F467768

General Info

Members Datasets Scaffolds Average Seq Length
598 368 1196 94

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10308883|Ga0075365_103088832
Length 103
Sequence VTRHDRRVQPVLSLIHLALLLFIALMWIRFVVDWVQVFARNWAPTGFLLVVLEIVYSATDPPIKALRRVIPPLRIGTIAIDLSFIIVMIVAYLLLYIVDGFLG

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300009828 Sorghum rhizosphere soil microbial communities in Albany, CA(condition:control)- sample E Metatranscriptome Rhizosphere
90 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
91 3300009850 Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C Metatranscriptome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
166 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
192 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
196 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
197 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
198 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
199 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
200 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
201 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
206 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
219 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
256 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
257 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
258 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
264 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
265 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
273 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
315 2501939600 Micromonospora sp. L5 Isolate Unclassified
316 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
317 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
318 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
319 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
320 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
321 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
322 2643221615 Nocardioides sp. Root224 Isolate Unclassified
323 2643221641 Nocardioides sp. Root122 Isolate Unclassified
324 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
325 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
326 2739367898 Nocardioides sp. CF479 Isolate Unclassified
327 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
328 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
329 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
330 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
331 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
332 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
333 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
334 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
335 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
336 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
337 2855683550 Micromonospora sp. RP3T Isolate Unclassified
338 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
339 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
340 2858868258 Micromonospora sp. MH33 Isolate Unclassified
341 2858882152 Micromonospora noduli MED15 Isolate Nodule
342 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
343 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
344 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
345 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
346 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
347 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
348 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
349 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
350 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
351 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
352 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
353 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
354 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
355 2902582711 Micromonospora sp. AP08 Isolate Unclassified
356 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
357 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
358 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
359 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
360 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
361 649633069 Micromonospora sp. L5 Isolate Unclassified
362 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
363 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
364 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
365 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
366 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
367 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
368 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.23
Metatranscriptomes 21.74
Isolates 9.03

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 9.87
Nodule 1
Rhizoplane 2.34
Rhizosphere 78.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10308883 3300006038 Bacteria 1113
2 Ga0006759J45824_1068341 3300003163 Bacteria 788
3 Ga0007410J51695_1053857 3300003574 Bacteria 515
4 Ga0007410J51695_1061087 3300003574 Bacteria 572
5 Ga0007410J51695_1119329 3300003574 Bacteria 514
6 Ga0007416J51690_1094464 3300003577 Bacteria 578
7 Ga0007416J51690_1114385 3300003577 Bacteria 532
8 Ga0007429J51699_1078057 3300003579 Bacteria 768
9 Ga0032354_1079464 3300003693 Bacteria 514
10 Ga0032354_1081598 3300003693 Bacteria 538
11 Ga0058863_10066423 3300004799 Bacteria 754
12 Ga0058863_10149005 3300004799 Bacteria 809
13 Ga0058863_11957479 3300004799 Bacteria 994
14 Ga0058861_10046601 3300004800 Bacteria 1172
15 Ga0058861_10082252 3300004800 Bacteria 689
16 Ga0058861_11982199 3300004800 Bacteria 707
17 Ga0058861_12059564 3300004800 Bacteria 684
18 Ga0058860_10104110 3300004801 Bacteria 877
19 Ga0058862_10114501 3300004803 Bacteria 832
20 Ga0058862_12794759 3300004803 Bacteria 558
21 Ga0058862_12856072 3300004803 Bacteria 1004
22 Ga0070658_10031352 3300005327 Bacteria 4268
