F467666

General Info

Members Datasets Scaffolds Average Seq Length
597 307 1194 120

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_13218435|Ga0157378_132184351
Length 138
Sequence MAKHLTQIERRTARVRRAVKAAAGTRLRLSVFRSSKHIYAQVIDDRKGETVAAASSMEKDMRGSLKTGANIEAAKAVGKLVAERASAKGVKDVVFDRGGYIFHGRIKALADAAREGGLDFGGLRRVRAANGTDNHHGT

Samples

Sample ID Description Type Environment
1 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
73 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
74 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
75 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
76 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
146 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
153 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
170 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
194 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
200 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
211 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
282 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
287 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
288 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
289 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
290 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
293 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
294 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
295 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
296 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
297 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
303 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
304 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
305 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
306 2842694124 Methylopila sp. R-72369 Isolate Unclassified
307 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 1.51
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.35
Nodule 0
Rhizoplane 5.19
Rhizosphere 88.61
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157378_13218435 3300013297 Bacteria 507
2 Ga0058861_11348831 3300004800 Bacteria 613
3 Ga0065715_10250189 3300005293 Bacteria 1170
4 Ga0070658_10073690 3300005327 Bacteria 2800
5 Ga0070658_10262708 3300005327 Bacteria 1466
6 Ga0070690_101779650 3300005330 Bacteria 502
7 Ga0070670_100521925 3300005331 Bacteria 1058
8 Ga0070680_100024886 3300005336 Bacteria 4784
9 Ga0070680_100241929 3300005336 Bacteria 1525
10 Ga0070680_100666430 3300005336 Bacteria 895
11 Ga0070660_100067200 3300005339 Bacteria 2792
12 Ga0070660_100126597 3300005339 Bacteria 2041
13 Ga0070660_100420409 3300005339 Bacteria 1107
14 Ga0070660_100816764 3300005339 Bacteria 784
15 Ga0070689_101766341 3300005340 Bacteria 563
16 Ga0070687_100834896 3300005343 Bacteria 656
17 Ga0070687_100864015 3300005343 Bacteria 646
18 Ga0070661_100069740 3300005344 Bacteria 2584
19 Ga0070692_10023862 3300005345 Bacteria 3001
20 Ga0070668_100316003 3300005347 Bacteria 1314
21 Ga0070668_101398393 3300005347 Bacteria 638
22 Ga0070669_100430308 3300005353 Bacteria 1084
23 Ga0070675_100341936 3300005354 Bacteria 1325
24 Ga0070673_100198851 3300005364 Bacteria 1725
25 Ga0070688_101163175 3300005365 Bacteria 619
26 Ga0070659_100183076 3300005366 Bacteria 1720
27 Ga0070709_10067799 3300005434 Bacteria 2292
28 Ga0070709_10068029 3300005434 Bacteria 2289
29 Ga0070709_10118168 3300005434 Bacteria 1793
30 Ga0070709_10534939 3300005434 Bacteria 895
31 Ga0070714_100002370 3300005435 Bacteria 13866
32 Ga0070714_100239953 3300005435 Bacteria 1673
33 Ga0070714_100386249 3300005435 Bacteria 1321
34 Ga0070714_100999472 3300005435 Bacteria 814
35 Ga0070713_101106550 3300005436 Bacteria 766
36 Ga0070713_102241029 3300005436 Bacteria 529
37 Ga0070711_101002123 3300005439 Bacteria 717
38 Ga0070663_100068014 3300005455 Bacteria 2585
39 Ga0070663_100472674 3300005455 Bacteria 1037
40 Ga0070663_100662054 3300005455 Bacteria 884
41 Ga0070663_100977329 3300005455 Bacteria 735
42 Ga0070662_100144725 3300005457 Bacteria 1845
43 Ga0070681_10121752 3300005458 Bacteria 2543
44 Ga0070681_10396609 3300005458 Bacteria 1291
45 Ga0070681_11900229 3300005458 Bacteria 523
46 Ga0070681_12037408 3300005458 Bacteria 502
47 Ga0068867_100424794 3300005459 Bacteria 1127
48 Ga0070699_101149950 3300005518 Bacteria 712
49 Ga0070679_100068171 3300005530 Bacteria 3549
50 Ga0070679_100451602 3300005530 Bacteria 1230
51 Ga0070679_100521890 3300005530 Bacteria 1132
52 Ga0068853_100197544 3300005539 Bacteria 1830
53 Ga0070672_101950073 3300005543 Bacteria 529
54 Ga0070686_100972532 3300005544 Bacteria 695
55 Ga0070696_100700052 3300005546 Bacteria 826
56 Ga0070693_100681178 3300005547 Bacteria 751
57 Ga0070665_100699288 3300005548 Bacteria 1027
58 Ga0068855_100496430 3300005563 Bacteria 1327
59 Ga0068855_102193184 3300005563 Bacteria 555
60 Ga0068855_102440645 3300005563 Bacteria 521
61 Ga0070664_100476296 3300005564 Bacteria 1148
62 Ga0070664_101113572 3300005564 Bacteria 744
63 Ga0068856_100909367 3300005614 Bacteria 899
64 Ga0068856_100969751 3300005614 Bacteria 869
65 Ga0068856_101465680 3300005614 Bacteria 697
66 Ga0068864_100225150 3300005618 Bacteria 1732
67 Ga0068870_10691209 3300005840 Bacteria 703
68 Ga0081455_10005678 3300005937 Bacteria 13615
69 Ga0081455_10083372 3300005937 Bacteria 2613
70 Ga0070717_10191447 3300006028 Bacteria 1787
71 Ga0070717_10400008 3300006028 Bacteria 1234
72 Ga0070717_10590956 3300006028 Bacteria 1007
73 Ga0075368_10332864 3300006042 Bacteria 659
74 Ga0075363_100104272 3300006048 Bacteria 1572
75 Ga0075364_10195283 3300006051 Bacteria 1371
76 Ga0075364_10508040 3300006051 Bacteria 824
77 Ga0070715_10423224 3300006163 Bacteria 746
78 Ga0070715_10505135 3300006163 Bacteria 693
