F467642
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 597 | 367 | 590 | 90 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100599869|Ga0068856_1005998692 |
| Length | 88 |
| Sequence | MAHKKGVGSSRNGRESHSKRLGIKIYGGQVAQAGNILVRQRGTQHHPGLNVGIGKDHTLFALTAGTVVFKKGRKDRSFVVIEPVAEAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 2 | 2643221574 | Brevundimonas sp. Root608 | Isolate | Unclassified |
| 3 | 2643221663 | Brevundimonas sp. Root1279 | Isolate | Unclassified |
| 4 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 5 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 6 | 2941485952 | Brevundimonas faecalis 2814 | Isolate | Rhizosphere |
| 7 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 110 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015684 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 | Metagenome | Unclassified |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 126 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 127 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 190 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 191 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 192 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 193 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 194 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 211 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 213 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 214 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 215 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 221 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 223 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 229 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 230 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 231 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 232 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 233 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 234 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 235 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 236 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 237 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 238 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 239 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 240 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 241 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 242 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 243 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 244 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 247 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 248 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 249 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 250 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 251 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 252 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 253 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 254 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 255 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 256 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 259 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 260 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 261 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 286 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 287 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 288 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 292 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 293 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 294 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 297 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 298 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 299 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 300 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 301 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 302 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 303 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 323 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 346 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 347 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 348 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 349 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 350 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 351 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 352 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 353 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 354 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 355 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 356 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 357 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 358 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 359 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 360 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 361 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 362 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.81 |
| Metatranscriptomes | 3.02 |
| Isolates | 1.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.04 |
| Nodule | 0 |
| Rhizoplane | 4.02 |
| Rhizosphere | 81.57 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.37 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH2_10050513 | 3300003320 | Bacteria | 5592 |
| 2 | Ga0006562J51391_1036509 | 3300003578 | Bacteria | 5206 |
| 3 | Ga0055526_1094353 | 3300003771 | Bacteria | 559 |
| 4 | Ga0055536_1055297 | 3300003781 | Bacteria | 849 |
| 5 | Ga0058861_10016048 | 3300004800 | Bacteria | 693 |
| 6 | Ga0058862_10002028 | 3300004803 | Bacteria | 705 |
| 7 | Ga0065704_10811784 | 3300005289 | Bacteria | 521 |
| 8 | Ga0070676_10010155 | 3300005328 | Bacteria | 5103 |
| 9 | Ga0070670_102194004 | 3300005331 | Bacteria | 509 |
| 10 | Ga0070677_10060459 | 3300005333 | Bacteria | 1561 |
| 11 | Ga0068869_100000612 | 3300005334 | Bacteria | 20160 |
| 12 | Ga0068869_101519059 | 3300005334 | Bacteria | 595 |
| 13 | Ga0070666_10037880 | 3300005335 | Bacteria | 3208 |
| 14 | Ga0070680_100478876 | 3300005336 | Bacteria | 1064 |
| 15 | Ga0070682_100548470 | 3300005337 | Bacteria | 904 |
| 16 | Ga0068868_100288429 | 3300005338 | Bacteria | 1391 |
| 17 | Ga0068868_101710471 | 3300005338 | Bacteria | 593 |
| 18 | Ga0070660_100398500 | 3300005339 | Bacteria | 1138 |
| 19 | Ga0070660_101320627 | 3300005339 | Bacteria | 612 |
| 20 | Ga0070691_10024327 | 3300005341 | Bacteria | 2815 |
| 21 | Ga0070691_10130539 | 3300005341 | Bacteria | 1273 |
| 22 | Ga0070687_100588787 | 3300005343 | Bacteria | 762 |
| 23 | Ga0070668_100483928 | 3300005347 | Bacteria | 1069 |
| 24 | Ga0070675_100062592 | 3300005354 | Bacteria | 3074 |
| 25 | Ga0070671_100434528 | 3300005355 | Bacteria | 1125 |
| 26 | Ga0070674_100000248 | 3300005356 | Bacteria | 26777 |
| 27 | Ga0070673_100268708 | 3300005364 | Bacteria | 1492 |
| 28 | Ga0070688_101034711 | 3300005365 | Bacteria | 654 |
| 29 | Ga0070659_100481843 | 3300005366 | Bacteria | 1056 |
| 30 | Ga0070667_100192087 | 3300005367 | Bacteria | 1809 |
| 31 | Ga0070703_10163233 | 3300005406 | Bacteria | 847 |
| 32 | Ga0070710_10780580 | 3300005437 | Bacteria | 681 |
| 33 | Ga0070710_11232122 | 3300005437 | Bacteria | 554 |
| 34 | Ga0070701_10017696 | 3300005438 | Bacteria | 3336 |
| 35 | Ga0070711_101071417 | 3300005439 | Bacteria | 694 |
| 36 | Ga0070705_100000334 | 3300005440 | Bacteria | 27607 |
| 37 | Ga0070700_100149174 | 3300005441 | Bacteria | 1597 |
| 38 | Ga0070694_100015829 | 3300005444 | Bacteria | 4745 |
| 39 | Ga0070694_100098319 | 3300005444 | Bacteria | 2066 |
| 40 | Ga0070694_100132350 | 3300005444 | Bacteria | 1803 |
| 41 | Ga0070663_100658599 | 3300005455 | Bacteria | 886 |
| 42 | Ga0070663_101663052 | 3300005455 | Bacteria | 570 |
| 43 | Ga0070678_100006191 | 3300005456 | Bacteria | 6996 |
| 44 | Ga0070678_100076480 | 3300005456 | Bacteria | 2522 |
| 45 | Ga0070678_100277400 | 3300005456 | Bacteria | 1416 |
| 46 | Ga0070662_100000325 | 3300005457 | Bacteria | 28539 |
| 47 | Ga0070681_10504411 | 3300005458 | Bacteria | 1123 |
| 48 | Ga0070681_10848805 | 3300005458 | Bacteria | 831 |
| 49 | Ga0068867_100000848 | 3300005459 | Bacteria | 20597 |
| 50 | Ga0068867_100649319 | 3300005459 | Bacteria | 926 |
| 51 | Ga0068867_101352012 | 3300005459 | Bacteria | 659 |