23 Ga0070683_100100177 3300005329 Bacteria 2727
24 Ga0070683_100117319 3300005329 Bacteria 2513
25 Ga0070683_100603312 3300005329 Bacteria 1051
26 Ga0070683_101437647 3300005329 Bacteria 663
27 Ga0070690_100584271 3300005330 Bacteria 846
28 Ga0070670_100822233 3300005331 Bacteria 840
29 Ga0070670_101011884 3300005331 Bacteria 756
30 Ga0068869_100717987 3300005334 Bacteria 854
31 Ga0068869_101142694 3300005334 Bacteria 683
32 Ga0068869_101981472 3300005334 Bacteria 522
33 Ga0070666_10315485 3300005335 Bacteria 1115
34 Ga0070680_100300369 3300005336 Bacteria 1361
35 Ga0070682_100044875 3300005337 Bacteria 2738
36 Ga0070682_101891048 3300005337 Bacteria 523
37 Ga0068868_100752855 3300005338 Bacteria 875
38 Ga0070660_100445467 3300005339 Bacteria 1074
39 Ga0070689_100155064 3300005340 Bacteria 1849
40 Ga0070691_10496533 3300005341 Bacteria 705
41 Ga0070661_100047123 3300005344 Bacteria 3154
42 Ga0070661_100368280 3300005344 Bacteria 1131
43 Ga0070692_10139829 3300005345 Bacteria 1369
44 Ga0070692_11117353 3300005345 Bacteria 557
45 Ga0070668_100552366 3300005347 Bacteria 1002
46 Ga0070675_100087959 3300005354 Bacteria 2599
47 Ga0070671_100796636 3300005355 Bacteria 823
48 Ga0070673_100550824 3300005364 Bacteria 1048
49 Ga0070659_100120194 3300005366 Bacteria 2127
50 Ga0070659_100737207 3300005366 Bacteria 854
51 Ga0070667_100151938 3300005367 Bacteria 2034
52 Ga0070667_100506660 3300005367 Bacteria 1107
53 Ga0070667_100588997 3300005367 Bacteria 1024
54 Ga0070714_101860331 3300005435 Bacteria 588
55 Ga0070714_101996955 3300005435 Bacteria 566
56 Ga0070713_100153298 3300005436 Bacteria 2052
57 Ga0070713_100167303 3300005436 Bacteria 1967
58 Ga0070710_10446751 3300005437 Bacteria 875
59 Ga0070710_10585063 3300005437 Bacteria 775
60 Ga0070710_10727779 3300005437 Bacteria 702
61 Ga0070700_100038352 3300005441 Bacteria 2919
62 Ga0070700_101066788 3300005441 Bacteria 668
63 Ga0070663_100516996 3300005455 Bacteria 993
64 Ga0070678_101754387 3300005456 Bacteria 585
65 Ga0070662_100383134 3300005457 Bacteria 1158
66 Ga0070681_10577041 3300005458 Bacteria 1038
67 Ga0070681_10590690 3300005458 Bacteria 1025
68 Ga0068867_101776791 3300005459 Bacteria 579
69 Ga0070685_10581208 3300005466 Bacteria 804
70 Ga0070685_10602280 3300005466 Bacteria 791
71 Ga0070698_100666564 3300005471 Bacteria 982
72 Ga0070679_100026095 3300005530 Bacteria 5736
73 Ga0070684_100009978 3300005535 Bacteria 7506
74 Ga0070684_100118331 3300005535 Bacteria 2381
75 Ga0070684_101132554 3300005535 Bacteria 735
76 Ga0068853_100925799 3300005539 Bacteria 838
77 Ga0070672_100589222 3300005543 Bacteria 968
78 Ga0070693_100101431 3300005547 Bacteria 1754
79 Ga0070693_100272981 3300005547 Bacteria 1129
80 Ga0070665_100238397 3300005548 Bacteria 1819
81 Ga0068855_100850200 3300005563 Bacteria 967
82 Ga0070664_100156326 3300005564 Bacteria 2015
83 Ga0070664_100280909 3300005564 Bacteria 1501
84 Ga0068857_100181821 3300005577 Bacteria 1914
85 Ga0068857_100235921 3300005577 Bacteria 1673
86 Ga0068856_100781315 3300005614 Bacteria 975
87 Ga0068856_100975963 3300005614 Bacteria 866
88 Ga0068852_100776022 3300005616 Bacteria 971
89 Ga0068859_101615059 3300005617 Bacteria 716
90 Ga0068864_100607571 3300005618 Bacteria 1062
91 Ga0068864_100825021 3300005618 Bacteria 912
92 Ga0068866_10465403 3300005718 Bacteria 830
93 Ga0068861_100200476 3300005719 Bacteria 1675
94 Ga0068870_11029693 3300005840 Bacteria 588
95 Ga0068870_11415617 3300005840 Bacteria 510
96 Ga0068863_101010175 3300005841 Bacteria 835
97 Ga0068863_101131930 3300005841 Bacteria 788
98 Ga0068860_100053322 3300005843 Bacteria 3845
99 Ga0068862_100127654 3300005844 Bacteria 2247
100 Ga0081540_1003269 3300005983 Bacteria 12886
101 Ga0081540_1069048 3300005983 Bacteria 1644
102 Ga0075365_10032673 3300006038 Bacteria 3348
103 Ga0075365_10207981 3300006038 Bacteria 1372
104 Ga0075365_10241996 3300006038 Bacteria 1267
105 Ga0075365_10264968 3300006038 Bacteria 1208
106 Ga0075365_10347497 3300006038 Bacteria 1045
107 Ga0075365_10508933 3300006038 Bacteria 851
108 Ga0075365_10707868 3300006038 Bacteria 711
109 Ga0075365_10757554 3300006038 Bacteria 686
110 Ga0075365_10989763 3300006038 Bacteria 593
111 Ga0075365_10996587 3300006038 Bacteria 590
112 Ga0075368_10124175 3300006042 Bacteria 1070
113 Ga0075368_10571477 3300006042 Bacteria 510
114 Ga0075363_100069228 3300006048 Bacteria 1914
115 Ga0075363_100085915 3300006048 Bacteria 1726
116 Ga0075363_100110676 3300006048 Bacteria 1526
117 Ga0075363_100220452 3300006048 Bacteria 1087
118 Ga0075364_10038321 3300006051 Bacteria 3105
119 Ga0075364_10126258 3300006051 Bacteria 1715
120 Ga0075364_10183709 3300006051 Bacteria 1416
121 Ga0075364_10268904 3300006051 Bacteria 1159
122 Ga0075364_10738674 3300006051 Bacteria 671
123 Ga0075364_11180905 3300006051 Bacteria 519
124 Ga0075362_10492658 3300006177 Bacteria 626
125 Ga0075367_10057187 3300006178 Bacteria 2319
126 Ga0075367_10352868 3300006178 Bacteria 928
127 Ga0075367_10729442 3300006178 Bacteria 630
128 Ga0075369_10452193 3300006186 Bacteria 608
129 Ga0097621_100615904 3300006237 Bacteria 993
130 Ga0075370_10009668 3300006353 Bacteria 5019
131 Ga0075370_10535877 3300006353 Bacteria 707
132 Ga0075370_10616761 3300006353 Bacteria 657
133 Ga0068871_100659871 3300006358 Bacteria 955
134 Ga0075428_100162970 3300006844 Bacteria 2419
135 Ga0075431_100308824 3300006847 Bacteria 1597
136 Ga0075433_11708857 3300006852 Bacteria 542
137 Ga0075434_100389389 3300006871 Bacteria 1415
138 Ga0068865_100884469 3300006881 Bacteria 776
139 Ga0068865_100914761 3300006881 Bacteria 764
140 Ga0097620_101615237 3300006931 Bacteria 716
141 Ga0105244_10487256 3300009036 Bacteria 567
142 Ga0105240_11549486 3300009093 Bacteria 694
143 Ga0111539_10435835 3300009094 Bacteria 1526
144 Ga0111539_11362753 3300009094 Bacteria 823
145 Ga0105245_10989582 3300009098 Bacteria 885
146 Ga0105245_11447485 3300009098 Bacteria 737
147 Ga0105245_11652448 3300009098 Bacteria 693
148 Ga0105245_12548446 3300009098 Bacteria 565