79 Ga0070716_101771920 3300006173 Bacteria 511
80 Ga0070712_100040629 3300006175 Bacteria 3190
81 Ga0075370_10021666 3300006353 Bacteria 3521
82 Ga0075370_10683673 3300006353 Bacteria 623
83 Ga0075370_10923910 3300006353 Bacteria 534
84 Ga0075428_101048933 3300006844 Bacteria 862
85 Ga0075431_100727707 3300006847 Bacteria 969
86 Ga0075434_100130826 3300006871 Bacteria 2528
87 Ga0075434_100233324 3300006871 Bacteria 1860
88 Ga0075434_100718035 3300006871 Bacteria 1017
89 Ga0068865_100474843 3300006881 Bacteria 1038
90 Ga0075436_100000730 3300006914 Bacteria 21767
91 Ga0075436_100353155 3300006914 Bacteria 1060
92 Ga0075435_100043491 3300007076 Bacteria 3595
93 Ga0075435_100988292 3300007076 Bacteria 735
94 Ga0099794_10366129 3300007265 Bacteria 751
95 Ga0099795_10002056 3300007788 Bacteria 4620
96 Ga0105244_10358963 3300009036 Bacteria 671
97 Ga0105245_10484807 3300009098 Bacteria 1250
98 Ga0105245_10838929 3300009098 Bacteria 959
99 Ga0105247_10709473 3300009101 Bacteria 758
100 Ga0114129_10219271 3300009147 Bacteria 2567
101 Ga0114129_12685670 3300009147 Bacteria 593
102 Ga0105238_11940600 3300009551 Bacteria 622
103 Ga0157371_10065322 3300013102 Bacteria 2577
104 Ga0157371_10303869 3300013102 Bacteria 1155
105 Ga0157370_10926247 3300013104 Bacteria 790
106 Ga0157369_11816380 3300013105 Bacteria 619
107 Ga0157372_10938935 3300013307 Bacteria 1003
108 Ga0157372_12407111 3300013307 Bacteria 605
109 Ga0157380_10846170 3300014326 Bacteria 936
110 Ga0182008_10048048 3300014497 Bacteria 2119
111 Ga0157377_10200795 3300014745 Bacteria 1266
112 Ga0157376_11029837 3300014969 Bacteria 847
113 Ga0197907_10594004 3300020069 Bacteria 532
114 Ga0213873_10173687 3300021358 Bacteria 658
115 Ga0213876_10013852 3300021384 Bacteria 4274
116 Ga0213876_10211166 3300021384 Bacteria 1032
117 Ga0213876_10786879 3300021384 Bacteria 506
118 Ga0213871_10144260 3300021441 Bacteria 721
119 Ga0228598_1037119 3300024227 Bacteria 961
120 Ga0209233_1003903 3300025261 Bacteria 5177
121 Ga0207685_10324043 3300025905 Bacteria 769
122 Ga0207685_10749981 3300025905 Bacteria 535
123 Ga0207699_10214055 3300025906 Bacteria 1312
124 Ga0207699_10759582 3300025906 Bacteria 711
125 Ga0207705_10004342 3300025909 Bacteria 10726
126 Ga0207705_10082383 3300025909 Bacteria 2346
127 Ga0207705_10088165 3300025909 Bacteria 2269
128 Ga0207684_10934885 3300025910 Bacteria 728
129 Ga0207707_10073118 3300025912 Bacteria 2989
130 Ga0207707_10232059 3300025912 Bacteria 1605
131 Ga0207707_10247011 3300025912 Bacteria 1550
132 Ga0207707_11507043 3300025912 Bacteria 533
133 Ga0207693_10090608 3300025915 Bacteria 2397
134 Ga0207663_10226766 3300025916 Bacteria 1362
135 Ga0207660_10238397 3300025917 Bacteria 1432
136 Ga0207660_10480063 3300025917 Bacteria 1007
137 Ga0207662_11315188 3300025918 Bacteria 513
138 Ga0207657_10057078 3300025919 Bacteria 3366
139 Ga0207657_10171817 3300025919 Bacteria 1755
140 Ga0207657_10352606 3300025919 Bacteria 1160
141 Ga0207657_10647180 3300025919 Bacteria 823
142 Ga0207649_10388807 3300025920 Bacteria 1041
143 Ga0207652_10022634 3300025921 Bacteria 5201
144 Ga0207652_10176487 3300025921 Bacteria 1919
145 Ga0207652_10230602 3300025921 Bacteria 1669
146 Ga0207652_11618618 3300025921 Bacteria 552
147 Ga0207681_10141875 3300025923 Bacteria 1790
148 Ga0207681_11582273 3300025923 Bacteria 549
149 Ga0207650_10549524 3300025925 Bacteria 968
150 Ga0207650_10614160 3300025925 Unclassified 915
151 Ga0207659_11137790 3300025926 Bacteria 671
152 Ga0207687_10614162 3300025927 Bacteria 917
153 Ga0207687_11017942 3300025927 Bacteria 710
154 Ga0207700_10115883 3300025928 Bacteria 2164
155 Ga0207700_11713554 3300025928 Bacteria 554
156 Ga0207664_10006275 3300025929 Bacteria 8170
157 Ga0207664_11007925 3300025929 Bacteria 746
158 Ga0207664_11009071 3300025929 Bacteria 746
159 Ga0207644_11011410 3300025931 Bacteria 698
160 Ga0207690_11416016 3300025932 Bacteria 581
161 Ga0207706_10075210 3300025933 Bacteria 2970
162 Ga0207669_11074361 3300025937 Bacteria 679
163 Ga0207665_10245678 3300025939 Bacteria 1320
164 Ga0207689_10902640 3300025942 Bacteria 745
165 Ga0207679_10154376 3300025945 Bacteria 1873
166 Ga0207667_10371205 3300025949 Bacteria 1458
167 Ga0207651_10233074 3300025960 Bacteria 1496
168 Ga0207651_11534344 3300025960 Bacteria 600
169 Ga0207658_11360849 3300025986 Bacteria 649
170 Ga0207678_10190014 3300026067 Bacteria 1755
171 Ga0207678_10406312 3300026067 Bacteria 1179
172 Ga0207702_10247187 3300026078 Bacteria 1674
173 Ga0207648_10157670 3300026089 Bacteria 2004
174 Ga0207676_10315401 3300026095 Bacteria 1433
175 Ga0207675_100960520 3300026118 Bacteria 872
176 Ga0207698_11810879 3300026142 Bacteria 626
177 Ga0209179_1000116 3300027512 Bacteria 9269
178 Ga0209974_10242241 3300027876 Bacteria 676
179 Ga0268265_10839338 3300028380 Bacteria 898
180 Ga0268264_11784163 3300028381 Bacteria 625
181 Ga0265337_1014579 3300028556 Bacteria 2602
182 Ga0265334_10063280 3300028573 Bacteria 1391
183 Ga0265336_10052787 3300028666 Bacteria 1226
184 Ga0265338_10070533 3300028800 Bacteria 2995
185 Ga0265338_10169152 3300028800 Bacteria 1678
186 Ga0265338_10265636 3300028800 Bacteria 1260
187 Ga0265324_10150226 3300029957 Bacteria 791
188 Ga0265770_1035309 3300030878 Bacteria 855
189 Ga0265760_10150736 3300031090 Bacteria 762
190 Ga0265330_10187151 3300031235 Bacteria 876
191 Ga0265325_10000449 3300031241 Bacteria 29667
192 Ga0265325_10001071 3300031241 Bacteria 19727
193 Ga0265325_10001769 3300031241 Bacteria 14972
194 Ga0265325_10003961 3300031241 Bacteria 9475
195 Ga0265325_10007856 3300031241 Bacteria 6350
196 Ga0265325_10012927 3300031241 Bacteria 4761
197 Ga0265325_10075997 3300031241 Bacteria 1677
198 Ga0265340_10072573 3300031247 Bacteria 1629
199 Ga0265340_10294989 3300031247 Bacteria 719