| 52 | Ga0070706_100648510 | 3300005467 | Bacteria | 980 |
| 53 | Ga0070707_100856188 | 3300005468 | Bacteria | 873 |
| 54 | Ga0070699_100104942 | 3300005518 | Bacteria | 2479 |
| 55 | Ga0070679_101479357 | 3300005530 | Bacteria | 626 |
| 56 | Ga0070697_100925519 | 3300005536 | Bacteria | 774 |
| 57 | Ga0070686_100000004 | 3300005544 | Bacteria | 262514 |
| 58 | Ga0070686_100122334 | 3300005544 | Bacteria | 1788 |
| 59 | Ga0070695_100005345 | 3300005545 | Bacteria | 7563 |
| 60 | Ga0070695_100007426 | 3300005545 | Bacteria | 6501 |
| 61 | Ga0070696_100007602 | 3300005546 | Bacteria | 7242 |
| 62 | Ga0070693_100042809 | 3300005547 | Bacteria | 2554 |
| 63 | Ga0070665_100096248 | 3300005548 | Bacteria | 2965 |
| 64 | Ga0070665_101256379 | 3300005548 | Bacteria | 751 |
| 65 | Ga0070665_102649807 | 3300005548 | Bacteria | 502 |
| 66 | Ga0070704_100266363 | 3300005549 | Bacteria | 1414 |
| 67 | Ga0068855_100056196 | 3300005563 | Bacteria | 4619 |
| 68 | Ga0068855_100656708 | 3300005563 | Bacteria | 1126 |
| 69 | Ga0070664_100261657 | 3300005564 | Bacteria | 1557 |
| 70 | Ga0070664_100934650 | 3300005564 | Bacteria | 814 |
| 71 | Ga0068857_100108963 | 3300005577 | Bacteria | 2488 |
| 72 | Ga0068857_100338520 | 3300005577 | Bacteria | 1392 |
| 73 | Ga0068857_100993377 | 3300005577 | Bacteria | 808 |
| 74 | Ga0068857_101099153 | 3300005577 | Bacteria | 768 |
| 75 | Ga0068854_100000421 | 3300005578 | Bacteria | 26467 |
| 76 | Ga0068856_100110715 | 3300005614 | Bacteria | 2743 |
| 77 | Ga0068856_100599869 | 3300005614 | Bacteria | 1122 |
| 78 | Ga0070702_100013531 | 3300005615 | Bacteria | 4120 |
| 79 | Ga0068852_100423905 | 3300005616 | Bacteria | 1313 |
| 80 | Ga0068859_101168430 | 3300005617 | Bacteria | 847 |
| 81 | Ga0068864_100000642 | 3300005618 | Bacteria | 29378 |
| 82 | Ga0068864_100003563 | 3300005618 | Bacteria | 12869 |
| 83 | Ga0068864_101308803 | 3300005618 | Bacteria | 725 |
| 84 | Ga0068866_10000212 | 3300005718 | Bacteria | 27530 |
| 85 | Ga0068861_100020884 | 3300005719 | Bacteria | 4698 |
| 86 | Ga0068861_100180865 | 3300005719 | Bacteria | 1755 |
| 87 | Ga0068861_100321293 | 3300005719 | Bacteria | 1348 |
| 88 | Ga0068870_10011634 | 3300005840 | Bacteria | 4088 |
| 89 | Ga0068870_10165057 | 3300005840 | Bacteria | 1317 |
| 90 | Ga0068863_101180230 | 3300005841 | Bacteria | 771 |
| 91 | Ga0068863_101342939 | 3300005841 | Bacteria | 722 |
| 92 | Ga0068858_100000304 | 3300005842 | Bacteria | 52470 |
| 93 | Ga0068858_100089233 | 3300005842 | Bacteria | 2869 |
| 94 | Ga0068858_100229150 | 3300005842 | Bacteria | 1761 |
| 95 | Ga0068858_100677348 | 3300005842 | Bacteria | 1003 |
| 96 | Ga0068860_100011032 | 3300005843 | Bacteria | 8909 |
| 97 | Ga0068860_102047393 | 3300005843 | Bacteria | 594 |
| 98 | Ga0068860_102735619 | 3300005843 | Bacteria | 512 |
| 99 | Ga0068862_100189379 | 3300005844 | Bacteria | 1850 |
| 100 | Ga0068862_100645301 | 3300005844 | Bacteria | 1021 |
| 101 | Ga0081455_10000017 | 3300005937 | Bacteria | 174550 |
| 102 | Ga0081455_10001033 | 3300005937 | Bacteria | 35145 |
| 103 | Ga0081455_10997467 | 3300005937 | Bacteria | 518 |
| 104 | Ga0081540_1000059 | 3300005983 | Bacteria | 120226 |
| 105 | Ga0081540_1057782 | 3300005983 | Bacteria | 1874 |
| 106 | Ga0081539_10000160 | 3300005985 | Bacteria | 157504 |
| 107 | Ga0075365_10059288 | 3300006038 | Bacteria | 2550 |
| 108 | Ga0075363_100707272 | 3300006048 | Bacteria | 609 |
| 109 | Ga0075364_10249750 | 3300006051 | Bacteria | 1206 |
| 110 | Ga0075362_10094835 | 3300006177 | Bacteria | 1389 |
| 111 | Ga0075362_10653528 | 3300006177 | Bacteria | 546 |
| 112 | Ga0075367_10883227 | 3300006178 | Bacteria | 570 |
| 113 | Ga0075369_10002976 | 3300006186 | Bacteria | 6124 |
| 114 | Ga0075369_10315732 | 3300006186 | Bacteria | 731 |
| 115 | Ga0075366_10194639 | 3300006195 | Bacteria | 1232 |
| 116 | Ga0097621_100083802 | 3300006237 | Bacteria | 2657 |
| 117 | Ga0075370_10146676 | 3300006353 | Bacteria | 1381 |
| 118 | Ga0068871_100136671 | 3300006358 | Bacteria | 2082 |
| 119 | Ga0068871_101640817 | 3300006358 | Bacteria | 609 |
| 120 | Ga0068871_102198770 | 3300006358 | Bacteria | 526 |
| 121 | Ga0075428_100050560 | 3300006844 | Bacteria | 4558 |
| 122 | Ga0075431_100006658 | 3300006847 | Bacteria | 11476 |
| 123 | Ga0075433_10002019 | 3300006852 | Bacteria | 15301 |
| 124 | Ga0075433_10080276 | 3300006852 | Bacteria | 2875 |
| 125 | Ga0075433_10484571 | 3300006852 | Bacteria | 1089 |
| 126 | Ga0075434_100032393 | 3300006871 | Bacteria | 5154 |
| 127 | Ga0075434_100279936 | 3300006871 | Bacteria | 1687 |
| 128 | Ga0075434_100954721 | 3300006871 | Bacteria | 872 |
| 129 | Ga0075429_100099059 | 3300006880 | Bacteria | 2543 |
| 130 | Ga0068865_100000819 | 3300006881 | Bacteria | 17531 |
| 131 | Ga0068865_101037141 | 3300006881 | Bacteria | 720 |
| 132 | Ga0068865_101405614 | 3300006881 | Bacteria | 623 |
| 133 | Ga0075436_101462241 | 3300006914 | Unclassified | 519 |
| 134 | Ga0097620_101168687 | 3300006931 | Bacteria | 847 |
| 135 | Ga0075435_100097945 | 3300007076 | Bacteria | 2427 |
| 136 | Ga0075435_100133339 | 3300007076 | Bacteria | 2079 |
| 137 | Ga0075435_100483629 | 3300007076 | Bacteria | 1069 |
| 138 | Ga0075435_101863231 | 3300007076 | Bacteria | 528 |
| 139 | Ga0099794_10104128 | 3300007265 | Bacteria | 1418 |
| 140 | Ga0111539_10143371 | 3300009094 | Bacteria | 2796 |
| 141 | Ga0111539_10162770 | 3300009094 | Bacteria | 2609 |
| 142 | Ga0105245_10017257 | 3300009098 | Bacteria | 6299 |
| 143 | Ga0105245_10156504 | 3300009098 | Bacteria | 2158 |
| 144 | Ga0105245_12298117 | 3300009098 | Bacteria | 593 |
| 145 | Ga0105247_10739851 | 3300009101 | Bacteria | 744 |
| 146 | Ga0114129_12852736 | 3300009147 | Bacteria | 573 |
| 147 | Ga0105243_10000488 | 3300009148 | Bacteria | 40416 |
| 148 | Ga0105243_13098231 | 3300009148 | Bacteria | 503 |
| 149 | Ga0105241_10002467 | 3300009174 | Bacteria | 13902 |
| 150 | Ga0105242_10000445 | 3300009176 | Bacteria | 32941 |
| 151 | Ga0105242_10781644 | 3300009176 | Bacteria | 943 |
| 152 | Ga0105248_10006674 | 3300009177 | Bacteria | 12666 |
| 153 | Ga0105248_10011310 | 3300009177 | Bacteria | 9840 |
| 154 | Ga0105248_10110329 | 3300009177 | Bacteria | 3102 |
| 155 | Ga0105248_10944101 | 3300009177 | Bacteria | 974 |
| 156 | Ga0105248_11124274 | 3300009177 | Bacteria | 888 |
| 157 | Ga0105248_12622735 | 3300009177 | Bacteria | 575 |
| 158 | Ga0105237_10026608 | 3300009545 | Bacteria | 5913 |
| 159 | Ga0105238_10514738 | 3300009551 | Bacteria | 1199 |
| 160 | Ga0105249_10004027 | 3300009553 | Bacteria | 12680 |
| 161 | Ga0105249_10360087 | 3300009553 | Bacteria | 1476 |
| 162 | Ga0105249_11034012 | 3300009553 | Bacteria | 891 |
| 163 | Ga0105239_10004845 | 3300010375 | Bacteria | 15921 |
| 164 | Ga0105239_10173676 | 3300010375 | Bacteria | 2410 |
| 165 | Ga0105239_10678160 | 3300010375 | Bacteria | 1178 |
| 166 | Ga0105246_10020057 | 3300011119 | Bacteria | 4285 |
| 167 | Ga0105246_10149888 | 3300011119 | Bacteria | 1764 |
| 168 | Ga0105246_11282353 | 3300011119 | Bacteria | 678 |
| 169 | Ga0105246_11446935 | 3300011119 | Bacteria | 643 |
| 170 | Ga0105246_12072115 | 3300011119 | Bacteria | 551 |
| 171 | Ga0157317_1016786 | 3300012475 | Bacteria | 620 |
| 172 | Ga0157326_1035108 | 3300012513 | Bacteria | 681 |
| 173 | Ga0157373_10284061 | 3300013100 | Bacteria | 1173 |
| 174 | Ga0157371_10008337 | 3300013102 | Bacteria | 8271 |
| 175 | Ga0157371_10029003 | 3300013102 | Bacteria | 4006 |
| 176 | Ga0157371_10062787 | 3300013102 | Bacteria | 2633 |
| 177 | Ga0157370_10014471 | 3300013104 | Bacteria | 8065 |
| 178 | Ga0157370_10616493 | 3300013104 | Bacteria | 993 |
| 179 | Ga0157370_10745202 | 3300013104 | Bacteria | 893 |
| 180 | Ga0157369_10007496 | 3300013105 | Bacteria | 12555 |
| 181 | Ga0157369_10008829 | 3300013105 | Bacteria | 11547 |
| 182 | Ga0157369_10385659 | 3300013105 | Bacteria | 1454 |
| 183 | Ga0157378_10652277 | 3300013297 | Bacteria | 1068 |
| 184 | Ga0163162_10005365 | 3300013306 | Bacteria | 12375 |
| 185 | Ga0163162_13468556 | 3300013306 | Bacteria | 502 |
| 186 | Ga0157372_10440671 | 3300013307 | Bacteria | 1518 |
| 187 | Ga0163163_10154430 | 3300014325 | Bacteria | 2339 |
| 188 | Ga0163163_10571765 | 3300014325 | Bacteria | 1193 |
| 189 | Ga0163163_10648689 | 3300014325 | Bacteria | 1119 |
| 190 | Ga0163163_11483274 | 3300014325 | Bacteria | 740 |
| 191 | Ga0157380_10594732 | 3300014326 | Bacteria | 1093 |
| 192 | Ga0157380_10618020 | 3300014326 | Bacteria | 1075 |
| 193 | Ga0157380_10680205 | 3300014326 | Bacteria | 1031 |