149 Ga0105247_10847957 3300009101 Bacteria 701
150 Ga0114129_10001122 3300009147 Bacteria 35346
151 Ga0114129_10440350 3300009147 Bacteria 1711
152 Ga0105243_10149348 3300009148 Bacteria 2003
153 Ga0105243_10155862 3300009148 Bacteria 1964
154 Ga0105243_10614203 3300009148 Bacteria 1048
155 Ga0105241_12156882 3300009174 Bacteria 552
156 Ga0105248_10860999 3300009177 Bacteria 1023
157 Ga0105237_10733237 3300009545 Bacteria 994
158 Ga0105237_10876300 3300009545 Bacteria 905
159 Ga0105238_10613664 3300009551 Bacteria 1096
160 Ga0105238_10632071 3300009551 Bacteria 1080
161 Ga0105249_12290036 3300009553 Bacteria 613
162 Ga0130087_1028052 3300009828 Bacteria 682
163 Ga0130087_1053175 3300009828 Bacteria 676
164 Ga0130084_1010536 3300009835 Bacteria 682
165 Ga0130084_1040972 3300009835 Bacteria 676
166 Ga0130084_1049495 3300009835 Bacteria 682
167 Ga0130085_1014037 3300009850 Bacteria 676
168 Ga0105239_10370703 3300010375 Bacteria 1618
169 Ga0105239_12079659 3300010375 Bacteria 660
170 Ga0105239_12566068 3300010375 Bacteria 594
171 Ga0105246_11220667 3300011119 Bacteria 693
172 Ga0105246_12164934 3300011119 Bacteria 540
173 Ga0105246_12450505 3300011119 Bacteria 513
174 Ga0157373_11499225 3300013100 Bacteria 515
175 Ga0157371_10231696 3300013102 Bacteria 1327
176 Ga0157370_10079737 3300013104 Bacteria 3083
177 Ga0157369_10027973 3300013105 Bacteria 6243
178 Ga0157369_10420442 3300013105 Bacteria 1385
179 Ga0157369_10697486 3300013105 Bacteria 1045
180 Ga0157374_11135780 3300013296 Bacteria 802
181 Ga0157378_10262034 3300013297 Bacteria 1659
182 Ga0163162_11465564 3300013306 Bacteria 777
183 Ga0157372_10371132 3300013307 Bacteria 1667
184 Ga0157372_10924552 3300013307 Bacteria 1011
185 Ga0157372_10987762 3300013307 Bacteria 975
186 Ga0157375_11217814 3300013308 Bacteria 883
187 Ga0163163_10034708 3300014325 Bacteria 4887
188 Ga0163163_10140929 3300014325 Bacteria 2453
189 Ga0163163_11401778 3300014325 Bacteria 760
190 Ga0157380_10370173 3300014326 Bacteria 1348
191 Ga0157380_10415759 3300014326 Bacteria 1281
192 Ga0182008_10370141 3300014497 Bacteria 764
193 Ga0157377_10820288 3300014745 Bacteria 688
194 Ga0157379_10245570 3300014968 Bacteria 1624
195 Ga0197907_10101500 3300020069 Bacteria 2296
196 Ga0197907_11314028 3300020069 Bacteria 2491
197 Ga0206356_10199686 3300020070 Bacteria 1180
198 Ga0206356_10769382 3300020070 Bacteria 742
199 Ga0206356_11550719 3300020070 Bacteria 982
200 Ga0206349_1386282 3300020075 Bacteria 1968
201 Ga0206355_1036556 3300020076 Bacteria 595
202 Ga0206355_1060392 3300020076 Bacteria 772
203 Ga0206355_1250670 3300020076 Bacteria 515
204 Ga0206355_1267893 3300020076 Bacteria 553
205 Ga0206355_1462315 3300020076 Bacteria 942
206 Ga0206351_10669555 3300020077 Bacteria 1573
207 Ga0206352_10543542 3300020078 Bacteria 2028
208 Ga0206352_10679660 3300020078 Bacteria 1345
209 Ga0206350_11123011 3300020080 Bacteria 526
210 Ga0206350_11129481 3300020080 Bacteria 976
211 Ga0206354_10442587 3300020081 Bacteria 675
212 Ga0206354_10648032 3300020081 Bacteria 2714
213 Ga0206354_10810435 3300020081 Bacteria 601
214 Ga0206354_11384001 3300020081 Bacteria 675
215 Ga0206353_10411900 3300020082 Bacteria 1640
216 Ga0206353_10931006 3300020082 Bacteria 556
217 Ga0206353_11352359 3300020082 Bacteria 746
218 Ga0154015_1116370 3300020610 Bacteria 604
219 Ga0154015_1680304 3300020610 Bacteria 1075
220 Ga0224712_10060507 3300022467 Bacteria 1507
221 Ga0224712_10086108 3300022467 Bacteria 1307
222 Ga0224712_10146480 3300022467 Bacteria 1043
223 Ga0224712_10208044 3300022467 Bacteria 891
224 Ga0207642_10299228 3300025899 Bacteria 932
225 Ga0207688_10500831 3300025901 Bacteria 761
226 Ga0207688_11045390 3300025901 Bacteria 516
227 Ga0207680_10603915 3300025903 Bacteria 785
228 Ga0207645_10540064 3300025907 Bacteria 790
229 Ga0207643_10439274 3300025908 Bacteria 829
230 Ga0207643_10744014 3300025908 Bacteria 634
231 Ga0207654_11382142 3300025911 Bacteria 513
232 Ga0207707_10154095 3300025912 Bacteria 2009
233 Ga0207707_10663314 3300025912 Bacteria 878
234 Ga0207663_10817409 3300025916 Bacteria 743
235 Ga0207660_10223847 3300025917 Bacteria 1477
236 Ga0207657_10066312 3300025919 Bacteria 3073
237 Ga0207649_10060152 3300025920 Bacteria 2386
238 Ga0207652_10072431 3300025921 Bacteria 2996
239 Ga0207650_10140119 3300025925 Bacteria 1900
240 Ga0207650_10699827 3300025925 Bacteria 856
241 Ga0207650_10866816 3300025925 Bacteria 766
242 Ga0207700_10052088 3300025928 Bacteria 3058
243 Ga0207700_10223453 3300025928 Bacteria 1598
244 Ga0207700_11646102 3300025928 Bacteria 567
245 Ga0207664_10857125 3300025929 Bacteria 816
246 Ga0207644_10387391 3300025931 Bacteria 1141
247 Ga0207644_10872669 3300025931 Bacteria 754
248 Ga0207690_10115832 3300025932 Bacteria 1937
249 Ga0207709_10101759 3300025935 Bacteria 1901
250 Ga0207709_10369765 3300025935 Bacteria 1088
251 Ga0207670_10533858 3300025936 Bacteria 956
252 Ga0207669_10667151 3300025937 Bacteria 852
253 Ga0207704_10326340 3300025938 Bacteria 1186
254 Ga0207691_11220979 3300025940 Bacteria 623
255 Ga0207689_10160475 3300025942 Bacteria 1853
256 Ga0207689_10658457 3300025942 Bacteria 882
257 Ga0207661_10021761 3300025944 Bacteria 4811
258 Ga0207661_10029024 3300025944 Bacteria 4244
259 Ga0207661_10634726 3300025944 Bacteria 981
260 Ga0207661_10864732 3300025944 Bacteria 833
261 Ga0207679_10054550 3300025945 Bacteria 2943
262 Ga0207667_10593786 3300025949 Bacteria 1117
263 Ga0207712_10797487 3300025961 Bacteria 830
264 Ga0207668_10016140 3300025972 Bacteria 4655
265 Ga0207640_11626555 3300025981 Bacteria 582
266 Ga0207658_10016364 3300025986 Bacteria 5102
267 Ga0207658_10027877 3300025986 Bacteria 3973
268 Ga0207677_10242014 3300026023 Bacteria 1460
269 Ga0207703_10074021 3300026035 Bacteria 2819
270 Ga0207639_10732507 3300026041 Bacteria 919
271 Ga0207678_10162098 3300026067 Bacteria 1909
272 Ga0207678_10918762 3300026067 Bacteria 774
273 Ga0207708_10060055 3300026075 Bacteria 2902
274 Ga0207702_10483737 3300026078 Bacteria 1205
275 Ga0207702_11351263 3300026078 Bacteria 706