200 Ga0265339_10000053 3300031249 Bacteria 101277
201 Ga0265339_10001408 3300031249 Bacteria 17842
202 Ga0265339_10052488 3300031249 Bacteria 2220
203 Ga0265339_10449758 3300031249 Bacteria 598
204 Ga0265331_10032488 3300031250 Bacteria 2586
205 Ga0265327_10001257 3300031251 Bacteria 33614
206 Ga0265327_10123937 3300031251 Bacteria 1222
207 Ga0265316_10091372 3300031344 Bacteria 2322
208 Ga0265316_10360250 3300031344 Bacteria 1052
209 Ga0307509_10707042 3300031507 Bacteria 674
210 Ga0307408_101816340 3300031548 Bacteria 583
211 Ga0265313_10000098 3300031595 Bacteria 89130
212 Ga0265313_10001884 3300031595 Bacteria 19075
213 Ga0265313_10009717 3300031595 Bacteria 6202
214 Ga0265313_10015760 3300031595 Bacteria 4378
215 Ga0265313_10041399 3300031595 Bacteria 2270
216 Ga0307508_10155372 3300031616 Bacteria 1891
217 Ga0316579_10028094 3300031691 Bacteria 2560
218 Ga0265314_10016595 3300031711 Bacteria 5808
219 Ga0265314_10220616 3300031711 Bacteria 1107
220 Ga0265314_10235211 3300031711 Bacteria 1060
221 Ga0265342_10000677 3300031712 Bacteria 35579
222 Ga0265342_10135631 3300031712 Bacteria 1376
223 Ga0265342_10215815 3300031712 Bacteria 1036
224 Ga0307405_11558399 3300031731 Bacteria 582
225 Ga0307413_11275646 3300031824 Bacteria 642
226 Ga0307413_11294979 3300031824 Bacteria 637
227 Ga0307406_10766021 3300031901 Bacteria 812
228 Ga0307406_11551454 3300031901 Bacteria 584
229 Ga0307407_10403880 3300031903 Bacteria 981
230 Ga0307407_10699501 3300031903 Bacteria 763
231 Ga0307407_11624095 3300031903 Bacteria 513
232 Ga0307409_101347614 3300031995 Bacteria 739
233 Ga0307416_103517201 3300032002 Bacteria 524
234 Ga0307414_12043807 3300032004 Bacteria 535
235 Ga0307411_10645457 3300032005 Bacteria 916
236 Ga0307411_10664243 3300032005 Bacteria 904
237 Ga0307415_100481427 3300032126 Bacteria 1080
238 Ga0307415_101331350 3300032126 Bacteria 681
239 Ga0316593_10145447 3300032168 Bacteria 860
240 Ga0307510_10114264 3300033180 Bacteria 2429
241 Ga0316588_1021447 3300033528 Bacteria 1470
242 Ga0316588_1084788 3300033528 Bacteria 786
243 Ga0373934_0078813 3300035086 Bacteria 1322
244 Ga0373944_0233610 3300035089 Bacteria 674
245 Ga0373923_0000485 3300035111 Bacteria 9534
246 Ga0373923_0497629 3300035111 Bacteria 594
247 Ga0373936_0001112 3300035113 Bacteria 9638
248 Ga0373936_0253065 3300035113 Bacteria 787
249 Ga0373945_0008329 3300035116 Bacteria 3373
250 Ga0373953_0000811 3300035117 Bacteria 8711
251 Ga0373953_0118957 3300035117 Bacteria 1121
252 Ga0373954_0012683 3300035118 Bacteria 3749
253 Ga0373956_0016286 3300035119 Bacteria 3121
254 Ga0373956_0040266 3300035119 Bacteria 2072
255 Ga0373943_0008586 3300035170 Bacteria 4580
256 Ga0373946_0108295 3300035171 Bacteria 1254
257 Ga0373955_0001002 3300035172 Bacteria 11996
258 Ga0373924_0004798 3300035410 Bacteria 4749
259 Ga0373931_1033615 3300035691 Bacteria 557
260 Ga0373935_0000768 3300035692 Bacteria 17055
261 Ga0373935_0060149 3300035692 Bacteria 2430
262 Ga0373927_0036076 3300035695 Bacteria 3216
263 Ga0373933_0008324 3300035724 Bacteria 5664
264 Ga0373947_0002626 3300035725 Bacteria 10785
265 Ga0373947_0012597 3300035725 Bacteria 4849
266 Ga0373925_0000435 3300037068 Bacteria 42178
267 Ga0373925_0008981 3300037068 Bacteria 7283
268 Ga0436364_0216236 3300037853 Bacteria 869
269 Ga0436365_1316139 3300039437 Bacteria 682
270 Ga0436365_1367189 3300039437 Bacteria 1409
271 Ga0436365_1609996 3300039437 Bacteria 6251
272 Ga0436360_0907730 3300039438 Bacteria 846
273 Ga0436363_0652916 3300039450 Bacteria 1551
274 Ga0436363_1571548 3300039450 Bacteria 7951
275 Ga0436362_0685301 3300039453 Bacteria 1721
276 Ga0451791_0629042 3300041451 Bacteria 725
277 Ga0451802_1351709 3300041460 Bacteria 598
278 Ga0451807_2295665 3300041486 Bacteria 870
279 Ga0450902_087872 3300042137 Bacteria 548
280 Ga0451577_0142636 3300042876 Bacteria 2153
281 Ga0451577_0275504 3300042876 Bacteria 1524
282 Ga0439440_0024509 3300042993 Bacteria 1384
283 Ga0466961_0749837 3300044693 Bacteria 584
284 Ga0466963_0032494 3300044694 Bacteria 3380
285 Ga0466964_0183567 3300044706 Bacteria 994
286 Ga0453684_0001066 3300044712 Bacteria 87216
287 Ga0453684_1073742 3300044712 Bacteria 852
288 Ga0466957_0030963 3300044842 Bacteria 3196
289 Ga0466959_0573135 3300045049 Bacteria 760
290 Ga0466959_0608334 3300045049 Bacteria 735
291 Ga0495617_272783 3300046452 Bacteria 519
292 Ga0495592_0000135 3300046454 Bacteria 65590
293 Ga0495603_0209444 3300046455 Bacteria 1126
294 Ga0495629_0007600 3300046459 Bacteria 7985
295 Ga0495651_0000205 3300046462 Bacteria 45135
296 Ga0495651_0727611 3300046462 Bacteria 617
297 Ga0495653_0000120 3300046463 Bacteria 65274
298 Ga0495582_0047456 3300046473 Bacteria 2366
299 Ga0495605_0161119 3300046474 Bacteria 996
300 Ga0495639_0115487 3300046475 Bacteria 1277
301 Ga0495639_0305488 3300046475 Bacteria 794
302 Ga0495662_0001020 3300046476 Bacteria 13726
303 Ga0495664_0000023 3300046477 Bacteria 126807
304 Ga0495596_0080001 3300046500 Bacteria 1269
305 Ga0495608_0000030 3300046511 Bacteria 145828
306 Ga0495618_0000042 3300046514 Bacteria 96182
307 Ga0495628_0000027 3300046516 Bacteria 126537
308 Ga0495628_0075152 3300046516 Bacteria 2631
309 Ga0495630_0022375 3300046517 Bacteria 4667
310 Ga0495630_0206721 3300046517 Bacteria 1499
311 Ga0495631_0403054 3300046518 Bacteria 582
312 Ga0495637_0052151 3300046520 Bacteria 1709
313 Ga0495642_0071914 3300046528 Bacteria 1448
314 Ga0495642_0231760 3300046528 Bacteria 807
315 Ga0495652_0000041 3300046529 Bacteria 126519
316 Ga0495640_0000047 3300046533 Bacteria 64381
317 Ga0495640_0310432 3300046533 Bacteria 978
318 Ga0495587_0000025 3300046536 Bacteria 147974
319 Ga0495587_0023989 3300046536 Bacteria 3743
320 Ga0495645_0000001 3300046543 Bacteria 657910
