_10242940
846 Ga0207659_10279234
847 Ga0207659_10302590
848 Ga0207659_11627456
849 Ga0207687_10019256
850 Ga0207687_10088730
851 Ga0207687_11074437
852 Ga0207687_11942207
853 Ga0207644_11270955
854 Ga0207690_11357360
855 Ga0207706_11429011
856 Ga0207686_10006039
857 Ga0207686_10409771
858 Ga0207686_10883559
859 Ga0207686_11168940
860 Ga0207670_10463065
861 Ga0207669_10135184
862 Ga0207669_10279095
863 Ga0207704_10413514
864 Ga0207704_10528018
865 Ga0207704_10622608
866 Ga0207704_10639935
867 Ga0207665_10130760
868 Ga0207665_10198428
869 Ga0207665_10372923
870 Ga0207691_10055966
871 Ga0207691_10549929
872 Ga0207711_10007204
873 Ga0207711_11410342
874 Ga0207689_10166675
875 Ga0207689_10202763
876 Ga0207689_10375316
877 Ga0207689_10479516
878 Ga0207651_10675208
879 Ga0207712_10146846
880 Ga0207712_10156458
881 Ga0207712_11024780
882 Ga0207668_10109942
883 Ga0207640_11376778
884 Ga0207658_10410029
885 Ga0207677_10163562
886 Ga0207677_10360518
887 Ga0207703_10099015
888 Ga0207639_11100599
889 Ga0207708_10162849
890 Ga0207702_10152382
891 Ga0207702_10409247
892 Ga0207641_10192960
893 Ga0207641_10323372
894 Ga0207641_10397455
895 Ga0207641_10583440
896 Ga0207641_10725221
897 Ga0207648_10062173
898 Ga0207648_11328091
899 Ga0207676_10003118
900 Ga0207676_12202112
901 Ga0207676_12599902
902 Ga0207674_10019245
903 Ga0207674_11405775
904 Ga0207675_100051723
905 Ga0207675_100472525
906 Ga0207675_102153591
907 Ga0207683_10076878
908 Ga0207683_11226771
909 Ga0268266_10148048
910 Ga0268266_10902718
911 Ga0268265_10073116
912 Ga0268265_10197557
913 Ga0268265_10852991
914 Ga0268265_12596286
915 Ga0268264_10122496
916 Ga0268264_11421264
917 Ga0268264_11593747
918 Ga0307517_10004517
919 Ga0307511_10005460
920 Ga0316180_1061576
921 Ga0307513_10862590
922 Ga0307508_10101445
923 Ga0307508_10230602
924 Ga0307508_10281585
925 Ga0307514_10272431
926 Ga0307514_10374787
927 Ga0307516_10072531
928 Ga0307516_10193210
929 Ga0307405_11347058
930 Ga0307413_10053607
931 Ga0307413_10382637
932 Ga0307413_10640700
933 Ga0307410_10371206
934 Ga0307410_11149899
935 Ga0326468_10000875
936 Ga0307407_10459996
937 Ga0307412_10909519
938 Ga0307409_100055915
939 Ga0307416_100598782
940 Ga0307414_10977398
941 Ga0307411_11059614
942 Ga0307415_100887569
943 Ga0307507_10266819
944 Ga0307507_10487658
945 Ga0373948_0004276
946 Ga0373940_0005282
947 Ga0373940_0013678
948 Ga0373951_0059067
949 Ga0373951_0130953
950 Ga0373943_0804824
951 Ga0373955_0451838
952 Ga0373935_0909892
953 Ga0373937_0174740
954 Ga0373937_1806194
955 Ga0373925_0179337
956 Ga0395900_0590140
957 Ga0395905_0709928
958 Ga0395905_1471402
959 Ga0436364_1267075
960 Ga0395901_2010142
961 Ga0242420_002938
962 Ga0436365_0671969
963 Ga0451853_0623857
964 Ga0439448_0119408
965 Ga0439455_0013663
966 Ga0439458_0006220
967 Ga0439459_0189667
968 Ga0451577_0005526
969 Ga0453684_0019490
970 Ga0451576_0394961
971 Ga0451576_0474743
972 Ga0466967_0062255
973 Ga0466967_0066870
974 Ga0495627_026626
975 Ga0495592_0021376
976 Ga0495629_0034374
977 Ga0495638_0045883
978 Ga0495651_0107186
979 Ga0495582_0162959
980 Ga0495639_0606145
981 Ga0495639_0706232
982 Ga0495662_0277484
983 Ga0495662_0532094
984 Ga0495664_0272907
985 Ga0495585_0145570
986 Ga0495594_0075088
987 Ga0495594_0086294
988 Ga0495594_0128489
989 Ga0495607_0086339
990 Ga0495618_0016423
991 Ga0495628_0012375
992 Ga0495631_0124560
993 Ga0495632_0015622
994 Ga0495643_0004558
995 Ga0495643_0009206
996 Ga0495652_0038412
997 Ga0495652_0765037
998 Ga0495640_0027517
999 Ga0495640_0153555
1000 Ga0495586_0131961
1001 Ga0495621_0167721
1002 Ga0495621_0176516
1003 Ga0495633_0036196
1004 Ga0495667_0061715
1005 Ga0495634_0003641
1006 Ga0495634_0655908
1007 Ga0495657_0025084
1008 Ga0495647_0103701
1009 Ga0495658_0199460
1010 Ga0495658_0296331
1011 Ga0495669_0150802
1012 Ga0495613_0003683
1013 Ga0495613_0471240
1014 Ga0495613_0574327
1015 Ga0495613_0819091
1016 Ga0495624_0019056
1017 Ga0495670_0101414
1018 Ga0495589_0161450
1019 Ga0495600_0052912
1020 Ga0495600_0654975
1021 Ga0495660_0045601
1022 Ga0495604_0004211
1023 Ga0495604_0053853
1024 Ga0495604_0227213
1025 Ga0495674_0979546
1026 Ga0495676_0045145
1027 Ga0495687_184150