276 Ga0207641_10830076 3300026088 Bacteria 915
277 Ga0207641_11229409 3300026088 Bacteria 749
278 Ga0207641_11910108 3300026088 Bacteria 595
279 Ga0207676_10380172 3300026095 Bacteria 1314
280 Ga0207674_10023143 3300026116 Bacteria 6661
281 Ga0207674_10218941 3300026116 Bacteria 1852
282 Ga0207674_11253877 3300026116 Bacteria 711
283 Ga0207675_100094847 3300026118 Bacteria 2807
284 Ga0207675_100535994 3300026118 Bacteria 1168
285 Ga0207675_101748803 3300026118 Bacteria 641
286 Ga0207683_10623848 3300026121 Bacteria 998
287 Ga0209813_10068974 3300027866 Bacteria 1145
288 Ga0207428_10386197 3300027907 Bacteria 1026
289 Ga0268265_12048119 3300028380 Bacteria 579
290 Ga0268264_10000402 3300028381 Bacteria 61871
291 Ga0268264_10196204 3300028381 Bacteria 1843
292 Ga0265337_1130616 3300028556 Bacteria 681
293 Ga0316183_1020906 3300030742 Bacteria 520
294 Ga0316181_1263273 3300030744 Bacteria 1380
295 Ga0265328_10009721 3300031239 Bacteria 3905
296 Ga0265327_10000021 3300031251 Bacteria 417788
297 Ga0307509_10039438 3300031507 Bacteria 5147
298 Ga0307408_101069055 3300031548 Bacteria 747
299 Ga0307508_10180901 3300031616 Bacteria 1711
300 Ga0307405_10271074 3300031731 Bacteria 1273
301 Ga0307413_10436773 3300031824 Bacteria 1035
302 Ga0307410_10035217 3300031852 Bacteria 3249
303 Ga0307410_10676648 3300031852 Bacteria 868
304 Ga0307410_10912311 3300031852 Bacteria 753
305 Ga0307410_11240880 3300031852 Bacteria 650
306 Ga0307406_11624444 3300031901 Bacteria 571
307 Ga0307407_10170440 3300031903 Bacteria 1433
308 Ga0307407_10480194 3300031903 Bacteria 907
309 Ga0307407_11545492 3300031903 Bacteria 526
310 Ga0307412_10273570 3300031911 Bacteria 1323
311 Ga0307409_100018650 3300031995 Bacteria 4673
312 Ga0307409_100655066 3300031995 Bacteria 1044
313 Ga0307409_101607682 3300031995 Bacteria 678
314 Ga0307416_100245360 3300032002 Bacteria 1739
315 Ga0307416_100922297 3300032002 Bacteria 974
316 Ga0307416_100953743 3300032002 Bacteria 960
317 Ga0307416_101056548 3300032002 Bacteria 916
318 Ga0307416_101674181 3300032002 Bacteria 741
319 Ga0307416_101796861 3300032002 Bacteria 717
320 Ga0307414_10311067 3300032004 Bacteria 1337
321 Ga0307414_10774584 3300032004 Bacteria 873
322 Ga0307414_11888555 3300032004 Bacteria 557
323 Ga0307411_10210631 3300032005 Bacteria 1500
324 Ga0307411_10541402 3300032005 Bacteria 992
325 Ga0307415_100199990 3300032126 Bacteria 1585
326 Ga0307415_100272525 3300032126 Bacteria 1387
327 Ga0307415_100312942 3300032126 Bacteria 1306
328 Ga0307415_100361367 3300032126 Bacteria 1226
329 Ga0307415_100499925 3300032126 Bacteria 1063
330 Ga0307415_100583360 3300032126 Bacteria 992
331 Ga0307415_100594240 3300032126 Bacteria 984
332 Ga0307415_101873292 3300032126 Bacteria 582
333 Ga0373945_0405011 3300035116 Bacteria 598
334 Ga0395899_0262960 3300037312 Bacteria 1179
335 Ga0395900_0009580 3300037418 Bacteria 9929
336 Ga0395900_0365399 3300037418 Bacteria 1414
337 Ga0395900_1845447 3300037418 Bacteria 515
338 Ga0395898_0036553 3300037466 Bacteria 4876
339 Ga0395905_0003316 3300037471 Bacteria 17275
340 Ga0395905_0519775 3300037471 Bacteria 1091
341 Ga0395905_1587402 3300037471 Bacteria 559
342 Ga0395901_0046176 3300038443 Bacteria 4523
343 Ga0395901_0061102 3300038443 Bacteria 3921
344 Ga0439466_0074373 3300041411 Bacteria 1078
345 Ga0439465_0212221 3300041413 Bacteria 708
346 Ga0451787_032963 3300041441 Bacteria 561
347 Ga0451789_0623947 3300041443 Bacteria 837
348 Ga0451791_1284756 3300041451 Bacteria 888
349 Ga0451793_0672536 3300041452 Bacteria 1277
350 Ga0451795_1604069 3300041456 Bacteria 768
351 Ga0451802_1034014 3300041460 Bacteria 520
352 Ga0451802_1142222 3300041460 Bacteria 527
353 Ga0451806_766117 3300041462 Bacteria 562
354 Ga0451833_0557031 3300041491 Bacteria 595
355 Ga0451833_0583816 3300041491 Bacteria 834
356 Ga0451837_0152106 3300041494 Bacteria 1270
357 Ga0451841_1264280 3300041498 Bacteria 1280
358 Ga0451845_0602073 3300041501 Bacteria 769
359 Ga0451843_1264702 3300041509 Bacteria 676
360 Ga0451843_1613861 3300041509 Bacteria 1220
361 Ga0451853_0135761 3300041512 Bacteria 1201
362 Ga0451853_1342949 3300041512 Bacteria 567
363 Ga0451853_3059727 3300041512 Bacteria 569
364 Ga0439432_251067 3300042006 Bacteria 507
365 Ga0450898_040174 3300042134 Bacteria 883
366 Ga0439434_0192868 3300042435 Bacteria 685
367 Ga0466972_0284112 3300044658 Bacteria 773
368 Ga0466972_0326701 3300044658 Bacteria 717
369 Ga0466965_0040997 3300044683 Bacteria 2280
370 Ga0466966_0201945 3300044684 Bacteria 1203
371 Ga0466961_0071892 3300044693 Bacteria 2195
372 Ga0466963_0380478 3300044694 Bacteria 995
373 Ga0466970_0042734 3300044765 Bacteria 2410
374 Ga0466970_0201903 3300044765 Bacteria 1106
375 Ga0466970_0358083 3300044765 Bacteria 828
376 Ga0466957_0239879 3300044842 Bacteria 1202
377 Ga0466957_0652344 3300044842 Bacteria 740
378 Ga0466960_0054464 3300044901 Bacteria 1942
379 Ga0466960_0409804 3300044901 Bacteria 782
380 Ga0466960_0839716 3300044901 Bacteria 558
381 Ga0466967_0304869 3300045976 Bacteria 1533
382 Ga0466967_1964959 3300045976 Bacteria 582
383 Ga0466967_2087792 3300045976 Bacteria 563
384 Ga0495603_0320205 3300046455 Bacteria 890
385 Ga0495629_0709352 3300046459 Bacteria 668
386 Ga0495594_0041251 3300046499 Bacteria 2527
387 Ga0495622_0520276 3300046557 Bacteria 508
388 Ga0495668_0706886 3300046616 Bacteria 558
389 Ga0496104_0241747 3300048907 Bacteria 1718
390 Ga0496105_0738033 3300048908 Bacteria 753
391 Ga0496110_0923600 3300048913 Bacteria 779
392 Ga0496111_0967809 3300048914 Bacteria 611
393 Ga0496112_0118924 3300048915 Bacteria 2612
394 Ga0496113_0472739 3300048916 Bacteria 1007
395 Ga0496119_0233510 3300048922 Bacteria 935
396 Ga0501315_010755 3300049531 Bacteria 1106
397 Ga0501031_0070543 3300049568 Bacteria 2276
398 Ga0501031_0807218 3300049568 Bacteria 601
399 Ga0501032_0042024 3300049569 Bacteria 3102
400 Ga0501032_1041538 3300049569 Bacteria 513
401 Ga0501034_0007412 3300049571 Bacteria 11677
402 Ga0501036_0003240 3300049572 Bacteria 12976