321 Ga0495645_0028090 3300046543 Bacteria 4087
322 Ga0495667_0000001 3300046559 Bacteria 834831
323 Ga0495668_0210461 3300046616 Bacteria 1065
324 Ga0495634_0002681 3300046642 Bacteria 14628
325 Ga0495635_0000061 3300046663 Bacteria 66702
326 Ga0495657_0003632 3300046675 Bacteria 12530
327 Ga0495599_0000021 3300046678 Bacteria 127591
328 Ga0495623_0001924 3300046679 Bacteria 13947
329 Ga0495623_0061199 3300046679 Bacteria 2361
330 Ga0495646_0000043 3300046680 Bacteria 65914
331 Ga0495647_0132704 3300046681 Bacteria 1056
332 Ga0495658_0662680 3300046683 Bacteria 668
333 Ga0495613_0132782 3300046689 Bacteria 1782
334 Ga0495624_0191342 3300046690 Bacteria 1244
335 Ga0495589_0238732 3300046794 Bacteria 851
336 Ga0495600_0000082 3300046809 Bacteria 52098
337 Ga0495600_0038090 3300046809 Bacteria 3127
338 Ga0495581_0059568 3300047315 Bacteria 2206
339 Ga0495581_0341044 3300047315 Bacteria 875
340 Ga0495604_0000036 3300047317 Bacteria 126707
341 Ga0495674_0000085 3300047319 Bacteria 65389
342 Ga0495676_0302800 3300047321 Bacteria 1078
343 Ga0495680_0000201 3300047322 Bacteria 64686
344 Ga0495675_0000203 3300047444 Bacteria 43496
345 Ga0495675_0019714 3300047444 Bacteria 4285
346 Ga0495684_0000025 3300047471 Bacteria 127037
347 Ga0495684_0134111 3300047471 Bacteria 1858
348 Ga0495686_0042833 3300047472 Bacteria 2875
349 Ga0495686_0226750 3300047472 Bacteria 1060
350 Ga0495593_0001971 3300047673 Bacteria 12228
351 Ga0495602_0000097 3300048088 Bacteria 82301
352 Ga0495602_0071395 3300048088 Bacteria 2965
353 Ga0496100_0004435 3300048903 Bacteria 7438
354 Ga0496101_0002577 3300048904 Bacteria 11131
355 Ga0496102_0001868 3300048905 Bacteria 18139
356 Ga0496103_0169041 3300048906 Bacteria 1403
357 Ga0496104_0015411 3300048907 Bacteria 6923
358 Ga0496104_0049496 3300048907 Bacteria 3963
359 Ga0496104_0053507 3300048907 Bacteria 3814
360 Ga0496104_0950932 3300048907 Bacteria 764
361 Ga0496105_0091210 3300048908 Bacteria 2516
362 Ga0496105_0758016 3300048908 Bacteria 741
363 Ga0496106_0001110 3300048909 Bacteria 19925
364 Ga0496106_0340349 3300048909 Bacteria 1205
365 Ga0496107_0013996 3300048910 Bacteria 5614
366 Ga0496108_0021381 3300048911 Bacteria 5317
367 Ga0496108_0027712 3300048911 Bacteria 4682
368 Ga0496109_0013351 3300048912 Bacteria 7121
369 Ga0496109_0071831 3300048912 Bacteria 3178
370 Ga0496110_0004757 3300048913 Bacteria 10571
371 Ga0496110_0005009 3300048913 Bacteria 10350
372 Ga0496111_0021064 3300048914 Bacteria 4547
373 Ga0496111_0189822 3300048914 Bacteria 1527
374 Ga0496112_0037933 3300048915 Bacteria 4705
375 Ga0496112_0121004 3300048915 Bacteria 2587
376 Ga0496112_0190912 3300048915 Bacteria 2010
377 Ga0496113_1240236 3300048916 Bacteria 581
378 Ga0496114_0077198 3300048917 Bacteria 2808
379 Ga0496114_0092630 3300048917 Bacteria 2568
380 Ga0496114_1318667 3300048917 Bacteria 609
381 Ga0496125_0763359 3300048928 Bacteria 505
382 Ga0501315_007377 3300049531 Bacteria 1251
383 Ga0501320_002298 3300049536 Bacteria 1516
384 Ga0501031_0041940 3300049568 Bacteria 2988
385 Ga0501031_0149599 3300049568 Bacteria 1525
386 Ga0501032_0014845 3300049569 Bacteria 5511
387 Ga0501032_0063065 3300049569 Bacteria 2481
388 Ga0501032_0140538 3300049569 Bacteria 1590
389 Ga0501032_0505035 3300049569 Bacteria 772
390 Ga0501033_0071546 3300049570 Bacteria 2547
391 Ga0501033_0114091 3300049570 Bacteria 1964
392 Ga0501033_0288368 3300049570 Bacteria 1157
393 Ga0501033_0366413 3300049570 Bacteria 1008
394 Ga0501033_0368449 3300049570 Bacteria 1005
395 Ga0501033_0724166 3300049570 Bacteria 676
396 Ga0501033_0965653 3300049570 Bacteria 571
397 Ga0501034_0024621 3300049571 Bacteria 6122
398 Ga0501034_0048416 3300049571 Bacteria 4289
399 Ga0501034_0136955 3300049571 Bacteria 2429
400 Ga0501034_0198693 3300049571 Bacteria 1964
401 Ga0501034_0277504 3300049571 Bacteria 1616
402 Ga0501034_0285152 3300049571 Bacteria 1590
403 Ga0501034_0534749 3300049571 Bacteria 1082
404 Ga0501034_0538108 3300049571 Bacteria 1078
405 Ga0501036_0173660 3300049572 Bacteria 1815
406 Ga0501036_0282634 3300049572 Bacteria 1388
407 Ga0501036_0485581 3300049572 Bacteria 1028
408 Ga0501037_0018197 3300049573 Bacteria 5176
409 Ga0501037_0021990 3300049573 Bacteria 4721
410 Ga0501037_0125311 3300049573 Bacteria 1845
411 Ga0501037_0213220 3300049573 Bacteria 1361
412 Ga0501037_0455980 3300049573 Bacteria 871
413 Ga0501038_0044755 3300049574 Bacteria 3844
414 Ga0501038_0215142 3300049574 Bacteria 1536
415 Ga0501038_0512372 3300049574 Bacteria 916
416 Ga0501038_0555567 3300049574 Bacteria 872
417 Ga0501039_0056068 3300049575 Bacteria 3052
418 Ga0501039_1235066 3300049575 Bacteria 577
419 Ga0501040_0041806 3300049576 Bacteria 3122
420 Ga0501040_0092178 3300049576 Bacteria 2107
421 Ga0501040_0120531 3300049576 Bacteria 1840
422 Ga0501040_0208966 3300049576 Bacteria 1387
423 Ga0501041_0030250 3300049577 Bacteria 3268
424 Ga0501041_0321232 3300049577 Bacteria 976
425 Ga0501042_0095441 3300049578 Bacteria 2136
426 Ga0501042_0157647 3300049578 Bacteria 1637
427 Ga0501042_0588312 3300049578 Bacteria 809
428 Ga0501043_0006712 3300049579 Bacteria 9190
429 Ga0501043_0015239 3300049579 Bacteria 6020
430 Ga0501043_0105634 3300049579 Bacteria 2212
431 Ga0501043_0259960 3300049579 Bacteria 1335
432 Ga0501043_0513147 3300049579 Bacteria 894
433 Ga0501043_0559082 3300049579 Bacteria 849
434 Ga0501046_0086938 3300049580 Bacteria 2409
435 Ga0501046_0109030 3300049580 Bacteria 2117
436 Ga0501046_0189744 3300049580 Bacteria 1533
437 Ga0501046_0272760 3300049580 Bacteria 1240
438 Ga0501047_0000235 3300049581 Bacteria 65603
439 Ga0501047_0010311 3300049581 Bacteria 8836
440 Ga0501047_0074415 3300049581 Bacteria 3270
441 Ga0501047_0113222 3300049581 Bacteria 2595