1028 Ga0495675_0045305
1029 Ga0495675_0552471
1030 Ga0495679_048186
1031 Ga0495685_000298
1032 Ga0495681_0004865
1033 Ga0495686_0134261
1034 Ga0495614_0656002
1035 Ga0496101_0830723
1036 Ga0496102_0044479
1037 Ga0496104_1288917
1038 Ga0496106_0127721
1039 Ga0496106_0183256
1040 Ga0496106_0891441
1041 Ga0496109_0121018
1042 Ga0496109_1984509
1043 Ga0496112_0025781
1044 Ga0496112_1333982
1045 Ga0496113_0985755
1046 Ga0496114_0168277
1047 Ga0496114_0598642
1048 Ga0496115_0013757
1049 Ga0496124_0805796
1050 Ga0501031_0012385
1051 Ga0501031_0018907
1052 Ga0501031_0050094
1053 Ga0501031_0193340
1054 Ga0501032_0004249
1055 Ga0501032_0023244
1056 Ga0501032_0031523
1057 Ga0501032_0053234
1058 Ga0501033_0011270
1059 Ga0501033_0035783
1060 Ga0501033_0049563
1061 Ga0501033_0088922
1062 Ga0501033_0136672
1063 Ga0501034_0010168
1064 Ga0501034_0019648
1065 Ga0501034_0072036
1066 Ga0501034_0191648
1067 Ga0501034_0218423
1068 Ga0501036_0007378
1069 Ga0501036_0026721
1070 Ga0501036_0190942
1071 Ga0501036_0714850
1072 Ga0501037_0001093
1073 Ga0501037_0025531
1074 Ga0501037_0451278
1075 Ga0501038_0008707
1076 Ga0501038_0014410
1077 Ga0501038_0019824
1078 Ga0501038_0028516
1079 Ga0501038_0362805
1080 Ga0501039_0018803
1081 Ga0501039_0078442
1082 Ga0501039_0194624
1083 Ga0501039_0311511
1084 Ga0501040_0004845
1085 Ga0501040_0010006
1086 Ga0501041_0007768
1087 Ga0501042_0068091
1088 Ga0501042_0110588
1089 Ga0501043_0003118
1090 Ga0501043_0008442
1091 Ga0501043_0039031
1092 Ga0501043_0120607
1093 Ga0501046_0007953
1094 Ga0501047_0000191
1095 Ga0501047_0001262
1096 Ga0501047_0026506
1097 Ga0501047_0061518
1098 Ga0501047_0096827
1099 Ga0501047_0295397
1100 Ga0501047_0357569
1101 Ga0501047_1378197
1102 Ga0501048_0008693
1103 Ga0501048_0491250
1104 Ga0501067_0001260
1105 Ga0501069_0007121
1106 Ga0501070_0042463
1107 Ga0501070_0069872
1108 Ga0501070_0132403
1109 Ga0501070_0215753
1110 Ga0501071_0000235
1111 Ga0501072_0784048
1112 Ga0501073_0019029
1113 Ga0501075_0461910
1114 Ga0501076_0126753
1115 Ga0501077_0017752
1116 Ga0501077_0147852
1117 Ga0501079_0139317
1118 Ga0501080_0015279
1119 Ga0501081_0475913
1120 Ga0501083_0046610
1121 Ga0501035_0003355
1122 Ga0501035_0004948
1123 Ga0501035_0018221
1124 Ga0501035_0020925
1125 Ga0501035_0034369
1126 Ga0501035_0315063
1127 Ga0501044_0004705
1128 Ga0501044_0004929
1129 Ga0501044_0080631
1130 Ga0501044_0122938
1131 Ga0501044_0156647
1132 Ga0501044_0201457
1133 Ga0501044_0818588
1134 Ga0501044_1138901
1135 Ga0501045_0018474
1136 Ga0501045_0337043
1137 nmdc:mga06z11_815898_c1
1138 nmdc:mga05p37_1324426_c1
1139 nmdc:mga06r32_5058_c1
1140 nmdc:mga08y16_481284_c1
1141 nmdc:mga0n895_1270308_c1
1142 nmdc:mga0n895_247447_c1
1143 nmdc:mga0n895_43392_c1
1144 nmdc:mga0rr50_1763379_c1
1145 nmdc:mga0rr50_42200_c1
1146 nmdc:mga0rr50_6659_c1
1147 nmdc:mga0rr50_902_c1
1148 nmdc:mga08x19_152513_c1
1149 nmdc:mga08x19_197890_c1
1150 nmdc:mga0a205_1008177_c1
1151 Ga0495601_0287891
1152 Ga0495655_0016242
1153 Ga0495595_0207079
1154 Ga0495619_0160446
1155 Ga0495619_0917851
1156 Ga0500578_0118445
1157 Ga0500646_0042702
1158 Ga0500641_0009253
1159 Ga0500654_020689
1160 Ga0500660_019729
1161 Ga0500553_081337
1162 Ga0500560_046560
1163 Ga0500569_016780
1164 Ga0500580_183588
1165 Ga0500594_0011618
1166 Ga0500628_004053
1167 Ga0500628_013399
1168 Ga0500652_001177
1169 Ga0500655_079840
1170 Ga0500658_0034585
1171 Ga0500573_0026804
1172 Ga0500579_061996
1173 Ga0500600_0028226
1174 Ga0500616_0010652
1175 Ga0500633_0018288
1176 Ga0500634_0008964
1177 Ga0500656_019964
1178 Ga0501084_0019549
1179 Ga0501084_0064670
1180 Ga0590071_000357
1181 Ga0590074_000645
1182 Ga0590075_000133
1183 Ga0590077_000027
1184 Ga0501082_0019393
1185 Ga0501082_0072544
1186 Ga0501082_0350449
1187 Ga0530510_0073606
1188 Ga0530510_0422397
1189 2855677577
1190 2857293234
1191 2858852913
1192 2858883338
1193 2858891362
1194 2858901417
1195 2867302745
1196 2869051873
1197 2869064503
1198 2869074358
1199 2880490024
1200 2880502536
1201 2923516987
1202 2929224375
1203 2929230969
1204 3006327530
1205 8003836382
1206 8003873175
1207 8054733285
1208 8054738835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11236