403 Ga0501036_0415028 3300049572 Bacteria 1122
404 Ga0501038_0000703 3300049574 Bacteria 29849
405 Ga0501038_0223744 3300049574 Bacteria 1500
406 Ga0501039_1433083 3300049575 Bacteria 531
407 Ga0501040_0077914 3300049576 Bacteria 2293
408 Ga0501040_0290002 3300049576 Bacteria 1169
409 Ga0501041_0128470 3300049577 Bacteria 1579
410 Ga0501042_0039963 3300049578 Bacteria 3335
411 Ga0501042_0160693 3300049578 Bacteria 1621
412 Ga0501042_0231712 3300049578 Bacteria 1332
413 Ga0501046_0143905 3300049580 Bacteria 1802
414 Ga0501047_0035779 3300049581 Bacteria 4797
415 Ga0501048_0065181 3300049582 Bacteria 2576
416 Ga0501048_0434344 3300049582 Bacteria 940
417 Ga0501068_0104674 3300049584 Bacteria 1756
418 Ga0501068_0158967 3300049584 Bacteria 1424
419 Ga0501069_0100462 3300049585 Bacteria 1642
420 Ga0501070_1205694 3300049586 Bacteria 581
421 Ga0501072_0105065 3300049588 Bacteria 2246
422 Ga0501073_0030163 3300049589 Bacteria 3873
423 Ga0501074_0622155 3300049590 Bacteria 763
424 Ga0501075_0135129 3300049591 Bacteria 1879
425 Ga0501076_0067042 3300049592 Bacteria 2866
426 Ga0501076_0819037 3300049592 Bacteria 768
427 Ga0501235_055924 3300049669 Bacteria 920
428 Ga0501080_1313983 3300049742 Bacteria 619
429 Ga0501081_0680537 3300049743 Bacteria 772
430 Ga0501035_0004179 3300049822 Bacteria 13724
431 Ga0501044_1362748 3300049823 Bacteria 575
432 Ga0501045_1252598 3300049824 Bacteria 540
433 Ga0501204_028876 3300049850 Bacteria 761
434 nmdc:mga03n38_164471_c1 3300050490 Bacteria 1126
435 nmdc:mga03n38_52606_c1 3300050490 Bacteria 1823
436 nmdc:mga03n38_863268_c1 3300050490 Bacteria 530
437 nmdc:mga00v17_12991_c1 3300050491 Bacteria 4612
438 nmdc:mga00v17_467245_c1 3300050491 Bacteria 819
439 nmdc:mga00v17_63839_c1 3300050491 Bacteria 2269
440 nmdc:mga00v17_66962_c1 3300050491 Bacteria 2218
441 nmdc:mga00v17_883162_c1 3300050491 Bacteria 567
442 nmdc:mga0yw44_117837_c1 3300050492 Bacteria 1708
443 nmdc:mga0yw44_15072_c1 3300050492 Bacteria 4128
444 nmdc:mga0yw44_161568_c1 3300050492 Bacteria 1467
445 nmdc:mga0yw44_26138_c1 3300050492 Bacteria 3330
446 nmdc:mga0yw44_344672_c1 3300050492 Bacteria 1002
447 nmdc:mga0yw44_359715_c1 3300050492 Bacteria 981
448 nmdc:mga0yw44_543359_c1 3300050492 Bacteria 789
449 nmdc:mga0yw44_574525_c1 3300050492 Bacteria 766
450 nmdc:mga0yw44_882704_c1 3300050492 Bacteria 607
451 nmdc:mga0yw44_95967_c1 3300050492 Bacteria 1882
452 nmdc:mga06z11_117743_c1 3300050494 Bacteria 1479
453 nmdc:mga06z11_335811_c1 3300050494 Bacteria 903
454 nmdc:mga06z11_826143_c1 3300050494 Bacteria 565
455 nmdc:mga04h51_346562_c1 3300050495 Bacteria 613
456 nmdc:mga07m45_54148_c1 3300050496 Bacteria 2268
457 nmdc:mga05p37_452_c1 3300050507 Bacteria 44614
458 nmdc:mga06r32_365634_c1 3300050510 Bacteria 1426
459 nmdc:mga08y16_493468_c1 3300050511 Bacteria 1245
460 nmdc:mga0n895_426469_c1 3300050512 Bacteria 1340
461 nmdc:mga0a205_1155740_c1 3300050515 Bacteria 622
462 nmdc:mga0sz30_94418_c1 3300050516 Bacteria 1303
463 Ga0500578_0411945 3300053086 Bacteria 777
464 Ga0500554_128264 3300053102 Bacteria 856
465 Ga0500573_0510072 3300053140 Bacteria 541
466 Ga0501084_0599394 3300054114 Bacteria 931
467 Ga0590075_150764 3300059424 Bacteria 613
468 Ga0587084_073881 3300059477 Bacteria 649
469 Ga0587084_080094 3300059477 Bacteria 631
470 Ga0587066_062482 3300059490 Bacteria 764
471 Ga0587066_075278 3300059490 Bacteria 720
472 Ga0587070_072791 3300059491 Bacteria 737
473 Ga0587070_090084 3300059491 Bacteria 688
474 Ga0587070_092560 3300059491 Bacteria 682
475 Ga0587073_0286514 3300059492 Bacteria 531
476 Ga0587073_0333376 3300059492 Bacteria 504
477 Ga0587077_071077 3300059493 Bacteria 777
478 Ga0587077_129579 3300059493 Bacteria 639
479 Ga0587080_074635 3300059503 Bacteria 685
480 Ga0587080_087679 3300059503 Bacteria 648
481 Ga0587082_045240 3300059504 Bacteria 821
482 Ga0587082_111004 3300059504 Bacteria 609
483 Ga0587082_112083 3300059504 Bacteria 607
484 Ga0587083_0107862 3300059505 Bacteria 703
485 Ga0587083_0223943 3300059505 Bacteria 548
486 Ga0587085_042028 3300059506 Bacteria 801
487 Ga0587085_112495 3300059506 Bacteria 588
488 Ga0587085_131156 3300059506 Bacteria 560
489 Ga0587086_008483 3300059507 Bacteria 1202
490 Ga0587086_033949 3300059507 Bacteria 763
491 Ga0587088_070031 3300059508 Bacteria 729
492 Ga0587088_125764 3300059508 Bacteria 598
493 Ga0587088_205747 3300059508 Bacteria 505
494 Ga0587090_036722 3300059510 Bacteria 845
495 Ga0587090_047035 3300059510 Bacteria 779
496 Ga0587091_085297 3300059511 Bacteria 716
497 Ga0587091_102997 3300059511 Bacteria 672
498 Ga0587091_192805 3300059511 Bacteria 543
499 Ga0587092_089984 3300059512 Bacteria 618
500 Ga0587094_047604 3300059513 Bacteria 717
501 Ga0587095_042168 3300059514 Bacteria 501
502 Ga0587106_058246 3300059605 Bacteria 703
503 Ga0587101_075461 3300059623 Bacteria 629
504 Ga0587101_124278 3300059623 Bacteria 537
505 Ga0587109_055856 3300059624 Bacteria 820
506 Ga0587109_198820 3300059624 Bacteria 521
507 Ga0587109_214709 3300059624 Bacteria 507
508 Ga0587113_024919 3300059625 Bacteria 651
509 Ga0587115_069680 3300059626 Bacteria 605
510 Ga0587117_029615 3300059627 Bacteria 818
511 Ga0587122_039167 3300059628 Bacteria 584
512 Ga0587127_012889 3300059629 Bacteria 675
513 Ga0587062_048840 3300059639 Bacteria 710
514 Ga0587062_083145 3300059639 Bacteria 598
515 Ga0587067_083326 3300059640 Bacteria 712
516 Ga0587067_147650 3300059640 Bacteria 588
517 Ga0587068_106487 3300059641 Bacteria 594
518 Ga0587068_141400 3300059641 Bacteria 538
519 Ga0587069_129446 3300059642 Bacteria 543
520 Ga0587072_101116 3300059643 Bacteria 647
521 Ga0587072_148248 3300059643 Bacteria 565
522 Ga0587075_044454 3300059644 Bacteria 756
523 Ga0587075_045718 3300059644 Bacteria 749
524 Ga0587076_123106 3300059645 Bacteria 603
525 Ga0587078_028429 3300059646 Bacteria 743
526 Ga0587078_030372 3300059646 Bacteria 726
527 Ga0587079_053105 3300059647 Bacteria 856
528 Ga0587079_086110 3300059647 Bacteria 727
529 Ga0587100_027807 3300059648 Bacteria 586