| 194 | Ga0157379_10006100 | 3300014968 | Bacteria | 10379 |
| 195 | Ga0157379_10632045 | 3300014968 | Bacteria | 1001 |
| 196 | Ga0157379_10911954 | 3300014968 | Bacteria | 834 |
| 197 | Ga0157379_11244899 | 3300014968 | Bacteria | 717 |
| 198 | Ga0157379_12453539 | 3300014968 | Bacteria | 521 |
| 199 | Ga0183365_10001 | 3300015684 | Bacteria | 2090444 |
| 200 | Ga0163161_10291514 | 3300017792 | Bacteria | 1283 |
| 201 | Ga0163161_10489070 | 3300017792 | Bacteria | 1000 |
| 202 | Ga0163161_10666389 | 3300017792 | Bacteria | 863 |
| 203 | Ga0197907_10667977 | 3300020069 | Bacteria | 890 |
| 204 | Ga0206356_11110789 | 3300020070 | Bacteria | 1432 |
| 205 | Ga0206355_1015572 | 3300020076 | Bacteria | 2043 |
| 206 | Ga0206354_10138590 | 3300020081 | Bacteria | 963 |
| 207 | Ga0206353_11674705 | 3300020082 | Bacteria | 1109 |
| 208 | Ga0213872_10196973 | 3300021361 | Bacteria | 865 |
| 209 | Ga0213875_10010457 | 3300021388 | Bacteria | 4642 |
| 210 | Ga0224712_10308432 | 3300022467 | Bacteria | 741 |
| 211 | Ga0209233_1050102 | 3300025261 | Bacteria | 854 |
| 212 | Ga0209676_1000038 | 3300025292 | Bacteria | 449305 |
| 213 | Ga0209676_1000253 | 3300025292 | Bacteria | 113412 |
| 214 | Ga0209676_1030538 | 3300025292 | Bacteria | 1646 |
| 215 | Ga0209564_1017530 | 3300025295 | Bacteria | 2785 |
| 216 | Ga0209050_1000948 | 3300025298 | Bacteria | 37706 |
| 217 | Ga0209050_1011769 | 3300025298 | Bacteria | 4103 |
| 218 | Ga0209256_1014947 | 3300025299 | Bacteria | 2748 |
| 219 | Ga0209051_1015983 | 3300025303 | Bacteria | 3425 |
| 220 | Ga0209257_1000525 | 3300025304 | Bacteria | 66561 |
| 221 | Ga0209257_1026430 | 3300025304 | Bacteria | 1957 |
| 222 | Ga0207697_10016637 | 3300025315 | Bacteria | 3029 |
| 223 | Ga0207642_10000214 | 3300025899 | Bacteria | 17101 |
| 224 | Ga0207710_10423343 | 3300025900 | Bacteria | 685 |
| 225 | Ga0207680_10010842 | 3300025903 | Bacteria | 4578 |
| 226 | Ga0207645_10002435 | 3300025907 | Bacteria | 14639 |
| 227 | Ga0207643_10009086 | 3300025908 | Bacteria | 5337 |
| 228 | Ga0207684_11386412 | 3300025910 | Bacteria | 576 |
| 229 | Ga0207654_10091794 | 3300025911 | Bacteria | 1853 |
| 230 | Ga0207671_10010300 | 3300025914 | Bacteria | 7727 |
| 231 | Ga0207693_11353120 | 3300025915 | Bacteria | 530 |
| 232 | Ga0207660_10164153 | 3300025917 | Bacteria | 1716 |
| 233 | Ga0207660_10598766 | 3300025917 | Bacteria | 898 |
| 234 | Ga0207662_10094510 | 3300025918 | Bacteria | 1844 |
| 235 | Ga0207662_10593311 | 3300025918 | Bacteria | 770 |
| 236 | Ga0207657_10207928 | 3300025919 | Bacteria | 1572 |
| 237 | Ga0207657_11151757 | 3300025919 | Bacteria | 591 |
| 238 | Ga0207652_11030995 | 3300025921 | Bacteria | 722 |
| 239 | Ga0207681_10090643 | 3300025923 | Bacteria | 2182 |
| 240 | Ga0207650_11632207 | 3300025925 | Bacteria | 547 |
| 241 | Ga0207650_11909567 | 3300025925 | Bacteria | 501 |
| 242 | Ga0207659_10643706 | 3300025926 | Bacteria | 906 |
| 243 | Ga0207687_10662526 | 3300025927 | Bacteria | 884 |
| 244 | Ga0207687_11773013 | 3300025927 | Bacteria | 529 |
| 245 | Ga0207706_10000116 | 3300025933 | Bacteria | 85356 |
| 246 | Ga0207686_10000245 | 3300025934 | Bacteria | 41614 |
| 247 | Ga0207686_10987231 | 3300025934 | Bacteria | 683 |
| 248 | Ga0207709_10004711 | 3300025935 | Bacteria | 7843 |
| 249 | Ga0207669_10000414 | 3300025937 | Bacteria | 18670 |
| 250 | Ga0207704_10002203 | 3300025938 | Bacteria | 8737 |
| 251 | Ga0207704_10927382 | 3300025938 | Bacteria | 733 |
| 252 | Ga0207691_10511071 | 3300025940 | Bacteria | 1020 |
| 253 | Ga0207711_10061675 | 3300025941 | Bacteria | 3233 |
| 254 | Ga0207711_10099230 | 3300025941 | Bacteria | 2574 |
| 255 | Ga0207711_10419461 | 3300025941 | Bacteria | 1245 |
| 256 | Ga0207689_10001745 | 3300025942 | Bacteria | 20517 |
| 257 | Ga0207689_11403177 | 3300025942 | Bacteria | 585 |
| 258 | Ga0207679_10922726 | 3300025945 | Bacteria | 799 |
| 259 | Ga0207679_10965317 | 3300025945 | Bacteria | 781 |
| 260 | Ga0207679_11039734 | 3300025945 | Bacteria | 751 |
| 261 | Ga0207667_10490310 | 3300025949 | Bacteria | 1247 |
| 262 | Ga0207667_11874214 | 3300025949 | Bacteria | 562 |
| 263 | Ga0207651_10081248 | 3300025960 | Bacteria | 2336 |
| 264 | Ga0207712_10196428 | 3300025961 | Bacteria | 1596 |
| 265 | Ga0207712_11146033 | 3300025961 | Bacteria | 693 |
| 266 | Ga0207668_10154011 | 3300025972 | Bacteria | 1783 |
| 267 | Ga0207668_10422729 | 3300025972 | Bacteria | 1131 |
| 268 | Ga0207640_10001361 | 3300025981 | Bacteria | 13219 |
| 269 | Ga0207658_10164863 | 3300025986 | Bacteria | 1819 |
| 270 | Ga0207677_10716465 | 3300026023 | Bacteria | 889 |
| 271 | Ga0207677_10746714 | 3300026023 | Bacteria | 872 |
| 272 | Ga0207703_10000435 | 3300026035 | Bacteria | 43900 |
| 273 | Ga0207703_10057550 | 3300026035 | Bacteria | 3171 |
| 274 | Ga0207703_10498440 | 3300026035 | Bacteria | 1143 |
| 275 | Ga0207639_10364649 | 3300026041 | Bacteria | 1294 |
| 276 | Ga0207678_10429514 | 3300026067 | Bacteria | 1146 |
| 277 | Ga0207708_10121162 | 3300026075 | Bacteria | 2038 |
| 278 | Ga0207708_10245196 | 3300026075 | Bacteria | 1442 |
| 279 | Ga0207702_10628793 | 3300026078 | Bacteria | 1055 |
| 280 | Ga0207648_10000030 | 3300026089 | Bacteria | 129654 |
| 281 | Ga0207648_10376312 | 3300026089 | Bacteria | 1283 |
| 282 | Ga0207676_10000603 | 3300026095 | Bacteria | 29490 |
| 283 | Ga0207676_10010071 | 3300026095 | Bacteria | 6727 |
| 284 | Ga0207674_10007183 | 3300026116 | Bacteria | 13001 |
| 285 | Ga0207674_10038821 | 3300026116 | Bacteria | 4940 |
| 286 | Ga0207674_10378757 | 3300026116 | Bacteria | 1368 |
| 287 | Ga0207675_100059407 | 3300026118 | Bacteria | 3568 |
| 288 | Ga0207675_100250019 | 3300026118 | Bacteria | 1716 |
| 289 | Ga0207675_100930676 | 3300026118 | Bacteria | 886 |
| 290 | Ga0207675_101031404 | 3300026118 | Bacteria | 841 |
| 291 | Ga0207683_10038280 | 3300026121 | Bacteria | 4179 |
| 292 | Ga0207683_10096754 | 3300026121 | Bacteria | 2632 |
| 293 | Ga0207698_10599357 | 3300026142 | Bacteria | 1086 |
| 294 | Ga0209974_10252951 | 3300027876 | Bacteria | 663 |
| 295 | Ga0207428_10043517 | 3300027907 | Bacteria | 3626 |
| 296 | Ga0207428_10160117 | 3300027907 | Bacteria | 1709 |
| 297 | Ga0268266_10136255 | 3300028379 | Bacteria | 2199 |
| 298 | Ga0268266_12186136 | 3300028379 | Bacteria | 525 |
| 299 | Ga0268265_10512375 | 3300028380 | Bacteria | 1132 |
| 300 | Ga0268265_10944934 | 3300028380 | Bacteria | 849 |
| 301 | Ga0268265_11190337 | 3300028380 | Bacteria | 759 |
| 302 | Ga0268265_11359482 | 3300028380 | Bacteria | 711 |
| 303 | Ga0268264_10009141 | 3300028381 | Bacteria | 8215 |
| 304 | Ga0268264_11099948 | 3300028381 | Bacteria | 803 |
| 305 | Ga0265319_1121503 | 3300028563 | Bacteria | 814 |
| 306 | Ga0307517_10583140 | 3300028786 | Bacteria | 553 |
| 307 | Ga0311001_1032624 | 3300029277 | Bacteria | 738 |
| 308 | Ga0265328_10403329 | 3300031239 | Bacteria | 537 |
| 309 | Ga0265325_10231624 | 3300031241 | Bacteria | 842 |
| 310 | Ga0265329_10140096 | 3300031242 | Bacteria | 781 |
| 311 | Ga0265329_10219553 | 3300031242 | Bacteria | 629 |
| 312 | Ga0265340_10172388 | 3300031247 | Bacteria | 980 |
| 313 | Ga0265339_10180145 | 3300031249 | Bacteria | 1053 |
| 314 | Ga0265316_10164656 | 3300031344 | Bacteria | 1657 |
| 315 | Ga0307513_10033854 | 3300031456 | Bacteria | 5739 |
| 316 | Ga0307509_10376128 | 3300031507 | Bacteria | 1135 |
| 317 | Ga0307408_101947269 | 3300031548 | Bacteria | 564 |
| 318 | Ga0265314_10242188 | 3300031711 | Bacteria | 1040 |
| 319 | Ga0265314_10432197 | 3300031711 | Bacteria | 705 |
| 320 | Ga0265342_10225169 | 3300031712 | Bacteria | 1009 |
| 321 | Ga0316578_10257515 | 3300031728 | Bacteria | 1046 |
| 322 | Ga0307405_11030086 | 3300031731 | Bacteria | 704 |
| 323 | Ga0316577_10430668 | 3300031733 | Bacteria | 749 |
| 324 | Ga0307406_10001233 | 3300031901 | Bacteria | 14337 |
| 325 | Ga0307406_10093084 | 3300031901 | Bacteria | 2034 |
| 326 | Ga0307406_11404827 | 3300031901 | Bacteria | 612 |
| 327 | Ga0307412_10001766 | 3300031911 | Bacteria | 11941 |
| 328 | Ga0307412_10009058 | 3300031911 | Bacteria | 5704 |
| 329 | Ga0307412_10868354 | 3300031911 | Bacteria | 788 |
| 330 | Ga0307409_100274362 | 3300031995 | Bacteria | 1555 |
| 331 | Ga0307409_100317421 | 3300031995 | Bacteria | 1457 |
| 332 | Ga0307416_100196478 | 3300032002 | Bacteria | 1909 |
| 333 | Ga0307416_102387481 | 3300032002 | Bacteria | 628 |
| 334 | Ga0307415_101201950 | 3300032126 | Bacteria | 714 |