442 Ga0501047_0566768 3300049581 Bacteria 959
443 Ga0501047_0804691 3300049581 Bacteria 755
444 Ga0501048_0001478 3300049582 Bacteria 17828
445 Ga0501048_0168400 3300049582 Bacteria 1551
446 Ga0501048_0343340 3300049582 Bacteria 1064
447 Ga0501048_0359600 3300049582 Bacteria 1038
448 Ga0501048_0678340 3300049582 Bacteria 740
449 Ga0501048_0830241 3300049582 Bacteria 664
450 Ga0501067_0012204 3300049583 Bacteria 4763
451 Ga0501067_0122770 3300049583 Bacteria 1445
452 Ga0501068_0070772 3300049584 Bacteria 2128
453 Ga0501068_0388907 3300049584 Bacteria 898
454 Ga0501069_0051403 3300049585 Bacteria 2293
455 Ga0501069_0166303 3300049585 Bacteria 1271
456 Ga0501069_0220162 3300049585 Bacteria 1103
457 Ga0501069_0437636 3300049585 Bacteria 776
458 Ga0501069_0684895 3300049585 Bacteria 618
459 Ga0501070_0014169 3300049586 Bacteria 6709
460 Ga0501070_0021942 3300049586 Bacteria 5349
461 Ga0501070_0036804 3300049586 Bacteria 4087
462 Ga0501070_0199045 3300049586 Bacteria 1645
463 Ga0501070_0211009 3300049586 Bacteria 1594
464 Ga0501070_0748408 3300049586 Bacteria 770
465 Ga0501070_0764324 3300049586 Bacteria 761
466 Ga0501070_1017639 3300049586 Bacteria 642
467 Ga0501070_1410180 3300049586 Bacteria 529
468 Ga0501071_0107543 3300049587 Bacteria 2059
469 Ga0501071_0111538 3300049587 Bacteria 2021
470 Ga0501071_0169808 3300049587 Bacteria 1632
471 Ga0501071_0268065 3300049587 Bacteria 1290
472 Ga0501072_0039445 3300049588 Bacteria 3708
473 Ga0501072_0138286 3300049588 Bacteria 1942
474 Ga0501072_0144574 3300049588 Bacteria 1896
475 Ga0501072_0243437 3300049588 Bacteria 1433
476 Ga0501072_0435666 3300049588 Bacteria 1038
477 Ga0501072_0604180 3300049588 Bacteria 865
478 Ga0501073_0040671 3300049589 Bacteria 3288
479 Ga0501073_0134224 3300049589 Bacteria 1715
480 Ga0501073_0143349 3300049589 Bacteria 1655
481 Ga0501073_0158206 3300049589 Bacteria 1570
482 Ga0501073_0355485 3300049589 Bacteria 1011
483 Ga0501073_0696107 3300049589 Bacteria 701
484 Ga0501073_0767294 3300049589 Bacteria 665
485 Ga0501074_0002757 3300049590 Bacteria 12304
486 Ga0501074_0021141 3300049590 Bacteria 4726
487 Ga0501074_0099909 3300049590 Bacteria 2077
488 Ga0501074_0202161 3300049590 Bacteria 1416
489 Ga0501074_0348658 3300049590 Bacteria 1051
490 Ga0501074_0371893 3300049590 Bacteria 1014
491 Ga0501075_0017316 3300049591 Bacteria 5204
492 Ga0501075_0346163 3300049591 Bacteria 1133
493 Ga0501075_0413447 3300049591 Bacteria 1028
494 Ga0501076_0092150 3300049592 Bacteria 2438
495 Ga0501076_0173537 3300049592 Bacteria 1757
496 Ga0501076_0179602 3300049592 Bacteria 1725
497 Ga0501076_0864845 3300049592 Bacteria 746
498 Ga0501077_0013704 3300049593 Bacteria 5081
499 Ga0501077_0110900 3300049593 Bacteria 1739
500 Ga0501077_0410166 3300049593 Bacteria 866
501 Ga0501077_0616512 3300049593 Bacteria 697
502 Ga0501077_0809091 3300049593 Bacteria 603
503 Ga0501077_0920899 3300049593 Bacteria 562
504 Ga0501079_0032338 3300049741 Bacteria 4022
505 Ga0501079_0151471 3300049741 Bacteria 1808
506 Ga0501079_0239828 3300049741 Bacteria 1416
507 Ga0501079_0779055 3300049741 Bacteria 753
508 Ga0501079_0893685 3300049741 Bacteria 699
509 Ga0501080_0013397 3300049742 Bacteria 7542
510 Ga0501080_0047460 3300049742 Bacteria 3998
511 Ga0501080_0139976 3300049742 Bacteria 2237
512 Ga0501080_0233621 3300049742 Bacteria 1680
513 Ga0501080_0522879 3300049742 Bacteria 1058
514 Ga0501080_0592654 3300049742 Bacteria 984
515 Ga0501080_0833696 3300049742 Bacteria 807
516 Ga0501080_1275407 3300049742 Bacteria 630
517 Ga0501081_0097937 3300049743 Bacteria 2070
518 Ga0501081_0125288 3300049743 Bacteria 1832
519 Ga0501081_0145138 3300049743 Bacteria 1702
520 Ga0501081_0296310 3300049743 Bacteria 1186
521 Ga0501081_0522407 3300049743 Bacteria 886
522 Ga0501081_1042038 3300049743 Bacteria 619
523 Ga0501083_0004993 3300049744 Bacteria 9404
524 Ga0501083_0007208 3300049744 Bacteria 7895
525 Ga0501083_0057947 3300049744 Bacteria 2592
526 Ga0501083_0091220 3300049744 Bacteria 2012
527 Ga0501083_0126567 3300049744 Bacteria 1675
528 Ga0501083_0282720 3300049744 Bacteria 1079
529 Ga0501083_0712590 3300049744 Bacteria 653
530 Ga0501035_0074684 3300049822 Bacteria 2998
531 Ga0501035_0253736 3300049822 Bacteria 1493
532 Ga0501035_0385234 3300049822 Bacteria 1169
533 Ga0501035_0462498 3300049822 Bacteria 1048
534 Ga0501035_0614503 3300049822 Bacteria 884
535 Ga0501035_1481472 3300049822 Bacteria 518
536 Ga0501044_0061936 3300049823 Bacteria 3826
537 Ga0501044_0063964 3300049823 Bacteria 3756
538 Ga0501044_0076620 3300049823 Bacteria 3393
539 Ga0501044_0112228 3300049823 Bacteria 2733
540 Ga0501044_0150030 3300049823 Bacteria 2314
541 Ga0501044_0193928 3300049823 Bacteria 1992
542 Ga0501044_0368836 3300049823 Bacteria 1353
543 Ga0501044_0400962 3300049823 Bacteria 1284
544 Ga0501044_0642233 3300049823 Bacteria 951
545 Ga0501044_0968064 3300049823 Bacteria 724
546 Ga0501044_1171374 3300049823 Bacteria 637
547 Ga0501044_1298566 3300049823 Bacteria 594
548 Ga0501044_1572777 3300049823 Bacteria 522
549 Ga0501045_0067201 3300049824 Bacteria 2632
550 Ga0501045_0127077 3300049824 Bacteria 1894
551 Ga0501045_1269271 3300049824 Bacteria 536
552 nmdc:mga03n38_319639_c1 3300050490 Bacteria 838
553 nmdc:mga03n38_690197_c1 3300050490 Bacteria 588
554 nmdc:mga03n38_760050_c1 3300050490 Bacteria 562
555 nmdc:mga06z11_621395_c1 3300050494 Bacteria 657
556 nmdc:mga07m45_318437_c1 3300050496 Bacteria 904
557 nmdc:mga07m45_48011_c1 3300050496 Bacteria 1553
558 nmdc:mga05p37_530552_c1 3300050507 Bacteria 1344
559 nmdc:mga06r32_90056_c1 3300050510 Bacteria 2996
560 nmdc:mga0n895_11248_c1 3300050512 Bacteria 7972
561 nmdc:mga0n895_317354_c1 3300050512 Bacteria 1579
562 nmdc:mga0n895_583071_c1 3300050512 Bacteria 1122