DUF3037

Protein of unknown function (DUF3037)

9

126

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
5tzn-assembly2.cif.gz_G structure of the viral immunoevasin m12 (smith) bound to the natural killer cell receptor nkr-p1b (b6) 0.6447 5 42
5v6c-assembly1.cif.gz_A crystal structure of the second beta-prism domain of rbmc from v. cholerae 0.6243 5 43
4d8m-assembly1.cif.gz_A crystal structure of bacillus thuringiensis cry5b nematocidal toxin 0.6149 2 34
7ado-assembly1.cif.gz_I cryo-em structure of human er membrane protein complex in lipid nanodiscs 0.6122 9 48
2pf6-assembly2.cif.gz_B lutheran glycoprotein, n-terminal domains 1 and 2 0.6101 5 47
ID Description Score Start End Superfamily
af_A4HUD7_445_606_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6387 7 42 3.30.420.10
3o44A04 Mainly Beta;Aligned Prism;Vitelline Membrane Outer Layer Protein I, subunit A;Jacalin-like lectin domain 0.6225 1 43 2.100.10.30
af_Q54RM1_111_303_2.40.160.120 Mainly Beta;Beta Barrel;Porin; 0.6121 4 46 2.40.160.120
af_A0A1D8PR64_243_461_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6104 5 42 3.30.420.10
af_H2KZM9_262_509_3.30.470.20 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.6078 1 32 3.30.470.20
ID Description Score Start End GO Terms
AF-D6K6E4-F1-model_v4 DUF3037 domain-containing protein 0.9963 7 127
AF-A0A7H8JMZ3-F1-model_v4 DUF3037 domain-containing protein 0.9956 4 127
AF-S3ZU95-F1-model_v4 DUF3037 domain-containing protein 0.9948 4 127
AF-A0A4R1DIT9-F1-model_v4 deleted 0.9945 4 127
AF-A0A7X1LZA2-F1-model_v4 DUF3037 domain-containing protein 0.9927 4 127

Map