| 335 | Ga0316583_10035019 | 3300032133 | Bacteria | 1782 |
| 336 | Ga0316593_10277332 | 3300032168 | Bacteria | 631 |
| 337 | Ga0316593_10316704 | 3300032168 | Bacteria | 593 |
| 338 | Ga0307510_10003966 | 3300033180 | Bacteria | 17345 |
| 339 | Ga0373959_0023917 | 3300034820 | Bacteria | 1191 |
| 340 | Ga0373938_0025607 | 3300034957 | Bacteria | 1229 |
| 341 | Ga0373928_0023385 | 3300035084 | Bacteria | 1318 |
| 342 | Ga0373929_0130594 | 3300035085 | Bacteria | 658 |
| 343 | Ga0373940_0074401 | 3300035088 | Bacteria | 994 |
| 344 | Ga0373940_0118960 | 3300035088 | Bacteria | 818 |
| 345 | Ga0373949_0004422 | 3300035090 | Bacteria | 3227 |
| 346 | Ga0373951_0007601 | 3300035091 | Bacteria | 2461 |
| 347 | Ga0373952_0001971 | 3300035092 | Bacteria | 3709 |
| 348 | Ga0373941_0002622 | 3300035115 | Bacteria | 3987 |
| 349 | Ga0373941_0227313 | 3300035115 | Bacteria | 720 |
| 350 | Ga0373960_0003749 | 3300035121 | Bacteria | 3454 |
| 351 | Ga0373942_0030882 | 3300035207 | Bacteria | 1413 |
| 352 | Ga0373961_0001996 | 3300035241 | Bacteria | 5485 |
| 353 | Ga0373962_0003662 | 3300035242 | Bacteria | 3696 |
| 354 | Ga0373931_0004929 | 3300035691 | Bacteria | 6137 |
| 355 | Ga0373937_1537196 | 3300036401 | Bacteria | 613 |
| 356 | Ga0395899_0128632 | 3300037312 | Bacteria | 1810 |
| 357 | Ga0395899_0191311 | 3300037312 | Bacteria | 1432 |
| 358 | Ga0395899_0508331 | 3300037312 | Bacteria | 781 |
| 359 | Ga0395900_0096102 | 3300037418 | Bacteria | 3044 |
| 360 | Ga0395900_1184735 | 3300037418 | Bacteria | 680 |
| 361 | Ga0395898_0090798 | 3300037466 | Bacteria | 2939 |
| 362 | Ga0395898_0769144 | 3300037466 | Bacteria | 904 |
| 363 | Ga0395905_0218958 | 3300037471 | Bacteria | 1782 |
| 364 | Ga0316581_0069120 | 3300037588 | Bacteria | 1084 |
| 365 | Ga0436364_1150066 | 3300037853 | Bacteria | 29298 |
| 366 | Ga0395901_0275428 | 3300038443 | Bacteria | 1749 |
| 367 | Ga0400488_39798 | 3300038741 | Bacteria | 1352 |
| 368 | Ga0436365_0115775 | 3300039437 | Bacteria | 716 |
| 369 | Ga0436365_0748526 | 3300039437 | Bacteria | 1237 |
| 370 | Ga0436365_1784067 | 3300039437 | Bacteria | 1669 |
| 371 | Ga0436361_0093866 | 3300039447 | Bacteria | 1698 |
| 372 | Ga0436363_0653852 | 3300039450 | Bacteria | 1136 |
| 373 | Ga0436362_0219308 | 3300039453 | Bacteria | 546 |
| 374 | Ga0451793_1071520 | 3300041452 | Bacteria | 565 |
| 375 | Ga0451800_1394774 | 3300041459 | Bacteria | 986 |
| 376 | Ga0451802_0195283 | 3300041460 | Bacteria | 630 |
| 377 | Ga0451805_025979 | 3300041461 | Bacteria | 580 |
| 378 | Ga0451804_0199340 | 3300041463 | Bacteria | 795 |
| 379 | Ga0451804_0945728 | 3300041463 | Bacteria | 546 |
| 380 | Ga0451807_2077697 | 3300041486 | Bacteria | 1293 |
| 381 | Ga0451833_0599544 | 3300041491 | Bacteria | 576 |
| 382 | Ga0451841_0664151 | 3300041498 | Bacteria | 748 |
| 383 | Ga0451845_0749816 | 3300041501 | Bacteria | 570 |
| 384 | Ga0451853_0109637 | 3300041512 | Bacteria | 1262 |
| 385 | Ga0451853_0965893 | 3300041512 | Bacteria | 598 |
| 386 | Ga0439431_0071041 | 3300041997 | Bacteria | 928 |
| 387 | Ga0439442_066180 | 3300042002 | Bacteria | 768 |
| 388 | Ga0439462_0105760 | 3300042015 | Bacteria | 778 |
| 389 | Ga0451577_0000703 | 3300042876 | Bacteria | 52315 |
| 390 | Ga0451577_0069497 | 3300042876 | Bacteria | 3141 |
| 391 | Ga0451577_0111122 | 3300042876 | Bacteria | 2452 |
| 392 | Ga0451577_0174551 | 3300042876 | Bacteria | 1937 |
| 393 | Ga0466972_0038882 | 3300044658 | Bacteria | 2324 |
| 394 | Ga0453683_0000045 | 3300044673 | Bacteria | 211088 |
| 395 | Ga0453683_0002370 | 3300044673 | Bacteria | 14734 |
| 396 | Ga0453683_0028862 | 3300044673 | Bacteria | 3511 |
| 397 | Ga0453683_0176855 | 3300044673 | Bacteria | 1353 |
| 398 | Ga0453683_0189701 | 3300044673 | Bacteria | 1304 |
| 399 | Ga0466965_0936974 | 3300044683 | Bacteria | 506 |
| 400 | Ga0466963_0548445 | 3300044694 | Bacteria | 816 |
| 401 | Ga0453684_0001990 | 3300044712 | Bacteria | 52425 |
| 402 | Ga0453684_0008021 | 3300044712 | Bacteria | 19108 |
| 403 | Ga0453684_0026846 | 3300044712 | Bacteria | 8296 |
| 404 | Ga0453684_0370049 | 3300044712 | Bacteria | 1611 |
| 405 | Ga0453684_0466332 | 3300044712 | Bacteria | 1403 |
| 406 | Ga0453684_0909661 | 3300044712 | Bacteria | 942 |
| 407 | Ga0451576_0000352 | 3300045051 | Bacteria | 110468 |
| 408 | Ga0451576_0007865 | 3300045051 | Bacteria | 12634 |
| 409 | Ga0451576_0025294 | 3300045051 | Bacteria | 6397 |
| 410 | Ga0451576_0147560 | 3300045051 | Bacteria | 2453 |
| 411 | Ga0451576_0216379 | 3300045051 | Bacteria | 2000 |
| 412 | Ga0451576_0244749 | 3300045051 | Unclassified | 1874 |
| 413 | Ga0451576_0387687 | 3300045051 | Bacteria | 1464 |
| 414 | Ga0451576_0857159 | 3300045051 | Bacteria | 953 |
| 415 | Ga0466967_0125509 | 3300045976 | Bacteria | 2377 |
| 416 | Ga0466967_1016346 | 3300045976 | Bacteria | 826 |
| 417 | Ga0466967_1258560 | 3300045976 | Bacteria | 737 |
| 418 | Ga0495603_0009766 | 3300046455 | Bacteria | 5808 |
| 419 | Ga0495590_0006457 | 3300046457 | Bacteria | 4576 |
| 420 | Ga0495638_0051220 | 3300046460 | Bacteria | 2575 |
| 421 | Ga0495638_0122540 | 3300046460 | Bacteria | 1535 |
| 422 | Ga0495650_0014402 | 3300046471 | Bacteria | 4118 |
| 423 | Ga0495662_0354654 | 3300046476 | Unclassified | 721 |
| 424 | Ga0495584_0346853 | 3300046491 | Bacteria | 754 |
| 425 | Ga0495584_0480986 | 3300046491 | Bacteria | 632 |
| 426 | Ga0495585_0437815 | 3300046492 | Bacteria | 626 |
| 427 | Ga0495594_0022729 | 3300046499 | Bacteria | 3355 |
| 428 | Ga0495583_0128692 | 3300046506 | Bacteria | 1061 |
| 429 | Ga0495583_0210609 | 3300046506 | Bacteria | 788 |
| 430 | Ga0495606_0050694 | 3300046507 | Bacteria | 2713 |
| 431 | Ga0495632_0073983 | 3300046519 | Bacteria | 1633 |
| 432 | Ga0495632_0092109 | 3300046519 | Bacteria | 1436 |
| 433 | Ga0495643_0115052 | 3300046522 | Bacteria | 1364 |
| 434 | Ga0495643_0119942 | 3300046522 | Bacteria | 1330 |
| 435 | Ga0495648_0066404 | 3300046524 | Bacteria | 2115 |
| 436 | Ga0495597_0069789 | 3300046542 | Bacteria | 1516 |
| 437 | Ga0495597_0230572 | 3300046542 | Bacteria | 733 |
| 438 | Ga0495645_0962710 | 3300046543 | Bacteria | 504 |
| 439 | Ga0495668_0016116 | 3300046616 | Bacteria | 4348 |
| 440 | Ga0495668_0404200 | 3300046616 | Bacteria | 750 |
| 441 | Ga0495625_0008402 | 3300046660 | Bacteria | 8814 |
| 442 | Ga0495625_0165668 | 3300046660 | Bacteria | 1478 |
| 443 | Ga0495625_0205165 | 3300046660 | Bacteria | 1298 |
| 444 | Ga0495625_0364127 | 3300046660 | Bacteria | 911 |
| 445 | Ga0495647_0641061 | 3300046681 | Bacteria | 500 |
| 446 | Ga0495636_0684132 | 3300047318 | Bacteria | 505 |
| 447 | Ga0495636_0689485 | 3300047318 | Bacteria | 504 |
| 448 | Ga0495674_0716861 | 3300047319 | Unclassified | 784 |
| 449 | Ga0495680_0217026 | 3300047322 | Bacteria | 1367 |
| 450 | Ga0495677_0001751 | 3300047445 | Bacteria | 8698 |
| 451 | Ga0495686_0034842 | 3300047472 | Bacteria | 3239 |
| 452 | Ga0495686_0055301 | 3300047472 | Bacteria | 2482 |
| 453 | Ga0495686_0142624 | 3300047472 | Bacteria | 1412 |
| 454 | Ga0495615_0165720 | 3300048090 | Bacteria | 666 |
| 455 | Ga0496102_0543699 | 3300048905 | Bacteria | 1084 |
| 456 | Ga0496104_0000560 | 3300048907 | Bacteria | 31696 |
| 457 | Ga0496105_0003456 | 3300048908 | Bacteria | 11690 |
| 458 | Ga0496106_0134030 | 3300048909 | Bacteria | 1944 |
| 459 | Ga0496108_0005016 | 3300048911 | Bacteria | 10695 |
| 460 | Ga0496109_0008389 | 3300048912 | Bacteria | 8782 |
| 461 | Ga0496110_0000436 | 3300048913 | Bacteria | 28367 |
| 462 | Ga0496110_1658161 | 3300048913 | Bacteria | 549 |
| 463 | Ga0496111_0003534 | 3300048914 | Bacteria | 9669 |
| 464 | Ga0496111_0575049 | 3300048914 | Bacteria | 826 |
| 465 | Ga0496111_0908890 | 3300048914 | Bacteria | 634 |
| 466 | Ga0496112_0050030 | 3300048915 | Bacteria | 4097 |
| 467 | Ga0496112_0425265 | 3300048915 | Bacteria | 1267 |
| 468 | Ga0496113_0000567 | 3300048916 | Bacteria | 18393 |
| 469 | Ga0496113_0386304 | 3300048916 | Bacteria | 1124 |
| 470 | Ga0496115_0086651 | 3300048918 | Bacteria | 2555 |
| 471 | Ga0496115_1090046 | 3300048918 | Bacteria | 606 |
| 472 | Ga0496116_0117646 | 3300048919 | Bacteria | 1546 |
| 473 | Ga0496120_0066306 | 3300048923 | Bacteria | 1997 |
| 474 | Ga0496122_0012019 | 3300048925 | Bacteria | 8680 |
| 475 | Ga0496122_0476093 | 3300048925 | Bacteria | 613 |
| 476 | Ga0496123_0002911 | 3300048926 | Bacteria | 20019 |
| 477 | Ga0496123_0022534 | 3300048926 | Bacteria | 4850 |
| 478 | Ga0496123_0532543 | 3300048926 | Bacteria | 507 |