563 nmdc:mga0rr50_639176_c1 3300050513 Bacteria 908
564 nmdc:mga08x19_270026_c1 3300050514 Bacteria 1177
565 nmdc:mga08x19_59655_c1 3300050514 Bacteria 2470
566 nmdc:mga08x19_66437_c1 3300050514 Bacteria 2344
567 Ga0495601_0000025 3300053077 Bacteria 127736
568 Ga0495612_0000570 3300053078 Bacteria 14844
569 Ga0495595_0000041 3300053084 Bacteria 67592
570 Ga0495619_0000035 3300053085 Bacteria 126262
571 Ga0500644_0001281 3300053088 Bacteria 6847
572 Ga0500650_0195293 3300053098 Bacteria 923
573 Ga0500555_047837 3300053103 Bacteria 1176
574 Ga0500595_132877 3300053119 Bacteria 700
575 Ga0500642_0121732 3300053130 Bacteria 1221
576 Ga0500573_0323831 3300053140 Bacteria 760
577 Ga0501084_0017814 3300054114 Bacteria 5911
578 Ga0501084_0140781 3300054114 Bacteria 2031
579 Ga0501084_0388002 3300054114 Bacteria 1180
580 Ga0501084_1753986 3300054114 Bacteria 518
581 Ga0590075_185964 3300059424 Bacteria 549
582 Ga0501082_0017885 3300060353 Bacteria 6106
583 Ga0501082_0090041 3300060353 Bacteria 2649
584 Ga0501082_0513413 3300060353 Bacteria 1047
585 Ga0501082_0686509 3300060353 Bacteria 896
586 Ga0501082_1171964 3300060353 Bacteria 671
587 Ga0466962_0191171 3300061719 Bacteria 999
588 Ga0466962_0263672 3300061719 Bacteria 848
589 Ga0530510_0023701 3300061734 Bacteria 4376
590 Ga0530510_0024355 3300061734 Bacteria 4318
591 Ga0530510_0413477 3300061734 Bacteria 1018
592 Ga0530510_0505836 3300061734 Bacteria 916
593 2643755795 2643221547 Bacteria 4740017
594 2643884719 2643221574 Bacteria 2789653
595 2644548379 2643221699 Bacteria 5731501
596 2842694294 2842694124 Bacteria 4063419
597 2884300438 2884298095 Bacteria 3823049
598 Ga0157378_13218435
599 Ga0058861_11348831
600 Ga0065715_10250189
601 Ga0070658_10073690
602 Ga0070658_10262708
603 Ga0070690_101779650
604 Ga0070670_100521925
605 Ga0070680_100024886
606 Ga0070680_100241929
607 Ga0070680_100666430
608 Ga0070660_100067200
609 Ga0070660_100126597
610 Ga0070660_100420409
611 Ga0070660_100816764
612 Ga0070689_101766341
613 Ga0070687_100834896
614 Ga0070687_100864015
615 Ga0070661_100069740
616 Ga0070692_10023862
617 Ga0070668_100316003
618 Ga0070668_101398393
619 Ga0070669_100430308
620 Ga0070675_100341936
621 Ga0070673_100198851
622 Ga0070688_101163175
623 Ga0070659_100183076
624 Ga0070709_10067799
625 Ga0070709_10068029
626 Ga0070709_10118168
627 Ga0070709_10534939
628 Ga0070714_100002370
629 Ga0070714_100239953
630 Ga0070714_100386249
631 Ga0070714_100999472
632 Ga0070713_101106550
633 Ga0070713_102241029
634 Ga0070711_101002123
635 Ga0070663_100068014
636 Ga0070663_100472674
637 Ga0070663_100662054
638 Ga0070663_100977329
639 Ga0070662_100144725
640 Ga0070681_10121752
641 Ga0070681_10396609
642 Ga0070681_11900229
643 Ga0070681_12037408
644 Ga0068867_100424794
645 Ga0070699_101149950
646 Ga0070679_100068171
647 Ga0070679_100451602
648 Ga0070679_100521890
649 Ga0068853_100197544
650 Ga0070672_101950073
651 Ga0070686_100972532
652 Ga0070696_100700052
653 Ga0070693_100681178
654 Ga0070665_100699288
655 Ga0068855_100496430
656 Ga0068855_102193184
657 Ga0068855_102440645
658 Ga0070664_100476296
659 Ga0070664_101113572
660 Ga0068856_100909367
661 Ga0068856_100969751
662 Ga0068856_101465680
663 Ga0068864_100225150
664 Ga0068870_10691209
665 Ga0081455_10005678
666 Ga0081455_10083372
667 Ga0070717_10191447
668 Ga0070717_10400008
669 Ga0070717_10590956
670 Ga0075368_10332864
671 Ga0075363_100104272
672 Ga0075364_10195283
673 Ga0075364_10508040
674 Ga0070715_10423224
675 Ga0070715_10505135
676 Ga0070716_101771920
677 Ga0070712_100040629
678 Ga0075370_10021666
679 Ga0075370_10683673
680 Ga0075370_10923910
681 Ga0075428_101048933
682 Ga0075431_100727707
683 Ga0075434_100130826
684 Ga0075434_100233324
685 Ga0075434_100718035
686 Ga0068865_100474843
687 Ga0075436_100000730
688 Ga0075436_100353155
689 Ga0075435_100043491
690 Ga0075435_100988292
691 Ga0099794_10366129
692 Ga0099795_10002056
693 Ga0105244_10358963
694 Ga0105245_10484807
695 Ga0105245_10838929
696 Ga0105247_10709473
697 Ga0114129_10219271
698 Ga0114129_12685670
699 Ga0105238_11940600
700 Ga0157371_10065322
701 Ga0157371_10303869
702 Ga0157370_10926247
703 Ga0157369_11816380
704 Ga0157372_10938935
705 Ga0157372_12407111
706 Ga0157380_10846170
707 Ga0182008_10048048
708 Ga0157377_10200795
709 Ga0157376_11029837
710 Ga0197907_10594004
711 Ga0213873_10173687
712 Ga0213876_10013852
713 Ga0213876_10211166
714 Ga0213876_10786879
715 Ga0213871_10144260
716 Ga0228598_1037119
717 Ga0209233_1003903
718 Ga0207685_10324043
719 Ga0207685_10749981
720 Ga0207699_10214055
721 Ga0207699_10759582
722 Ga0207705_10004342
723 Ga0207705_10082383
724 Ga0207705_10088165
725 Ga0207684_10934885
726 Ga0207707_10073118
727 Ga0207707_10232059
728 Ga0207707_10247011
729 Ga0207707_11507043
730 Ga0207693_10090608
731 Ga0207663_10226766
732 Ga0207660_10238397
733 Ga0207660_10480063
734 Ga0207662_11315188
735 Ga0207657_10057078
736 Ga0207657_10171817
737 Ga0207657_10352606
738 Ga0207657_10647180
739 Ga0207649_10388807
740 Ga0207652_10022634
741 Ga0207652_10176487
742 Ga0207652_10230602
743 Ga0207652_11618618
744 Ga0207681_10141875
745 Ga0207681_11582273
746 Ga0207650_10549524
747 Ga0207650_10614160
748 Ga0207659_11137790
749 Ga0207687_10614162
750 Ga0207687_11017942
751 Ga0207700_10115883
752 Ga0207700_11713554
753 Ga0207664_10006275
754 Ga0207664_11007925
755 Ga0207664_11009071
756 Ga0207644_11011410
757 Ga0207690_11416016
758 Ga0207706_10075210
759 Ga0207669_11074361
760 Ga0207665_10245678
761 Ga0207689_10902640
762 Ga0207679_10154376
763 Ga0207667_10371205
764 Ga0207651_10233074
765 Ga0207651_11534344
766 Ga0207658_11360849
767 Ga0207678_10190014
768 Ga0207678_10406312
769 Ga0207702_10247187
770 Ga0207648_10157670
771 Ga0207676_10315401
772 Ga0207675_100960520