530 Ga0587102_043316 3300059649 Bacteria 587
531 Ga0587108_023884 3300059653 Bacteria 595
532 Ga0587114_050919 3300059655 Bacteria 701
533 Ga0587119_047662 3300059658 Bacteria 632
534 Ga0587119_064853 3300059658 Bacteria 570
535 Ga0587071_070381 3300060344 Bacteria 761
536 Ga0587071_071219 3300060344 Bacteria 757
537 Ga0587071_097376 3300060344 Bacteria 676
538 Ga0587071_101130 3300060344 Bacteria 667
539 Ga0587111_0152696 3300060346 Bacteria 621
540 Ga0587111_0163364 3300060346 Bacteria 607
541 Ga0587111_0258022 3300060346 Bacteria 518
542 Ga0501082_0250806 3300060353 Bacteria 1540
543 Ga0530510_0143438 3300061734 Bacteria 1761
544 Ga0530510_0155290 3300061734 Bacteria 1691
545 2501944228 2501939600 Bacteria 6907073
546 2515495153 2515154088 Bacteria 5526283
547 2515719153 2515154129 Bacteria 5584369
548 2515754892 2515154137 Bacteria 5711575
549 2516083360 2515154202 Bacteria 5471270
550 2516088535 2515154203 Bacteria 5458536
551 2523386871 2523231044 Bacteria 6434991
552 2644089580 2643221615 Bacteria 5487866
553 2644228883 2643221641 Bacteria 4490190
554 2644319425 2643221657 Bacteria 5490246
555 2676483570 2675903059 Bacteria 8644972
556 2740167006 2739367898 Bacteria 4367674
557 2753038094 2751185725 Bacteria 5740550
558 2753268293 2751185782 Bacteria 11227053
559 2753326605 2751185792 Bacteria 5739090
560 2772644221 2772190715 Bacteria 6959372
561 2795783309 2795385470 Bacteria 8317180
562 2831936273 2831935698 Bacteria 5963223
563 2832010496 2832004796 Bacteria 6538017
564 2855387807 2855386786 Bacteria 4752232
565 2855676453 2855670206 Bacteria 7120389
566 2855678625 2855676851 Bacteria 7063653
567 2855684708 2855683550 Bacteria 7134265
568 2856864466 2856858025 Bacteria 7255264
569 2857294585 2857288857 Bacteria 7189066
570 2858872336 2858868258 Bacteria 7683772
571 2858888709 2858882152 Bacteria 7230291
572 2858888963 2858888857 Bacteria 7060307
573 2858897443 2858895516 Bacteria 7378898
574 2858905738 2858902515 Bacteria 7086037
575 2866066469 2866065130 Bacteria 6518152
576 2867303556 2867302475 Bacteria 7087181
577 2867316092 2867312974 Bacteria 7058875
578 2867320958 2867319477 Bacteria 7069771
579 2867511790 2867507094 Bacteria 6506033
580 2869050188 2869048445 Bacteria 6875584
581 2869062120 2869061728 Bacteria 7112407
582 2869074201 2869068681 Bacteria 7205615
583 2880489699 2880489317 Bacteria 7096270
584 2880496003 2880495981 Bacteria 7340502
585 2902583453 2902582711 Bacteria 6187705
586 2929224677 2929219909 Bacteria 6984360
587 2929232382 2929226422 Bacteria 7248583
588 2984580608 2984576629 Bacteria 4248407
589 2990258300 2990256926 Bacteria 4252839
590 2996227588 2996221748 Bacteria 6799777
591 649814006 649633069 Bacteria 6962533
592 8003832486 8003830390 Bacteria 6541657
593 8003863741 8003856774 Bacteria 7675274
594 8003876598 8003870546 Bacteria 7396674
595 8054612742 8054609563 Bacteria 5170090
596 8054732768 8054727385 Bacteria 7558670
597 8054737958 8054734606 Bacteria 6947278
598 8055416242 8055412473 Bacteria 6257500
599 Ga0075365_10308883
600 Ga0006759J45824_1068341
601 Ga0007410J51695_1053857
602 Ga0007410J51695_1061087
603 Ga0007410J51695_1119329
604 Ga0007416J51690_1094464
605 Ga0007416J51690_1114385
606 Ga0007429J51699_1078057
607 Ga0032354_1079464
608 Ga0032354_1081598
609 Ga0058863_10066423
610 Ga0058863_10149005
611 Ga0058863_11957479
612 Ga0058861_10046601
613 Ga0058861_10082252
614 Ga0058861_11982199
615 Ga0058861_12059564
616 Ga0058860_10104110
617 Ga0058862_10114501
618 Ga0058862_12794759
619 Ga0058862_12856072
620 Ga0070658_10031352
621 Ga0070683_100100177
622 Ga0070683_100117319
623 Ga0070683_100603312
624 Ga0070683_101437647
625 Ga0070690_100584271
626 Ga0070670_100822233
627 Ga0070670_101011884
628 Ga0068869_100717987
629 Ga0068869_101142694
630 Ga0068869_101981472
631 Ga0070666_10315485
632 Ga0070680_100300369
633 Ga0070682_100044875
634 Ga0070682_101891048
635 Ga0068868_100752855
636 Ga0070660_100445467
637 Ga0070689_100155064
638 Ga0070691_10496533
639 Ga0070661_100047123
640 Ga0070661_100368280
641 Ga0070692_10139829
642 Ga0070692_11117353
643 Ga0070668_100552366
644 Ga0070675_100087959
645 Ga0070671_100796636
646 Ga0070673_100550824
647 Ga0070659_100120194
648 Ga0070659_100737207
649 Ga0070667_100151938
650 Ga0070667_100506660
651 Ga0070667_100588997
652 Ga0070714_101860331
653 Ga0070714_101996955
654 Ga0070713_100153298
655 Ga0070713_100167303
656 Ga0070710_10446751
657 Ga0070710_10585063
658 Ga0070710_10727779
659 Ga0070700_100038352
660 Ga0070700_101066788
661 Ga0070663_100516996
662 Ga0070678_101754387
663 Ga0070662_100383134
664 Ga0070681_10577041
665 Ga0070681_10590690
666 Ga0068867_101776791
667 Ga0070685_10581208
668 Ga0070685_10602280
669 Ga0070698_100666564
670 Ga0070679_100026095
671 Ga0070684_100009978
672 Ga0070684_100118331
673 Ga0070684_101132554
674 Ga0068853_100925799
675 Ga0070672_100589222
676 Ga0070693_100101431
677 Ga0070693_100272981
678 Ga0070665_100238397
679 Ga0068855_100850200
680 Ga0070664_100156326
681 Ga0070664_100280909
682 Ga0068857_100181821
683 Ga0068857_100235921
684 Ga0068856_100781315
685 Ga0068856_100975963
686 Ga0068852_100776022
687 Ga0068859_101615059
688 Ga0068864_100607571
689 Ga0068864_100825021
690 Ga0068866_10465403
691 Ga0068861_100200476
692 Ga0068870_11029693
693 Ga0068870_11415617
694 Ga0068863_101010175
695 Ga0068863_101131930
696 Ga0068860_100053322
697 Ga0068862_100127654
698 Ga0081540_1003269
699 Ga0081540_1069048
700 Ga0075365_10032673
701 Ga0075365_10207981
702 Ga0075365_10241996
703 Ga0075365_10264968
704 Ga0075365_10347497
705 Ga0075365_10508933
706 Ga0075365_10707868
707 Ga0075365_10757554
708 Ga0075365_10989763
709 Ga0075365_10996587
710 Ga0075368_10124175
711 Ga0075368_10571477
712 Ga0075363_100069228
713 Ga0075363_100085915
714 Ga0075363_100110676
715 Ga0075363_100220452
716 Ga0075364_10038321
717 Ga0075364_10126258
718 Ga0075364_10183709
719 Ga0075364_10268904
720 Ga0075364_10738674
721 Ga0075364_11180905
722 Ga0075362_10492658