| 479 | Ga0496124_0000684 | 3300048927 | Bacteria | 55763 |
| 480 | Ga0496124_0003283 | 3300048927 | Bacteria | 19954 |
| 481 | Ga0496124_0020387 | 3300048927 | Bacteria | 6127 |
| 482 | Ga0496125_0006253 | 3300048928 | Bacteria | 12946 |
| 483 | Ga0496125_0221593 | 3300048928 | Bacteria | 1218 |
| 484 | Ga0496126_0103407 | 3300048929 | Bacteria | 2489 |
| 485 | Ga0496126_0690812 | 3300048929 | Bacteria | 794 |
| 486 | Ga0501307_026944 | 3300049162 | Bacteria | 779 |
| 487 | Ga0495682_0050892 | 3300049460 | Bacteria | 1507 |
| 488 | Ga0501314_032243 | 3300049530 | Bacteria | 586 |
| 489 | Ga0501031_0267974 | 3300049568 | Bacteria | 1109 |
| 490 | Ga0501032_0345317 | 3300049569 | Bacteria | 959 |
| 491 | Ga0501032_0512389 | 3300049569 | Bacteria | 766 |
| 492 | Ga0501033_0043329 | 3300049570 | Bacteria | 3352 |
| 493 | Ga0501034_0001769 | 3300049571 | Bacteria | 27612 |
| 494 | Ga0501034_0088327 | 3300049571 | Bacteria | 3098 |
| 495 | Ga0501034_0091659 | 3300049571 | Bacteria | 3036 |
| 496 | Ga0501034_0429692 | 3300049571 | Bacteria | 1241 |
| 497 | Ga0501034_0704512 | 3300049571 | Bacteria | 908 |
| 498 | Ga0501036_0990916 | 3300049572 | Bacteria | 688 |
| 499 | Ga0501037_0030278 | 3300049573 | Bacteria | 4000 |
| 500 | Ga0501037_0228170 | 3300049573 | Bacteria | 1308 |
| 501 | Ga0501037_0521951 | 3300049573 | Bacteria | 804 |
| 502 | Ga0501037_1008621 | 3300049573 | Bacteria | 542 |
| 503 | Ga0501037_1053088 | 3300049573 | Bacteria | 528 |
| 504 | Ga0501038_0735284 | 3300049574 | Bacteria | 737 |
| 505 | Ga0501039_0012984 | 3300049575 | Bacteria | 6369 |
| 506 | Ga0501039_0255481 | 3300049575 | Bacteria | 1378 |
| 507 | Ga0501039_0619705 | 3300049575 | Bacteria | 848 |
| 508 | Ga0501040_0082033 | 3300049576 | Bacteria | 2235 |
| 509 | Ga0501040_1047283 | 3300049576 | Bacteria | 592 |
| 510 | Ga0501041_0782036 | 3300049577 | Bacteria | 612 |
| 511 | Ga0501041_1151516 | 3300049577 | Bacteria | 500 |
| 512 | Ga0501042_0317779 | 3300049578 | Bacteria | 1125 |
| 513 | Ga0501043_0060465 | 3300049579 | Bacteria | 2974 |
| 514 | Ga0501043_0559274 | 3300049579 | Bacteria | 849 |
| 515 | Ga0501046_0470970 | 3300049580 | Bacteria | 902 |
| 516 | Ga0501047_0074907 | 3300049581 | Bacteria | 3258 |
| 517 | Ga0501047_0505683 | 3300049581 | Bacteria | 1035 |
| 518 | Ga0501068_0425122 | 3300049584 | Unclassified | 858 |
| 519 | Ga0501070_0130207 | 3300049586 | Bacteria | 2079 |
| 520 | Ga0501071_1224329 | 3300049587 | Bacteria | 580 |
| 521 | Ga0501071_1352999 | 3300049587 | Bacteria | 550 |
| 522 | Ga0501072_0004259 | 3300049588 | Bacteria | 10851 |
| 523 | Ga0501072_0172002 | 3300049588 | Bacteria | 1729 |
| 524 | Ga0501073_0346651 | 3300049589 | Bacteria | 1025 |
| 525 | Ga0501074_1338533 | 3300049590 | Bacteria | 502 |
| 526 | Ga0501076_0551202 | 3300049592 | Bacteria | 951 |
| 527 | Ga0501076_0620438 | 3300049592 | Bacteria | 892 |
| 528 | Ga0501076_0691077 | 3300049592 | Bacteria | 842 |
| 529 | Ga0501076_0877952 | 3300049592 | Bacteria | 739 |
| 530 | Ga0501077_0104367 | 3300049593 | Bacteria | 1796 |
| 531 | Ga0501077_0542275 | 3300049593 | Bacteria | 746 |
| 532 | Ga0501079_0644469 | 3300049741 | Bacteria | 834 |
| 533 | Ga0501081_0870598 | 3300049743 | Bacteria | 679 |
| 534 | Ga0501083_0032340 | 3300049744 | Bacteria | 3588 |
| 535 | Ga0501083_0105475 | 3300049744 | Bacteria | 1856 |
| 536 | Ga0501083_0832889 | 3300049744 | Bacteria | 600 |
| 537 | Ga0501035_0743561 | 3300049822 | Bacteria | 788 |
| 538 | Ga0501035_1359439 | 3300049822 | Bacteria | 546 |
| 539 | Ga0501045_0864544 | 3300049824 | Bacteria | 665 |
| 540 | nmdc:mga03n38_734481_c1 | 3300050490 | Bacteria | 571 |
| 541 | nmdc:mga0yw44_185731_c1 | 3300050492 | Bacteria | 1370 |
| 542 | nmdc:mga0k408_23848_c1 | 3300050493 | Bacteria | 3456 |
| 543 | nmdc:mga0k408_272198_c1 | 3300050493 | Bacteria | 1011 |
| 544 | nmdc:mga07m45_25876_c1 | 3300050496 | Bacteria | 3222 |
| 545 | nmdc:mga05p37_501440_c1 | 3300050507 | Bacteria | 1393 |
| 546 | nmdc:mga09592_697099_c1 | 3300050508 | Bacteria | 864 |
| 547 | nmdc:mga06r32_1665_c1 | 3300050510 | Bacteria | 20044 |
| 548 | nmdc:mga08y16_63600_c1 | 3300050511 | Bacteria | 3854 |
| 549 | nmdc:mga08y16_913454_c1 | 3300050511 | Bacteria | 863 |
| 550 | nmdc:mga0n895_1527513_c1 | 3300050512 | Bacteria | 633 |
| 551 | nmdc:mga0n895_3715_c1 | 3300050512 | Bacteria | 12345 |
| 552 | nmdc:mga0n895_46456_c1 | 3300050512 | Bacteria | 4242 |
| 553 | nmdc:mga0n895_719464_c1 | 3300050512 | Bacteria | 993 |
| 554 | nmdc:mga0rr50_127096_c1 | 3300050513 | Bacteria | 2037 |
| 555 | nmdc:mga0rr50_335678_c1 | 3300050513 | Bacteria | 1269 |
| 556 | nmdc:mga08x19_144753_c1 | 3300050514 | Bacteria | 1607 |
| 557 | nmdc:mga0a205_133061_c1 | 3300050515 | Bacteria | 2387 |
| 558 | nmdc:mga0a205_1678_c1 | 3300050515 | Bacteria | 19104 |
| 559 | nmdc:mga0a205_367632_c1 | 3300050515 | Bacteria | 1304 |
| 560 | nmdc:mga0a205_763315_c1 | 3300050515 | Bacteria | 815 |
| 561 | Ga0500578_0052858 | 3300053086 | Bacteria | 2601 |
| 562 | Ga0500643_000620 | 3300053087 | Bacteria | 24035 |
| 563 | Ga0500646_0050422 | 3300053090 | Bacteria | 1200 |
| 564 | Ga0500583_0040704 | 3300053092 | Bacteria | 2106 |
| 565 | Ga0500651_0665818 | 3300053093 | Bacteria | 559 |
| 566 | Ga0500651_0669906 | 3300053093 | Bacteria | 557 |
| 567 | Ga0500650_0083677 | 3300053098 | Bacteria | 1492 |
| 568 | Ga0500555_040251 | 3300053103 | Bacteria | 1303 |
| 569 | Ga0500556_0103036 | 3300053104 | Bacteria | 1101 |
| 570 | Ga0500556_0235543 | 3300053104 | Bacteria | 721 |
| 571 | Ga0500562_046713 | 3300053108 | Bacteria | 1155 |
| 572 | Ga0500608_000544 | 3300053122 | Bacteria | 14103 |
| 573 | Ga0500642_0435744 | 3300053130 | Bacteria | 565 |
| 574 | Ga0500652_004220 | 3300053131 | Bacteria | 4428 |
| 575 | Ga0500559_0052896 | 3300053136 | Bacteria | 1796 |
| 576 | Ga0500559_0168967 | 3300053136 | Bacteria | 1029 |
| 577 | Ga0500588_0008763 | 3300053146 | Bacteria | 2377 |
| 578 | Ga0500616_0449461 | 3300053153 | Bacteria | 508 |
| 579 | Ga0500622_0019061 | 3300053156 | Bacteria | 3644 |
| 580 | Ga0500627_0112322 | 3300053158 | Bacteria | 1227 |
| 581 | Ga0501084_0058626 | 3300054114 | Bacteria | 3222 |
| 582 | Ga0501084_0299868 | 3300054114 | Bacteria | 1357 |
| 583 | Ga0501084_0821191 | 3300054114 | Bacteria | 783 |
| 584 | Ga0501084_1087406 | 3300054114 | Bacteria | 671 |
| 585 | Ga0587101_035285 | 3300059623 | Bacteria | 801 |
| 586 | Ga0587107_096593 | 3300059652 | Bacteria | 579 |
| 587 | Ga0587111_0086681 | 3300060346 | Bacteria | 758 |
| 588 | Ga0501082_0654908 | 3300060353 | Bacteria | 919 |
| 589 | Ga0501082_1196800 | 3300060353 | Bacteria | 664 |
| 590 | Ga0530510_0281835 | 3300061734 | Bacteria | 1241 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2522572158 | 2523104118 | 82 |
| 2 | iso_pu_bacteria | 2643221574 | 2643884120 | 82 |
| 3 | iso_pu_bacteria | 2643221663 | 2644353379 | 82 |
| 4 | iso_pu_bacteria | 2643221699 | 2644551556 | 82 |
| 5 | iso_pu_bacteria | 2928972540 | 2928974219 | 82 |
| 6 | iso_pu_bacteria | 2941485952 | 2941486183 | 82 |
| 7 | iso_pu_bacteria | 2977240413 | 2977240818 | 82 |
| 8 | 3300005328 | Ga0070676_10010155 | Ga0070676_100101553 | 83 |
| 9 | 3300005333 | Ga0070677_10060459 | Ga0070677_100604592 | 83 |
| 10 | 3300005334 | Ga0068869_100000612 | Ga0068869_1000006126 | 83 |
| 11 | 3300005335 | Ga0070666_10037880 | Ga0070666_100378802 | 83 |
| 12 | 3300005336 | Ga0070680_100478876 | Ga0070680_1004788762 | 83 |
| 13 | 3300005337 | Ga0070682_100548470 | Ga0070682_1005484702 | 83 |
| 14 | 3300005338 | Ga0068868_100288429 | Ga0068868_1002884292 | 83 |
| 15 | 3300005338 | Ga0068868_101710471 | Ga0068868_1017104712 | 83 |
| 16 | 3300005339 | Ga0070660_101320627 | Ga0070660_1013206271 | 83 |
| 17 | 3300005341 | Ga0070691_10130539 | Ga0070691_101305392 | 83 |
| 18 | 3300005343 | Ga0070687_100588787 | Ga0070687_1005887872 | 83 |
| 19 | 3300005355 | Ga0070671_100434528 | Ga0070671_1004345282 | 83 |
| 20 | 3300005356 | Ga0070674_100000248 | Ga0070674_1000002487 | 83 |
| 21 | 3300005364 | Ga0070673_100268708 | Ga0070673_1002687082 | 83 |
| 22 | 3300005366 | Ga0070659_100481843 | Ga0070659_1004818432 | 83 |
| 23 | 3300005367 | Ga0070667_100192087 | Ga0070667_1001920873 | 83 |
| 24 | 3300005438 | Ga0070701_10017696 | Ga0070701_100176963 | 83 |
| 25 | 3300005440 | Ga0070705_100000334 | Ga0070705_10000033412 | 83 |
| 26 | 3300005441 | Ga0070700_100149174 | Ga0070700_1001491742 | 83 |
| 27 | 3300005444 | Ga0070694_100015829 | Ga0070694_1000158296 | 83 |