773 Ga0207698_11810879
774 Ga0209179_1000116
775 Ga0209974_10242241
776 Ga0268265_10839338
777 Ga0268264_11784163
778 Ga0265337_1014579
779 Ga0265334_10063280
780 Ga0265336_10052787
781 Ga0265338_10070533
782 Ga0265338_10169152
783 Ga0265338_10265636
784 Ga0265324_10150226
785 Ga0265770_1035309
786 Ga0265760_10150736
787 Ga0265330_10187151
788 Ga0265325_10000449
789 Ga0265325_10001071
790 Ga0265325_10001769
791 Ga0265325_10003961
792 Ga0265325_10007856
793 Ga0265325_10012927
794 Ga0265325_10075997
795 Ga0265340_10072573
796 Ga0265340_10294989
797 Ga0265339_10000053
798 Ga0265339_10001408
799 Ga0265339_10052488
800 Ga0265339_10449758
801 Ga0265331_10032488
802 Ga0265327_10001257
803 Ga0265327_10123937
804 Ga0265316_10091372
805 Ga0265316_10360250
806 Ga0307509_10707042
807 Ga0307408_101816340
808 Ga0265313_10000098
809 Ga0265313_10001884
810 Ga0265313_10009717
811 Ga0265313_10015760
812 Ga0265313_10041399
813 Ga0307508_10155372
814 Ga0316579_10028094
815 Ga0265314_10016595
816 Ga0265314_10220616
817 Ga0265314_10235211
818 Ga0265342_10000677
819 Ga0265342_10135631
820 Ga0265342_10215815
821 Ga0307405_11558399
822 Ga0307413_11275646
823 Ga0307413_11294979
824 Ga0307406_10766021
825 Ga0307406_11551454
826 Ga0307407_10403880
827 Ga0307407_10699501
828 Ga0307407_11624095
829 Ga0307409_101347614
830 Ga0307416_103517201
831 Ga0307414_12043807
832 Ga0307411_10645457
833 Ga0307411_10664243
834 Ga0307415_100481427
835 Ga0307415_101331350
836 Ga0316593_10145447
837 Ga0307510_10114264
838 Ga0316588_1021447
839 Ga0316588_1084788
840 Ga0373934_0078813
841 Ga0373944_0233610
842 Ga0373923_0000485
843 Ga0373923_0497629
844 Ga0373936_0001112
845 Ga0373936_0253065
846 Ga0373945_0008329
847 Ga0373953_0000811
848 Ga0373953_0118957
849 Ga0373954_0012683
850 Ga0373956_0016286
851 Ga0373956_0040266
852 Ga0373943_0008586
853 Ga0373946_0108295
854 Ga0373955_0001002
855 Ga0373924_0004798
856 Ga0373931_1033615
857 Ga0373935_0000768
858 Ga0373935_0060149
859 Ga0373927_0036076
860 Ga0373933_0008324
861 Ga0373947_0002626
862 Ga0373947_0012597
863 Ga0373925_0000435
864 Ga0373925_0008981
865 Ga0436364_0216236
866 Ga0436365_1316139
867 Ga0436365_1367189
868 Ga0436365_1609996
869 Ga0436360_0907730
870 Ga0436363_0652916
871 Ga0436363_1571548
872 Ga0436362_0685301
873 Ga0451791_0629042
874 Ga0451802_1351709
875 Ga0451807_2295665
876 Ga0450902_087872
877 Ga0451577_0142636
878 Ga0451577_0275504
879 Ga0439440_0024509
880 Ga0466961_0749837
881 Ga0466963_0032494
882 Ga0466964_0183567
883 Ga0453684_0001066
884 Ga0453684_1073742
885 Ga0466957_0030963
886 Ga0466959_0573135
887 Ga0466959_0608334
888 Ga0495617_272783
889 Ga0495592_0000135
890 Ga0495603_0209444
891 Ga0495629_0007600
892 Ga0495651_0000205
893 Ga0495651_0727611
894 Ga0495653_0000120
895 Ga0495582_0047456
896 Ga0495605_0161119
897 Ga0495639_0115487
898 Ga0495639_0305488
899 Ga0495662_0001020
900 Ga0495664_0000023
901 Ga0495596_0080001
902 Ga0495608_0000030
903 Ga0495618_0000042
904 Ga0495628_0000027
905 Ga0495628_0075152
906 Ga0495630_0022375
907 Ga0495630_0206721
908 Ga0495631_0403054
909 Ga0495637_0052151
910 Ga0495642_0071914
911 Ga0495642_0231760
912 Ga0495652_0000041
913 Ga0495640_0000047
914 Ga0495640_0310432
915 Ga0495587_0000025
916 Ga0495587_0023989
917 Ga0495645_0000001
918 Ga0495645_0028090
919 Ga0495667_0000001
920 Ga0495668_0210461
921 Ga0495634_0002681
922 Ga0495635_0000061
923 Ga0495657_0003632
924 Ga0495599_0000021
925 Ga0495623_0001924
926 Ga0495623_0061199
927 Ga0495646_0000043
928 Ga0495647_0132704
929 Ga0495658_0662680
930 Ga0495613_0132782
931 Ga0495624_0191342
932 Ga0495589_0238732
933 Ga0495600_0000082
934 Ga0495600_0038090
935 Ga0495581_0059568
936 Ga0495581_0341044
937 Ga0495604_0000036
938 Ga0495674_0000085
939 Ga0495676_0302800
940 Ga0495680_0000201
941 Ga0495675_0000203
942 Ga0495675_0019714
943 Ga0495684_0000025
944 Ga0495684_0134111
945 Ga0495686_0042833
946 Ga0495686_0226750
947 Ga0495593_0001971
948 Ga0495602_0000097
949 Ga0495602_0071395
950 Ga0496100_0004435
951 Ga0496101_0002577
952 Ga0496102_0001868
953 Ga0496103_0169041
954 Ga0496104_0015411
955 Ga0496104_0049496
956 Ga0496104_0053507
957 Ga0496104_0950932
958 Ga0496105_0091210
959 Ga0496105_0758016
960 Ga0496106_0001110
961 Ga0496106_0340349
962 Ga0496107_0013996
963 Ga0496108_0021381
964 Ga0496108_0027712
965 Ga0496109_0013351
966 Ga0496109_0071831
967 Ga0496110_0004757
968 Ga0496110_0005009
969 Ga0496111_0021064
970 Ga0496111_0189822
971 Ga0496112_0037933
972 Ga0496112_0121004
973 Ga0496112_0190912
974 Ga0496113_1240236
975 Ga0496114_0077198
976 Ga0496114_0092630
977 Ga0496114_1318667
978 Ga0496125_0763359
979 Ga0501315_007377
980 Ga0501320_002298
981 Ga0501031_0041940
982 Ga0501031_0149599
983 Ga0501032_0014845
984 Ga0501032_0063065
985 Ga0501032_0140538
986 Ga0501032_0505035
987 Ga0501033_0071546
988 Ga0501033_0114091
989 Ga0501033_0288368
990 Ga0501033_0366413
991 Ga0501033_0368449
992 Ga0501033_0724166
993 Ga0501033_0965653
994 Ga0501034_0024621
995 Ga0501034_0048416
996 Ga0501034_0136955
997 Ga0501034_0198693
998 Ga0501034_0277504
999 Ga0501034_0285152
1000 Ga0501034_0534749
1001 Ga0501034_0538108
1002 Ga0501036_0173660
1003 Ga0501036_0282634
1004 Ga0501036_0485581
1005 Ga0501037_0018197
1006 Ga0501037_0021990
1007 Ga0501037_0125311
1008 Ga0501037_0213220
1009 Ga0501037_0455980
1010 Ga0501038_0044755
1011 Ga0501038_0215142
1012 Ga0501038_0512372
1013 Ga0501038_0555567
1014 Ga0501039_0056068
1015 Ga0501039_1235066
1016 Ga0501040_0041806
1017 Ga0501040_0092178
1018 Ga0501040_0120531
1019 Ga0501040_0208966
1020 Ga0501041_0030250
1021 Ga0501041_0321232
1022 Ga0501042_0095441
1023 Ga0501042_0157647
1024 Ga0501042_0588312
1025 Ga0501043_0006712
1026 Ga0501043_0015239
1027 Ga0501043_0105634
1028 Ga0501043_0259960