723 Ga0075367_10057187
724 Ga0075367_10352868
725 Ga0075367_10729442
726 Ga0075369_10452193
727 Ga0097621_100615904
728 Ga0075370_10009668
729 Ga0075370_10535877
730 Ga0075370_10616761
731 Ga0068871_100659871
732 Ga0075428_100162970
733 Ga0075431_100308824
734 Ga0075433_11708857
735 Ga0075434_100389389
736 Ga0068865_100884469
737 Ga0068865_100914761
738 Ga0097620_101615237
739 Ga0105244_10487256
740 Ga0105240_11549486
741 Ga0111539_10435835
742 Ga0111539_11362753
743 Ga0105245_10989582
744 Ga0105245_11447485
745 Ga0105245_11652448
746 Ga0105245_12548446
747 Ga0105247_10847957
748 Ga0114129_10001122
749 Ga0114129_10440350
750 Ga0105243_10149348
751 Ga0105243_10155862
752 Ga0105243_10614203
753 Ga0105241_12156882
754 Ga0105248_10860999
755 Ga0105237_10733237
756 Ga0105237_10876300
757 Ga0105238_10613664
758 Ga0105238_10632071
759 Ga0105249_12290036
760 Ga0130087_1028052
761 Ga0130087_1053175
762 Ga0130084_1010536
763 Ga0130084_1040972
764 Ga0130084_1049495
765 Ga0130085_1014037
766 Ga0105239_10370703
767 Ga0105239_12079659
768 Ga0105239_12566068
769 Ga0105246_11220667
770 Ga0105246_12164934
771 Ga0105246_12450505
772 Ga0157373_11499225
773 Ga0157371_10231696
774 Ga0157370_10079737
775 Ga0157369_10027973
776 Ga0157369_10420442
777 Ga0157369_10697486
778 Ga0157374_11135780
779 Ga0157378_10262034
780 Ga0163162_11465564
781 Ga0157372_10371132
782 Ga0157372_10924552
783 Ga0157372_10987762
784 Ga0157375_11217814
785 Ga0163163_10034708
786 Ga0163163_10140929
787 Ga0163163_11401778
788 Ga0157380_10370173
789 Ga0157380_10415759
790 Ga0182008_10370141
791 Ga0157377_10820288
792 Ga0157379_10245570
793 Ga0197907_10101500
794 Ga0197907_11314028
795 Ga0206356_10199686
796 Ga0206356_10769382
797 Ga0206356_11550719
798 Ga0206349_1386282
799 Ga0206355_1036556
800 Ga0206355_1060392
801 Ga0206355_1250670
802 Ga0206355_1267893
803 Ga0206355_1462315
804 Ga0206351_10669555
805 Ga0206352_10543542
806 Ga0206352_10679660
807 Ga0206350_11123011
808 Ga0206350_11129481
809 Ga0206354_10442587
810 Ga0206354_10648032
811 Ga0206354_10810435
812 Ga0206354_11384001
813 Ga0206353_10411900
814 Ga0206353_10931006
815 Ga0206353_11352359
816 Ga0154015_1116370
817 Ga0154015_1680304
818 Ga0224712_10060507
819 Ga0224712_10086108
820 Ga0224712_10146480
821 Ga0224712_10208044
822 Ga0207642_10299228
823 Ga0207688_10500831
824 Ga0207688_11045390
825 Ga0207680_10603915
826 Ga0207645_10540064
827 Ga0207643_10439274
828 Ga0207643_10744014
829 Ga0207654_11382142
830 Ga0207707_10154095
831 Ga0207707_10663314
832 Ga0207663_10817409
833 Ga0207660_10223847
834 Ga0207657_10066312
835 Ga0207649_10060152
836 Ga0207652_10072431
837 Ga0207650_10140119
838 Ga0207650_10699827
839 Ga0207650_10866816
840 Ga0207700_10052088
841 Ga0207700_10223453
842 Ga0207700_11646102
843 Ga0207664_10857125
844 Ga0207644_10387391
845 Ga0207644_10872669
846 Ga0207690_10115832
847 Ga0207709_10101759
848 Ga0207709_10369765
849 Ga0207670_10533858
850 Ga0207669_10667151
851 Ga0207704_10326340
852 Ga0207691_11220979
853 Ga0207689_10160475
854 Ga0207689_10658457
855 Ga0207661_10021761
856 Ga0207661_10029024
857 Ga0207661_10634726
858 Ga0207661_10864732
859 Ga0207679_10054550
860 Ga0207667_10593786
861 Ga0207712_10797487
862 Ga0207668_10016140
863 Ga0207640_11626555
864 Ga0207658_10016364
865 Ga0207658_10027877
866 Ga0207677_10242014
867 Ga0207703_10074021
868 Ga0207639_10732507
869 Ga0207678_10162098
870 Ga0207678_10918762
871 Ga0207708_10060055
872 Ga0207702_10483737
873 Ga0207702_11351263
874 Ga0207641_10830076
875 Ga0207641_11229409
876 Ga0207641_11910108
877 Ga0207676_10380172
878 Ga0207674_10023143
879 Ga0207674_10218941
880 Ga0207674_11253877
881 Ga0207675_100094847
882 Ga0207675_100535994
883 Ga0207675_101748803
884 Ga0207683_10623848
885 Ga0209813_10068974
886 Ga0207428_10386197
887 Ga0268265_12048119
888 Ga0268264_10000402
889 Ga0268264_10196204
890 Ga0265337_1130616
891 Ga0316183_1020906
892 Ga0316181_1263273
893 Ga0265328_10009721
894 Ga0265327_10000021
895 Ga0307509_10039438
896 Ga0307408_101069055
897 Ga0307508_10180901
898 Ga0307405_10271074
899 Ga0307413_10436773
900 Ga0307410_10035217
901 Ga0307410_10676648
902 Ga0307410_10912311
903 Ga0307410_11240880
904 Ga0307406_11624444
905 Ga0307407_10170440
906 Ga0307407_10480194
907 Ga0307407_11545492
908 Ga0307412_10273570
909 Ga0307409_100018650
910 Ga0307409_100655066
911 Ga0307409_101607682
912 Ga0307416_100245360
913 Ga0307416_100922297
914 Ga0307416_100953743
915 Ga0307416_101056548
916 Ga0307416_101674181
917 Ga0307416_101796861
918 Ga0307414_10311067
919 Ga0307414_10774584
920 Ga0307414_11888555
921 Ga0307411_10210631
922 Ga0307411_10541402
923 Ga0307415_100199990
924 Ga0307415_100272525
925 Ga0307415_100312942
926 Ga0307415_100361367
927 Ga0307415_100499925
928 Ga0307415_100583360
929 Ga0307415_100594240
930 Ga0307415_101873292
931 Ga0373945_0405011
932 Ga0395899_0262960
933 Ga0395900_0009580
934 Ga0395900_0365399
935 Ga0395900_1845447
936 Ga0395898_0036553
937 Ga0395905_0003316
938 Ga0395905_0519775
939 Ga0395905_1587402
940 Ga0395901_0046176
941 Ga0395901_0061102
942 Ga0439466_0074373
943 Ga0439465_0212221
944 Ga0451787_032963
945 Ga0451789_0623947
946 Ga0451791_1284756
947 Ga0451793_0672536
948 Ga0451795_1604069
949 Ga0451802_1034014
950 Ga0451802_1142222
951 Ga0451806_766117
952 Ga0451833_0557031
953 Ga0451833_0583816
954 Ga0451837_0152106
955 Ga0451841_1264280
956 Ga0451845_0602073
957 Ga0451843_1264702
958 Ga0451843_1613861
959 Ga0451853_0135761
960 Ga0451853_1342949
961 Ga0451853_3059727
962 Ga0439432_251067
963 Ga0450898_040174
964 Ga0439434_0192868
965 Ga0466972_0284112
966 Ga0466972_0326701
967 Ga0466965_0040997
968 Ga0466966_0201945
969 Ga0466961_0071892
970 Ga0466963_0380478
971 Ga0466970_0042734
972 Ga0466970_0201903
973 Ga0466970_0358083
974 Ga0466957_0239879
975 Ga0466957_0652344
976 Ga0466960_0054464
977 Ga0466960_0409804
978 Ga0466960_0839716
979 Ga0466967_0304869
980 Ga0466967_1964959
981 Ga0466967_2087792
982 Ga0495603_0320205
983 Ga0495629_0709352
984 Ga0495594_0041251
985 Ga0495622_0520276