| 28 | 3300005444 | Ga0070694_100098319 | Ga0070694_1000983193 | 83 |
| 29 | 3300005455 | Ga0070663_100658599 | Ga0070663_1006585992 | 83 |
| 30 | 3300005456 | Ga0070678_100006191 | Ga0070678_1000061919 | 83 |
| 31 | 3300005457 | Ga0070662_100000325 | Ga0070662_10000032525 | 83 |
| 32 | 3300005459 | Ga0068867_100000848 | Ga0068867_10000084812 | 83 |
| 33 | 3300005467 | Ga0070706_100648510 | Ga0070706_1006485103 | 83 |
| 34 | 3300005468 | Ga0070707_100856188 | Ga0070707_1008561882 | 83 |
| 35 | 3300005518 | Ga0070699_100104942 | Ga0070699_1001049422 | 83 |
| 36 | 3300005530 | Ga0070679_101479357 | Ga0070679_1014793571 | 83 |
| 37 | 3300005536 | Ga0070697_100925519 | Ga0070697_1009255191 | 83 |
| 38 | 3300005544 | Ga0070686_100122334 | Ga0070686_1001223343 | 83 |
| 39 | 3300005545 | Ga0070695_100007426 | Ga0070695_1000074263 | 83 |
| 40 | 3300005546 | Ga0070696_100007602 | Ga0070696_1000076023 | 83 |
| 41 | 3300005547 | Ga0070693_100042809 | Ga0070693_1000428093 | 83 |
| 42 | 3300005548 | Ga0070665_100096248 | Ga0070665_1000962483 | 83 |
| 43 | 3300005549 | Ga0070704_100266363 | Ga0070704_1002663633 | 83 |
| 44 | 3300005563 | Ga0068855_100056196 | Ga0068855_1000561969 | 83 |
| 45 | 3300005564 | Ga0070664_100934650 | Ga0070664_1009346502 | 83 |
| 46 | 3300005577 | Ga0068857_100108963 | Ga0068857_1001089633 | 83 |
| 47 | 3300005577 | Ga0068857_100338520 | Ga0068857_1003385203 | 83 |
| 48 | 3300005578 | Ga0068854_100000421 | Ga0068854_10000042116 | 83 |
| 49 | 3300005614 | Ga0068856_100110715 | Ga0068856_1001107153 | 83 |
| 50 | 3300005615 | Ga0070702_100013531 | Ga0070702_1000135313 | 83 |
| 51 | 3300005618 | Ga0068864_100003563 | Ga0068864_1000035638 | 83 |
| 52 | 3300005718 | Ga0068866_10000212 | Ga0068866_100002127 | 83 |
| 53 | 3300005719 | Ga0068861_100020884 | Ga0068861_1000208843 | 83 |
| 54 | 3300005840 | Ga0068870_10011634 | Ga0068870_100116342 | 83 |
| 55 | 3300005842 | Ga0068858_100089233 | Ga0068858_1000892336 | 83 |
| 56 | 3300005842 | Ga0068858_100229150 | Ga0068858_1002291502 | 83 |
| 57 | 3300005843 | Ga0068860_100011032 | Ga0068860_1000110324 | 83 |
| 58 | 3300005844 | Ga0068862_100189379 | Ga0068862_1001893794 | 83 |
| 59 | 3300006237 | Ga0097621_100083802 | Ga0097621_1000838023 | 83 |
| 60 | 3300006358 | Ga0068871_100136671 | Ga0068871_1001366714 | 83 |
| 61 | 3300006852 | Ga0075433_10080276 | Ga0075433_100802766 | 83 |
| 62 | 3300006852 | Ga0075433_10484571 | Ga0075433_104845712 | 83 |
| 63 | 3300006871 | Ga0075434_100954721 | Ga0075434_1009547211 | 83 |
| 64 | 3300006881 | Ga0068865_100000819 | Ga0068865_1000008193 | 83 |
| 65 | 3300007076 | Ga0075435_101863231 | Ga0075435_1018632311 | 83 |
| 66 | 3300009098 | Ga0105245_10017257 | Ga0105245_100172572 | 83 |
| 67 | 3300009148 | Ga0105243_10000488 | Ga0105243_1000048819 | 83 |
| 68 | 3300009174 | Ga0105241_10002467 | Ga0105241_1000246716 | 83 |
| 69 | 3300009176 | Ga0105242_10000445 | Ga0105242_1000044524 | 83 |
| 70 | 3300009177 | Ga0105248_10006674 | Ga0105248_100066747 | 83 |
| 71 | 3300009177 | Ga0105248_10110329 | Ga0105248_101103293 | 83 |
| 72 | 3300009551 | Ga0105238_10514738 | Ga0105238_105147382 | 83 |
| 73 | 3300009553 | Ga0105249_10004027 | Ga0105249_100040273 | 83 |
| 74 | 3300009553 | Ga0105249_11034012 | Ga0105249_110340122 | 83 |
| 75 | 3300010375 | Ga0105239_10004845 | Ga0105239_100048455 | 83 |
| 76 | 3300011119 | Ga0105246_10020057 | Ga0105246_100200572 | 83 |
| 77 | 3300011119 | Ga0105246_11446935 | Ga0105246_114469351 | 83 |
| 78 | 3300013102 | Ga0157371_10062787 | Ga0157371_100627871 | 83 |
| 79 | 3300013306 | Ga0163162_10005365 | Ga0163162_100053653 | 83 |
| 80 | 3300013307 | Ga0157372_10440671 | Ga0157372_104406712 | 83 |
| 81 | 3300014325 | Ga0163163_10571765 | Ga0163163_105717652 | 83 |
| 82 | 3300014326 | Ga0157380_10618020 | Ga0157380_106180201 | 83 |
| 83 | 3300014326 | Ga0157380_10680205 | Ga0157380_106802053 | 83 |
| 84 | 3300014968 | Ga0157379_10006100 | Ga0157379_1000610015 | 83 |
| 85 | 3300014968 | Ga0157379_12453539 | Ga0157379_124535391 | 83 |
| 86 | 3300025899 | Ga0207642_10000214 | Ga0207642_1000021416 | 83 |
| 87 | 3300025903 | Ga0207680_10010842 | Ga0207680_100108423 | 83 |
| 88 | 3300025907 | Ga0207645_10002435 | Ga0207645_100024356 | 83 |
| 89 | 3300025908 | Ga0207643_10009086 | Ga0207643_100090865 | 83 |
| 90 | 3300025910 | Ga0207684_11386412 | Ga0207684_113864122 | 83 |
| 91 | 3300025911 | Ga0207654_10091794 | Ga0207654_100917942 | 83 |
| 92 | 3300025917 | Ga0207660_10598766 | Ga0207660_105987662 | 83 |
| 93 | 3300025918 | Ga0207662_10593311 | Ga0207662_105933112 | 83 |
| 94 | 3300025919 | Ga0207657_11151757 | Ga0207657_111517572 | 83 |
| 95 | 3300025921 | Ga0207652_11030995 | Ga0207652_110309952 | 83 |
| 96 | 3300025923 | Ga0207681_10090643 | Ga0207681_100906432 | 83 |
| 97 | 3300025925 | Ga0207650_11909567 | Ga0207650_119095671 | 83 |
| 98 | 3300025926 | Ga0207659_10643706 | Ga0207659_106437062 | 83 |
| 99 | 3300025927 | Ga0207687_11773013 | Ga0207687_117730132 | 83 |
| 100 | 3300025933 | Ga0207706_10000116 | Ga0207706_1000011614 | 83 |
| 101 | 3300025934 | Ga0207686_10000245 | Ga0207686_1000024527 | 83 |
| 102 | 3300025935 | Ga0207709_10004711 | Ga0207709_100047115 | 83 |
| 103 | 3300025937 | Ga0207669_10000414 | Ga0207669_100004147 | 83 |
| 104 | 3300025938 | Ga0207704_10002203 | Ga0207704_100022033 | 83 |
| 105 | 3300025940 | Ga0207691_10511071 | Ga0207691_105110712 | 83 |
| 106 | 3300025941 | Ga0207711_10061675 | Ga0207711_100616756 | 83 |
| 107 | 3300025942 | Ga0207689_10001745 | Ga0207689_1000174519 | 83 |
| 108 | 3300025945 | Ga0207679_11039734 | Ga0207679_110397342 | 83 |
| 109 | 3300025949 | Ga0207667_10490310 | Ga0207667_104903102 | 83 |
| 110 | 3300025960 | Ga0207651_10081248 | Ga0207651_100812482 | 83 |
| 111 | 3300025961 | Ga0207712_11146033 | Ga0207712_111460332 | 83 |
| 112 | 3300025972 | Ga0207668_10154011 | Ga0207668_101540112 | 83 |
| 113 | 3300025981 | Ga0207640_10001361 | Ga0207640_100013617 | 83 |
| 114 | 3300025986 | Ga0207658_10164863 | Ga0207658_101648633 | 83 |
| 115 | 3300026023 | Ga0207677_10746714 | Ga0207677_107467142 | 83 |
| 116 | 3300026035 | Ga0207703_10057550 | Ga0207703_100575506 | 83 |
| 117 | 3300026041 | Ga0207639_10364649 | Ga0207639_103646493 | 83 |
| 118 | 3300026067 | Ga0207678_10429514 | Ga0207678_104295142 | 83 |
| 119 | 3300026075 | Ga0207708_10121162 | Ga0207708_101211623 | 83 |
| 120 | 3300026089 | Ga0207648_10000030 | Ga0207648_10000030107 | 83 |
| 121 | 3300026095 | Ga0207676_10010071 | Ga0207676_100100713 | 83 |
| 122 | 3300026116 | Ga0207674_10007183 | Ga0207674_100071838 | 83 |
| 123 | 3300026116 | Ga0207674_10378757 | Ga0207674_103787572 | 83 |
| 124 | 3300026121 | Ga0207683_10038280 | Ga0207683_100382805 | 83 |
| 125 | 3300026142 | Ga0207698_10599357 | Ga0207698_105993572 | 83 |
| 126 | 3300027876 | Ga0209974_10252951 | Ga0209974_102529513 | 83 |
| 127 | 3300028379 | Ga0268266_10136255 | Ga0268266_101362554 | 83 |
| 128 | 3300028380 | Ga0268265_10512375 | Ga0268265_105123751 | 83 |
| 129 | 3300028381 | Ga0268264_10009141 | Ga0268264_100091412 | 83 |
| 130 | 3300031728 | Ga0316578_10257515 | Ga0316578_102575153 | 83 |
| 131 | 3300031733 | Ga0316577_10430668 | Ga0316577_104306682 | 83 |
| 132 | 3300032133 | Ga0316583_10035019 | Ga0316583_100350192 | 83 |
| 133 | 3300032168 | Ga0316593_10277332 | Ga0316593_102773322 | 83 |
| 134 | 3300037588 | Ga0316581_0069120 | Ga0316581_0069120_573_845 | 83 |
| 135 | 3300042015 | Ga0439462_0105760 | Ga0439462_0105760_225_491 | 83 |
| 136 | 3300042876 | Ga0451577_0069497 | Ga0451577_0069497_2295_2564 | 83 |
| 137 | 3300044673 | Ga0453683_0176855 | Ga0453683_0176855_448_717 | 83 |
| 138 | 3300044712 | Ga0453684_0370049 | Ga0453684_0370049_297_566 | 83 |
| 139 | 3300045051 | Ga0451576_0216379 | Ga0451576_0216379_1049_1318 | 83 |
| 140 | 3300045051 | Ga0451576_0244749 | Ga0451576_0244749_657_944 | 83 |
| 141 | 3300046455 | Ga0495603_0009766 | Ga0495603_0009766_4115_4384 | 83 |
| 142 | 3300046499 | Ga0495594_0022729 | Ga0495594_0022729_1533_1802 | 83 |
| 143 | 3300048909 | Ga0496106_0134030 | Ga0496106_0134030_348_617 | 83 |
| 144 | 3300048913 | Ga0496110_1658161 | Ga0496110_1658161_41_307 | 83 |
| 145 | 3300048914 | Ga0496111_0908890 | Ga0496111_0908890_185_451 | 83 |
| 146 | 3300049573 | Ga0501037_0521951 | Ga0501037_0521951_80_349 | 83 |
| 147 | 3300049573 | Ga0501037_1053088 | Ga0501037_1053088_223_492 | 83 |
| 148 | 3300049574 | Ga0501038_0735284 | Ga0501038_0735284_445_714 | 83 |
| 149 | 3300049575 | Ga0501039_0012984 | Ga0501039_0012984_6083_6352 | 83 |