1029 Ga0501043_0513147
1030 Ga0501043_0559082
1031 Ga0501046_0086938
1032 Ga0501046_0109030
1033 Ga0501046_0189744
1034 Ga0501046_0272760
1035 Ga0501047_0000235
1036 Ga0501047_0010311
1037 Ga0501047_0074415
1038 Ga0501047_0113222
1039 Ga0501047_0566768
1040 Ga0501047_0804691
1041 Ga0501048_0001478
1042 Ga0501048_0168400
1043 Ga0501048_0343340
1044 Ga0501048_0359600
1045 Ga0501048_0678340
1046 Ga0501048_0830241
1047 Ga0501067_0012204
1048 Ga0501067_0122770
1049 Ga0501068_0070772
1050 Ga0501068_0388907
1051 Ga0501069_0051403
1052 Ga0501069_0166303
1053 Ga0501069_0220162
1054 Ga0501069_0437636
1055 Ga0501069_0684895
1056 Ga0501070_0014169
1057 Ga0501070_0021942
1058 Ga0501070_0036804
1059 Ga0501070_0199045
1060 Ga0501070_0211009
1061 Ga0501070_0748408
1062 Ga0501070_0764324
1063 Ga0501070_1017639
1064 Ga0501070_1410180
1065 Ga0501071_0107543
1066 Ga0501071_0111538
1067 Ga0501071_0169808
1068 Ga0501071_0268065
1069 Ga0501072_0039445
1070 Ga0501072_0138286
1071 Ga0501072_0144574
1072 Ga0501072_0243437
1073 Ga0501072_0435666
1074 Ga0501072_0604180
1075 Ga0501073_0040671
1076 Ga0501073_0134224
1077 Ga0501073_0143349
1078 Ga0501073_0158206
1079 Ga0501073_0355485
1080 Ga0501073_0696107
1081 Ga0501073_0767294
1082 Ga0501074_0002757
1083 Ga0501074_0021141
1084 Ga0501074_0099909
1085 Ga0501074_0202161
1086 Ga0501074_0348658
1087 Ga0501074_0371893
1088 Ga0501075_0017316
1089 Ga0501075_0346163
1090 Ga0501075_0413447
1091 Ga0501076_0092150
1092 Ga0501076_0173537
1093 Ga0501076_0179602
1094 Ga0501076_0864845
1095 Ga0501077_0013704
1096 Ga0501077_0110900
1097 Ga0501077_0410166
1098 Ga0501077_0616512
1099 Ga0501077_0809091
1100 Ga0501077_0920899
1101 Ga0501079_0032338
1102 Ga0501079_0151471
1103 Ga0501079_0239828
1104 Ga0501079_0779055
1105 Ga0501079_0893685
1106 Ga0501080_0013397
1107 Ga0501080_0047460
1108 Ga0501080_0139976
1109 Ga0501080_0233621
1110 Ga0501080_0522879
1111 Ga0501080_0592654
1112 Ga0501080_0833696
1113 Ga0501080_1275407
1114 Ga0501081_0097937
1115 Ga0501081_0125288
1116 Ga0501081_0145138
1117 Ga0501081_0296310
1118 Ga0501081_0522407
1119 Ga0501081_1042038
1120 Ga0501083_0004993
1121 Ga0501083_0007208
1122 Ga0501083_0057947
1123 Ga0501083_0091220
1124 Ga0501083_0126567
1125 Ga0501083_0282720
1126 Ga0501083_0712590
1127 Ga0501035_0074684
1128 Ga0501035_0253736
1129 Ga0501035_0385234
1130 Ga0501035_0462498
1131 Ga0501035_0614503
1132 Ga0501035_1481472
1133 Ga0501044_0061936
1134 Ga0501044_0063964
1135 Ga0501044_0076620
1136 Ga0501044_0112228
1137 Ga0501044_0150030
1138 Ga0501044_0193928
1139 Ga0501044_0368836
1140 Ga0501044_0400962
1141 Ga0501044_0642233
1142 Ga0501044_0968064
1143 Ga0501044_1171374
1144 Ga0501044_1298566
1145 Ga0501044_1572777
1146 Ga0501045_0067201
1147 Ga0501045_0127077
1148 Ga0501045_1269271
1149 nmdc:mga03n38_319639_c1
1150 nmdc:mga03n38_690197_c1
1151 nmdc:mga03n38_760050_c1
1152 nmdc:mga06z11_621395_c1
1153 nmdc:mga07m45_318437_c1
1154 nmdc:mga07m45_48011_c1
1155 nmdc:mga05p37_530552_c1
1156 nmdc:mga06r32_90056_c1
1157 nmdc:mga0n895_11248_c1
1158 nmdc:mga0n895_317354_c1
1159 nmdc:mga0n895_583071_c1
1160 nmdc:mga0rr50_639176_c1
1161 nmdc:mga08x19_270026_c1
1162 nmdc:mga08x19_59655_c1
1163 nmdc:mga08x19_66437_c1
1164 Ga0495601_0000025
1165 Ga0495612_0000570
1166 Ga0495595_0000041
1167 Ga0495619_0000035
1168 Ga0500644_0001281
1169 Ga0500650_0195293
1170 Ga0500555_047837
1171 Ga0500595_132877
1172 Ga0500642_0121732
1173 Ga0500573_0323831
1174 Ga0501084_0017814
1175 Ga0501084_0140781
1176 Ga0501084_0388002
1177 Ga0501084_1753986
1178 Ga0590075_185964
1179 Ga0501082_0017885
1180 Ga0501082_0090041
1181 Ga0501082_0513413
1182 Ga0501082_0686509
1183 Ga0501082_1171964
1184 Ga0466962_0191171
1185 Ga0466962_0263672
1186 Ga0530510_0023701
1187 Ga0530510_0024355
1188 Ga0530510_0413477
1189 Ga0530510_0505836
1190 2643755795
1191 2643884719
1192 2644548379
1193 2842694294
1194 2884300438

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

2

120

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.9001 28 122
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.891 28 122
6gaw-assembly1.cif.gz_BS unique features of mammalian mitochondrial translation initiation revealed by cryo-em. this file contains the complete 55s ribosome. 0.8885 29 120
6zsb-assembly1.cif.gz_XP human mitochondrial ribosome in complex with mrna and p-site trna 0.8853 28 120
4xh5-assembly1.cif.gz_A-2 crystal structure of salmonella typhimurium propionate kinase a88g mutant, in complex with amppnp and propionate 0.8723 28 57
ID Description Score Start End Superfamily
af_B6SLT9_8_113_3.30.420.100 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9356 29 122 3.30.420.100
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9167 26 122 3.30.420.100
af_A0A2R8QLI3_49_190_3.30.420.80 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribosomal protein S11/S14 0.9156 29 121 3.30.420.80
4dhcS01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9137 28 122 3.30.420.100
af_C0P5F8_195_302_3.30.420.100 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9124 29 121 3.30.420.100
ID Description Score Start End GO Terms
AF-X0TWH5-F1-model_v4 50S ribosomal protein L18 0.9865 34 122 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A7X7F021-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9823 35 121 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A357XTC9-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9736 35 121 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0008097
GO:1990904
AF-B4VPM1-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9726 43 122 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-X0TWH5-F1-model_v4 50S ribosomal protein L18 0.965 34 122 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Map