986 Ga0495668_0706886
987 Ga0496104_0241747
988 Ga0496105_0738033
989 Ga0496110_0923600
990 Ga0496111_0967809
991 Ga0496112_0118924
992 Ga0496113_0472739
993 Ga0496119_0233510
994 Ga0501315_010755
995 Ga0501031_0070543
996 Ga0501031_0807218
997 Ga0501032_0042024
998 Ga0501032_1041538
999 Ga0501034_0007412
1000 Ga0501036_0003240
1001 Ga0501036_0415028
1002 Ga0501038_0000703
1003 Ga0501038_0223744
1004 Ga0501039_1433083
1005 Ga0501040_0077914
1006 Ga0501040_0290002
1007 Ga0501041_0128470
1008 Ga0501042_0039963
1009 Ga0501042_0160693
1010 Ga0501042_0231712
1011 Ga0501046_0143905
1012 Ga0501047_0035779
1013 Ga0501048_0065181
1014 Ga0501048_0434344
1015 Ga0501068_0104674
1016 Ga0501068_0158967
1017 Ga0501069_0100462
1018 Ga0501070_1205694
1019 Ga0501072_0105065
1020 Ga0501073_0030163
1021 Ga0501074_0622155
1022 Ga0501075_0135129
1023 Ga0501076_0067042
1024 Ga0501076_0819037
1025 Ga0501235_055924
1026 Ga0501080_1313983
1027 Ga0501081_0680537
1028 Ga0501035_0004179
1029 Ga0501044_1362748
1030 Ga0501045_1252598
1031 Ga0501204_028876
1032 nmdc:mga03n38_164471_c1
1033 nmdc:mga03n38_52606_c1
1034 nmdc:mga03n38_863268_c1
1035 nmdc:mga00v17_12991_c1
1036 nmdc:mga00v17_467245_c1
1037 nmdc:mga00v17_63839_c1
1038 nmdc:mga00v17_66962_c1
1039 nmdc:mga00v17_883162_c1
1040 nmdc:mga0yw44_117837_c1
1041 nmdc:mga0yw44_15072_c1
1042 nmdc:mga0yw44_161568_c1
1043 nmdc:mga0yw44_26138_c1
1044 nmdc:mga0yw44_344672_c1
1045 nmdc:mga0yw44_359715_c1
1046 nmdc:mga0yw44_543359_c1
1047 nmdc:mga0yw44_574525_c1
1048 nmdc:mga0yw44_882704_c1
1049 nmdc:mga0yw44_95967_c1
1050 nmdc:mga06z11_117743_c1
1051 nmdc:mga06z11_335811_c1
1052 nmdc:mga06z11_826143_c1
1053 nmdc:mga04h51_346562_c1
1054 nmdc:mga07m45_54148_c1
1055 nmdc:mga05p37_452_c1
1056 nmdc:mga06r32_365634_c1
1057 nmdc:mga08y16_493468_c1
1058 nmdc:mga0n895_426469_c1
1059 nmdc:mga0a205_1155740_c1
1060 nmdc:mga0sz30_94418_c1
1061 Ga0500578_0411945
1062 Ga0500554_128264
1063 Ga0500573_0510072
1064 Ga0501084_0599394
1065 Ga0590075_150764
1066 Ga0587084_073881
1067 Ga0587084_080094
1068 Ga0587066_062482
1069 Ga0587066_075278
1070 Ga0587070_072791
1071 Ga0587070_090084
1072 Ga0587070_092560
1073 Ga0587073_0286514
1074 Ga0587073_0333376
1075 Ga0587077_071077
1076 Ga0587077_129579
1077 Ga0587080_074635
1078 Ga0587080_087679
1079 Ga0587082_045240
1080 Ga0587082_111004
1081 Ga0587082_112083
1082 Ga0587083_0107862
1083 Ga0587083_0223943
1084 Ga0587085_042028
1085 Ga0587085_112495
1086 Ga0587085_131156
1087 Ga0587086_008483
1088 Ga0587086_033949
1089 Ga0587088_070031
1090 Ga0587088_125764
1091 Ga0587088_205747
1092 Ga0587090_036722
1093 Ga0587090_047035
1094 Ga0587091_085297
1095 Ga0587091_102997
1096 Ga0587091_192805
1097 Ga0587092_089984
1098 Ga0587094_047604
1099 Ga0587095_042168
1100 Ga0587106_058246
1101 Ga0587101_075461
1102 Ga0587101_124278
1103 Ga0587109_055856
1104 Ga0587109_198820
1105 Ga0587109_214709
1106 Ga0587113_024919
1107 Ga0587115_069680
1108 Ga0587117_029615
1109 Ga0587122_039167
1110 Ga0587127_012889
1111 Ga0587062_048840
1112 Ga0587062_083145
1113 Ga0587067_083326
1114 Ga0587067_147650
1115 Ga0587068_106487
1116 Ga0587068_141400
1117 Ga0587069_129446
1118 Ga0587072_101116
1119 Ga0587072_148248
1120 Ga0587075_044454
1121 Ga0587075_045718
1122 Ga0587076_123106
1123 Ga0587078_028429
1124 Ga0587078_030372
1125 Ga0587079_053105
1126 Ga0587079_086110
1127 Ga0587100_027807
1128 Ga0587102_043316
1129 Ga0587108_023884
1130 Ga0587114_050919
1131 Ga0587119_047662
1132 Ga0587119_064853
1133 Ga0587071_070381
1134 Ga0587071_071219
1135 Ga0587071_097376
1136 Ga0587071_101130
1137 Ga0587111_0152696
1138 Ga0587111_0163364
1139 Ga0587111_0258022
1140 Ga0501082_0250806
1141 Ga0530510_0143438
1142 Ga0530510_0155290
1143 2501944228
1144 2515495153
1145 2515719153
1146 2515754892
1147 2516083360
1148 2516088535
1149 2523386871
1150 2644089580
1151 2644228883
1152 2644319425
1153 2676483570
1154 2740167006
1155 2753038094
1156 2753268293
1157 2753326605
1158 2772644221
1159 2795783309
1160 2831936273
1161 2832010496
1162 2855387807
1163 2855676453
1164 2855678625
1165 2855684708
1166 2856864466
1167 2857294585
1168 2858872336
1169 2858888709
1170 2858888963
1171 2858897443
1172 2858905738
1173 2866066469
1174 2867303556
1175 2867316092
1176 2867320958
1177 2867511790
1178 2869050188
1179 2869062120
1180 2869074201
1181 2880489699
1182 2880496003
1183 2902583453
1184 2929224677
1185 2929232382
1186 2984580608
1187 2990258300
1188 2996227588
1189 649814006
1190 8003832486
1191 8003863741
1192 8003876598
1193 8054612742
1194 8054732768
1195 8054737958
1196 8055416242

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

16

98

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.7497 4 92
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.6202 4 92
5bw9-assembly1.cif.gz_G crystal structure of yeast v1-atpase in the autoinhibited form 0.6135 3 96
5a7d-assembly4.cif.gz_N tetrameric assembly of lgn with inscuteable 0.5485 3 62
8bsj-assembly1.cif.gz_SP giardia ribosome in pre-t classical state (c) 0.5248 14 82
ID Description Score Start End Superfamily
af_Q95PI2_414_485_1.10.287.130 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.6075 5 95 1.10.287.130
af_Q554E7_500_636_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.5779 6 94 1.10.287.70
af_Q95PI2_414_485_1.10.287.130 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Signal transduction histidine kinase, dimerisation/phosphotransfer (DHp) domain 0.5378 5 95 1.10.287.130
3mxlB03 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4793 1 62 1.20.140.10
af_Q554E7_500_636_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.455 6 94 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A5B8NU41-F1-model_v4 YggT family protein 0.9831 3 96 GO:0016020
AF-A0A166MW17-F1-model_v4 deleted 0.9776 4 95
AF-A0A853BBV7-F1-model_v4 YggT family protein 0.976 2 92 GO:0016020
AF-A0A1L7CYT5-F1-model_v4 Membrane protein 0.9731 3 95 GO:0016020
AF-A0A3N1HEG6-F1-model_v4 YggT family protein 0.9726 3 92 GO:0016020

Map