| 150 | 3300049576 | Ga0501040_0082033 | Ga0501040_0082033_55_324 | 83 |
| 151 | 3300049577 | Ga0501041_1151516 | Ga0501041_1151516_210_479 | 83 |
| 152 | 3300049584 | Ga0501068_0425122 | Ga0501068_0425122_413_679 | 83 |
| 153 | 3300049588 | Ga0501072_0004259 | Ga0501072_0004259_5322_5591 | 83 |
| 154 | 3300049592 | Ga0501076_0877952 | Ga0501076_0877952_433_702 | 83 |
| 155 | 3300049593 | Ga0501077_0104367 | Ga0501077_0104367_894_1163 | 83 |
| 156 | 3300049822 | Ga0501035_1359439 | Ga0501035_1359439_111_380 | 83 |
| 157 | 3300049824 | Ga0501045_0864544 | Ga0501045_0864544_49_318 | 83 |
| 158 | 3300050512 | nmdc:mga0n895_719464_c1 | nmdc:mga0n895_719464_c1_132_401 | 83 |
| 159 | 3300050513 | nmdc:mga0rr50_335678_c1 | nmdc:mga0rr50_335678_c1_974_1243 | 83 |
| 160 | 3300050515 | nmdc:mga0a205_133061_c1 | nmdc:mga0a205_133061_c1_308_577 | 83 |
| 161 | 3300050515 | nmdc:mga0a205_763315_c1 | nmdc:mga0a205_763315_c1_227_496 | 83 |
| 162 | 3300061734 | Ga0530510_0281835 | Ga0530510_0281835_338_607 | 83 |
| 163 | 3300005544 | Ga0070686_100000004 | Ga0070686_100000004152 | 84 |
| 164 | 3300005843 | Ga0068860_102047393 | Ga0068860_1020473932 | 84 |
| 165 | 3300005843 | Ga0068860_102735619 | Ga0068860_1027356191 | 84 |
| 166 | 3300005985 | Ga0081539_10000160 | Ga0081539_10000160120 | 84 |
| 167 | 3300006847 | Ga0075431_100006658 | Ga0075431_1000066584 | 84 |
| 168 | 3300025918 | Ga0207662_10094510 | Ga0207662_100945102 | 84 |
| 169 | 3300026118 | Ga0207675_100059407 | Ga0207675_1000594071 | 84 |
| 170 | 3300028381 | Ga0268264_11099948 | Ga0268264_110999482 | 84 |
| 171 | 3300037418 | Ga0395900_1184735 | Ga0395900_1184735_142_414 | 84 |
| 172 | 3300041997 | Ga0439431_0071041 | Ga0439431_0071041_378_644 | 84 |
| 173 | 3300042002 | Ga0439442_066180 | Ga0439442_066180_64_330 | 84 |
| 174 | 3300046471 | Ga0495650_0014402 | Ga0495650_0014402_1216_1482 | 84 |
| 175 | 3300046681 | Ga0495647_0641061 | Ga0495647_0641061_180_449 | 84 |
| 176 | 3300047322 | Ga0495680_0217026 | Ga0495680_0217026_450_719 | 84 |
| 177 | 3300050510 | nmdc:mga06r32_1665_c1 | nmdc:mga06r32_1665_c1_11936_12214 | 84 |
| 178 | 3300005334 | Ga0068869_101519059 | Ga0068869_1015190592 | 85 |
| 179 | 3300005341 | Ga0070691_10024327 | Ga0070691_100243272 | 85 |
| 180 | 3300005347 | Ga0070668_100483928 | Ga0070668_1004839281 | 85 |
| 181 | 3300005354 | Ga0070675_100062592 | Ga0070675_1000625923 | 85 |
| 182 | 3300005437 | Ga0070710_10780580 | Ga0070710_107805801 | 85 |
| 183 | 3300005444 | Ga0070694_100132350 | Ga0070694_1001323502 | 85 |
| 184 | 3300005456 | Ga0070678_100076480 | Ga0070678_1000764803 | 85 |
| 185 | 3300005456 | Ga0070678_100277400 | Ga0070678_1002774002 | 85 |
| 186 | 3300005458 | Ga0070681_10504411 | Ga0070681_105044113 | 85 |
| 187 | 3300005458 | Ga0070681_10848805 | Ga0070681_108488052 | 85 |
| 188 | 3300005459 | Ga0068867_100649319 | Ga0068867_1006493192 | 85 |
| 189 | 3300005459 | Ga0068867_101352012 | Ga0068867_1013520123 | 85 |
| 190 | 3300005545 | Ga0070695_100005345 | Ga0070695_1000053453 | 85 |
| 191 | 3300005548 | Ga0070665_101256379 | Ga0070665_1012563792 | 85 |
| 192 | 3300005548 | Ga0070665_102649807 | Ga0070665_1026498071 | 85 |
| 193 | 3300005564 | Ga0070664_100261657 | Ga0070664_1002616572 | 85 |
| 194 | 3300005577 | Ga0068857_100993377 | Ga0068857_1009933772 | 85 |
| 195 | 3300005616 | Ga0068852_100423905 | Ga0068852_1004239052 | 85 |
| 196 | 3300005618 | Ga0068864_100000642 | Ga0068864_10000064226 | 85 |
| 197 | 3300005618 | Ga0068864_101308803 | Ga0068864_1013088032 | 85 |
| 198 | 3300005719 | Ga0068861_100180865 | Ga0068861_1001808653 | 85 |
| 199 | 3300005719 | Ga0068861_100321293 | Ga0068861_1003212932 | 85 |
| 200 | 3300005840 | Ga0068870_10165057 | Ga0068870_101650573 | 85 |
| 201 | 3300005841 | Ga0068863_101342939 | Ga0068863_1013429392 | 85 |
| 202 | 3300005842 | Ga0068858_100000304 | Ga0068858_10000030412 | 85 |
| 203 | 3300005844 | Ga0068862_100645301 | Ga0068862_1006453012 | 85 |
| 204 | 3300005937 | Ga0081455_10000017 | Ga0081455_10000017111 | 85 |
| 205 | 3300005937 | Ga0081455_10001033 | Ga0081455_1000103321 | 85 |
| 206 | 3300005937 | Ga0081455_10997467 | Ga0081455_109974672 | 85 |
| 207 | 3300005983 | Ga0081540_1000059 | Ga0081540_100005959 | 85 |
| 208 | 3300005983 | Ga0081540_1057782 | Ga0081540_10577822 | 85 |
| 209 | 3300006038 | Ga0075365_10059288 | Ga0075365_100592883 | 85 |
| 210 | 3300006051 | Ga0075364_10249750 | Ga0075364_102497502 | 85 |
| 211 | 3300006177 | Ga0075362_10653528 | Ga0075362_106535281 | 85 |
| 212 | 3300006358 | Ga0068871_101640817 | Ga0068871_1016408172 | 85 |
| 213 | 3300006844 | Ga0075428_100050560 | Ga0075428_1000505603 | 85 |
| 214 | 3300006852 | Ga0075433_10002019 | Ga0075433_100020193 | 85 |
| 215 | 3300006871 | Ga0075434_100032393 | Ga0075434_1000323936 | 85 |
| 216 | 3300006880 | Ga0075429_100099059 | Ga0075429_1000990592 | 85 |
| 217 | 3300006881 | Ga0068865_101037141 | Ga0068865_1010371412 | 85 |
| 218 | 3300006881 | Ga0068865_101405614 | Ga0068865_1014056142 | 85 |
| 219 | 3300007076 | Ga0075435_100133339 | Ga0075435_1001333393 | 85 |
| 220 | 3300007265 | Ga0099794_10104128 | Ga0099794_101041281 | 85 |
| 221 | 3300009094 | Ga0111539_10143371 | Ga0111539_101433713 | 85 |
| 222 | 3300009094 | Ga0111539_10162770 | Ga0111539_101627703 | 85 |
| 223 | 3300009098 | Ga0105245_10156504 | Ga0105245_101565042 | 85 |
| 224 | 3300009098 | Ga0105245_12298117 | Ga0105245_122981172 | 85 |
| 225 | 3300009147 | Ga0114129_12852736 | Ga0114129_128527362 | 85 |
| 226 | 3300009176 | Ga0105242_10781644 | Ga0105242_107816443 | 85 |
| 227 | 3300009177 | Ga0105248_10011310 | Ga0105248_100113103 | 85 |
| 228 | 3300009177 | Ga0105248_10944101 | Ga0105248_109441012 | 85 |
| 229 | 3300009545 | Ga0105237_10026608 | Ga0105237_100266082 | 85 |
| 230 | 3300009553 | Ga0105249_10360087 | Ga0105249_103600872 | 85 |
| 231 | 3300010375 | Ga0105239_10173676 | Ga0105239_101736765 | 85 |
| 232 | 3300010375 | Ga0105239_10678160 | Ga0105239_106781602 | 85 |
| 233 | 3300011119 | Ga0105246_10149888 | Ga0105246_101498883 | 85 |
| 234 | 3300011119 | Ga0105246_12072115 | Ga0105246_120721152 | 85 |
| 235 | 3300012475 | Ga0157317_1016786 | Ga0157317_10167861 | 85 |
| 236 | 3300013104 | Ga0157370_10745202 | Ga0157370_107452021 | 85 |
| 237 | 3300013297 | Ga0157378_10652277 | Ga0157378_106522773 | 85 |
| 238 | 3300013306 | Ga0163162_13468556 | Ga0163162_134685561 | 85 |
| 239 | 3300014325 | Ga0163163_10154430 | Ga0163163_101544305 | 85 |
| 240 | 3300014325 | Ga0163163_10648689 | Ga0163163_106486892 | 85 |
| 241 | 3300014325 | Ga0163163_11483274 | Ga0163163_114832742 | 85 |
| 242 | 3300014326 | Ga0157380_10594732 | Ga0157380_105947322 | 85 |
| 243 | 3300014968 | Ga0157379_10632045 | Ga0157379_106320452 | 85 |
| 244 | 3300014968 | Ga0157379_10911954 | Ga0157379_109119542 | 85 |
| 245 | 3300015684 | Ga0183365_10001 | Ga0183365_10001635 | 85 |
| 246 | 3300017792 | Ga0163161_10291514 | Ga0163161_102915142 | 85 |
| 247 | 3300017792 | Ga0163161_10489070 | Ga0163161_104890702 | 85 |
| 248 | 3300020076 | Ga0206355_1015572 | Ga0206355_10155724 | 85 |
| 249 | 3300020081 | Ga0206354_10138590 | Ga0206354_101385902 | 85 |
| 250 | 3300021361 | Ga0213872_10196973 | Ga0213872_101969732 | 85 |
| 251 | 3300021388 | Ga0213875_10010457 | Ga0213875_100104574 | 85 |
| 252 | 3300025261 | Ga0209233_1050102 | Ga0209233_10501022 | 85 |
| 253 | 3300025315 | Ga0207697_10016637 | Ga0207697_100166372 | 85 |
| 254 | 3300025914 | Ga0207671_10010300 | Ga0207671_100103009 | 85 |
| 255 | 3300025927 | Ga0207687_10662526 | Ga0207687_106625261 | 85 |
| 256 | 3300025934 | Ga0207686_10987231 | Ga0207686_109872312 | 85 |
| 257 | 3300025938 | Ga0207704_10927382 | Ga0207704_109273821 | 85 |
| 258 | 3300025941 | Ga0207711_10099230 | Ga0207711_100992303 | 85 |
| 259 | 3300025941 | Ga0207711_10419461 | Ga0207711_104194612 | 85 |
| 260 | 3300025945 | Ga0207679_10965317 | Ga0207679_109653172 | 85 |
| 261 | 3300025961 | Ga0207712_10196428 | Ga0207712_101964283 | 85 |
| 262 | 3300025972 | Ga0207668_10422729 | Ga0207668_104227292 | 85 |
| 263 | 3300026035 | Ga0207703_10000435 | Ga0207703_100004356 | 85 |
| 264 | 3300026075 | Ga0207708_10245196 | Ga0207708_102451963 | 85 |
| 265 | 3300026089 | Ga0207648_10376312 | Ga0207648_103763123 | 85 |
| 266 | 3300026095 | Ga0207676_10000603 | Ga0207676_100006036 | 85 |
| 267 | 3300026116 | Ga0207674_10038821 | Ga0207674_100388215 | 85 |
| 268 | 3300026118 | Ga0207675_100250019 | Ga0207675_1002500193 | 85 |
| 269 | 3300026118 | Ga0207675_100930676 | Ga0207675_1009306762 | 85 |
| 270 | 3300026118 | Ga0207675_101031404 | Ga0207675_1010314041 | 85 |
| 271 | 3300026121 | Ga0207683_10096754 | Ga0207683_100967543 | 85 |
| 272 | 3300027907 | Ga0207428_10043517 | Ga0207428_100435173 | 85 |
| 273 | 3300028379 | Ga0268266_12186136 | Ga0268266_121861362 | 85 |
| 274 | 3300028380 | Ga0268265_10944934 | Ga0268265_109449341 | 85 |
| 275 | 3300028380 | Ga0268265_11190337 | Ga0268265_111903372 | 85 |
| 276 | 3300028380 | Ga0268265_11359482 | Ga0268265_113594822 | 85 |
| 277 | 3300028786 | Ga0307517_10583140 | Ga0307517_105831402 | 85 |
| 278 | 3300031242 | Ga0265329_10140096 | Ga0265329_101400962 | 85 |
| 279 | 3300031456 | Ga0307513_10033854 | Ga0307513_100338543 | 85 |
| 280 | 3300031507 | Ga0307509_10376128 | Ga0307509_103761282 | 85 |
| 281 | 3300031548 | Ga0307408_101947269 | Ga0307408_1019472691 | 85 |
| 282 | 3300031711 | Ga0265314_10242188 | Ga0265314_102421882 | 85 |
| 283 | 3300031901 | Ga0307406_10093084 | Ga0307406_100930844 | 85 |
| 284 | 3300031911 | Ga0307412_10001766 | Ga0307412_100017668 | 85 |
| 285 | 3300031911 | Ga0307412_10868354 | Ga0307412_108683542 | 85 |
| 286 | 3300032002 | Ga0307416_102387481 | Ga0307416_1023874812 | 85 |
| 287 | 3300033180 | Ga0307510_10003966 | Ga0307510_100039662 | 85 |
| 288 | 3300034820 | Ga0373959_0023917 | Ga0373959_0023917_673_945 | 85 |
| 289 | 3300034957 | Ga0373938_0025607 | Ga0373938_0025607_818_1090 | 85 |
| 290 | 3300035084 | Ga0373928_0023385 | Ga0373928_0023385_465_737 | 85 |
| 291 | 3300035085 | Ga0373929_0130594 | Ga0373929_0130594_125_397 | 85 |
| 292 | 3300035088 | Ga0373940_0074401 | Ga0373940_0074401_96_368 | 85 |
| 293 | 3300035088 | Ga0373940_0118960 | Ga0373940_0118960_17_295 | 85 |
| 294 | 3300035090 | Ga0373949_0004422 | Ga0373949_0004422_1193_1465 | 85 |
| 295 | 3300035091 | Ga0373951_0007601 | Ga0373951_0007601_1552_1824 | 85 |
| 296 | 3300035092 | Ga0373952_0001971 | Ga0373952_0001971_2361_2633 | 85 |
| 297 | 3300035115 | Ga0373941_0002622 | Ga0373941_0002622_3081_3353 | 85 |
| 298 | 3300035115 | Ga0373941_0227313 | Ga0373941_0227313_169_447 | 85 |
| 299 | 3300035121 | Ga0373960_0003749 | Ga0373960_0003749_1936_2208 | 85 |
| 300 | 3300035207 | Ga0373942_0030882 | Ga0373942_0030882_76_348 | 85 |
| 301 | 3300035241 | Ga0373961_0001996 | Ga0373961_0001996_1519_1791 | 85 |
| 302 | 3300035242 | Ga0373962_0003662 | Ga0373962_0003662_1170_1442 | 85 |
| 303 | 3300035691 | Ga0373931_0004929 | Ga0373931_0004929_2267_2539 | 85 |
| 304 | 3300036401 | Ga0373937_1537196 | Ga0373937_1537196_33_299 | 85 |
| 305 | 3300037853 | Ga0436364_1150066 | Ga0436364_1150066_431_700 | 85 |
| 306 | 3300039437 | Ga0436365_0115775 | Ga0436365_0115775_252_521 | 85 |
| 307 | 3300039437 | Ga0436365_0748526 | Ga0436365_0748526_219_488 | 85 |
| 308 | 3300039447 | Ga0436361_0093866 | Ga0436361_0093866_714_983 | 85 |
| 309 | 3300039450 | Ga0436363_0653852 | Ga0436363_0653852_252_521 | 85 |
| 310 | 3300041452 | Ga0451793_1071520 | Ga0451793_1071520_138_416 | 85 |
| 311 | 3300041459 | Ga0451800_1394774 | Ga0451800_1394774_111_377 | 85 |
| 312 | 3300041463 | Ga0451804_0199340 | Ga0451804_0199340_34_300 | 85 |
| 313 | 3300041463 | Ga0451804_0945728 | Ga0451804_0945728_204_470 | 85 |
| 314 | 3300041486 | Ga0451807_2077697 | Ga0451807_2077697_529_795 | 85 |
| 315 | 3300041491 | Ga0451833_0599544 | Ga0451833_0599544_197_463 | 85 |
| 316 | 3300041512 | Ga0451853_0109637 | Ga0451853_0109637_353_619 | 85 |
| 317 | 3300044658 | Ga0466972_0038882 | Ga0466972_0038882_76_351 | 85 |
| 318 | 3300044683 | Ga0466965_0936974 | Ga0466965_0936974_204_479 | 85 |
| 319 | 3300044712 | Ga0453684_0909661 | Ga0453684_0909661_193_462 | 85 |
| 320 | 3300045051 | Ga0451576_0147560 | Ga0451576_0147560_2010_2276 | 85 |
| 321 | 3300045976 | Ga0466967_1016346 | Ga0466967_1016346_465_734 | 85 |
| 322 | 3300046457 | Ga0495590_0006457 | Ga0495590_0006457_117_395 | 85 |
| 323 | 3300046460 | Ga0495638_0122540 | Ga0495638_0122540_433_702 | 85 |
| 324 | 3300046476 | Ga0495662_0354654 | Ga0495662_0354654_115_381 | 85 |
| 325 | 3300046491 | Ga0495584_0346853 | Ga0495584_0346853_286_558 | 85 |
| 326 | 3300046491 | Ga0495584_0480986 | Ga0495584_0480986_41_307 | 85 |
| 327 | 3300046492 | Ga0495585_0437815 | Ga0495585_0437815_230_496 | 85 |
| 328 | 3300046506 | Ga0495583_0128692 | Ga0495583_0128692_357_623 | 85 |
| 329 | 3300046519 | Ga0495632_0073983 | Ga0495632_0073983_796_1068 | 85 |
| 330 | 3300046519 | Ga0495632_0092109 | Ga0495632_0092109_975_1241 | 85 |
| 331 | 3300046522 | Ga0495643_0119942 | Ga0495643_0119942_836_1105 | 85 |
| 332 | 3300046542 | Ga0495597_0230572 | Ga0495597_0230572_440_718 | 85 |
| 333 | 3300046616 | Ga0495668_0016116 | Ga0495668_0016116_1569_1838 | 85 |
| 334 | 3300046660 | Ga0495625_0008402 | Ga0495625_0008402_1896_2165 | 85 |
| 335 | 3300046660 | Ga0495625_0165668 | Ga0495625_0165668_813_1079 | 85 |
| 336 | 3300047318 | Ga0495636_0689485 | Ga0495636_0689485_94_366 | 85 |
| 337 | 3300047319 | Ga0495674_0716861 | Ga0495674_0716861_338_604 | 85 |
| 338 | 3300047445 | Ga0495677_0001751 | Ga0495677_0001751_4845_5114 | 85 |
| 339 | 3300047472 | Ga0495686_0034842 | Ga0495686_0034842_1933_2202 | 85 |
| 340 | 3300048905 | Ga0496102_0543699 | Ga0496102_0543699_188_460 | 85 |
| 341 | 3300048914 | Ga0496111_0575049 | Ga0496111_0575049_67_333 | 85 |
| 342 | 3300048915 | Ga0496112_0425265 | Ga0496112_0425265_779_1048 | 85 |
| 343 | 3300048916 | Ga0496113_0386304 | Ga0496113_0386304_325_594 | 85 |
| 344 | 3300048918 | Ga0496115_1090046 | Ga0496115_1090046_147_419 | 85 |
| 345 | 3300048923 | Ga0496120_0066306 | Ga0496120_0066306_389_658 | 85 |
| 346 | 3300048926 | Ga0496123_0022534 | Ga0496123_0022534_3616_3885 | 85 |
| 347 | 3300048926 | Ga0496123_0532543 | Ga0496123_0532543_141_410 | 85 |
| 348 | 3300048927 | Ga0496124_0000684 | Ga0496124_0000684_38738_39007 | 85 |
| 349 | 3300048927 | Ga0496124_0003283 | Ga0496124_0003283_14195_14464 | 85 |
| 350 | 3300048928 | Ga0496125_0221593 | Ga0496125_0221593_141_410 | 85 |
| 351 | 3300048929 | Ga0496126_0103407 | Ga0496126_0103407_1216_1485 | 85 |
| 352 | 3300049162 | Ga0501307_026944 | Ga0501307_026944_455_733 | 85 |
| 353 | 3300049460 | Ga0495682_0050892 | Ga0495682_0050892_569_835 | 85 |
| 354 | 3300049530 | Ga0501314_032243 | Ga0501314_032243_213_482 | 85 |
| 355 | 3300049568 | Ga0501031_0267974 | Ga0501031_0267974_620_889 | 85 |
| 356 | 3300049569 | Ga0501032_0345317 | Ga0501032_0345317_294_563 | 85 |
| 357 | 3300049569 | Ga0501032_0512389 | Ga0501032_0512389_129_398 | 85 |
| 358 | 3300049571 | Ga0501034_0001769 | Ga0501034_0001769_17674_17943 | 85 |
| 359 | 3300049571 | Ga0501034_0088327 | Ga0501034_0088327_1022_1291 | 85 |
| 360 | 3300049571 | Ga0501034_0091659 | Ga0501034_0091659_1677_1946 | 85 |
| 361 | 3300049571 | Ga0501034_0704512 | Ga0501034_0704512_342_611 | 85 |
| 362 | 3300049573 | Ga0501037_0030278 | Ga0501037_0030278_144_413 | 85 |
| 363 | 3300049573 | Ga0501037_0228170 | Ga0501037_0228170_323_592 | 85 |
| 364 | 3300049575 | Ga0501039_0255481 | Ga0501039_0255481_176_442 | 85 |
| 365 | 3300049576 | Ga0501040_1047283 | Ga0501040_1047283_226_498 | 85 |
| 366 | 3300049579 | Ga0501043_0060465 | Ga0501043_0060465_844_1113 | 85 |
| 367 | 3300049579 | Ga0501043_0559274 | Ga0501043_0559274_502_771 | 85 |
| 368 | 3300049580 | Ga0501046_0470970 | Ga0501046_0470970_273_542 | 85 |
| 369 | 3300049581 | Ga0501047_0074907 | Ga0501047_0074907_2946_3215 | 85 |
| 370 | 3300049581 | Ga0501047_0505683 | Ga0501047_0505683_712_981 | 85 |
| 371 | 3300049587 | Ga0501071_1224329 | Ga0501071_1224329_89_355 | 85 |
| 372 | 3300049588 | Ga0501072_0172002 | Ga0501072_0172002_644_910 | 85 |
| 373 | 3300049592 | Ga0501076_0551202 | Ga0501076_0551202_110_376 | 85 |
| 374 | 3300049741 | Ga0501079_0644469 | Ga0501079_0644469_366_632 | 85 |
| 375 | 3300049744 | Ga0501083_0832889 | Ga0501083_0832889_140_409 | 85 |
| 376 | 3300050492 | nmdc:mga0yw44_185731_c1 | nmdc:mga0yw44_185731_c1_505_777 | 85 |
| 377 | 3300050507 | nmdc:mga05p37_501440_c1 | nmdc:mga05p37_501440_c1_542_814 | 85 |
| 378 | 3300050508 | nmdc:mga09592_697099_c1 | nmdc:mga09592_697099_c1_170_436 | 85 |
| 379 | 3300050511 | nmdc:mga08y16_63600_c1 | nmdc:mga08y16_63600_c1_1825_2097 | 85 |
| 380 | 3300050511 | nmdc:mga08y16_913454_c1 | nmdc:mga08y16_913454_c1_194_460 | 85 |
| 381 | 3300050512 | nmdc:mga0n895_1527513_c1 | nmdc:mga0n895_1527513_c1_173_442 | 85 |
| 382 | 3300050512 | nmdc:mga0n895_3715_c1 | nmdc:mga0n895_3715_c1_1817_2089 | 85 |
| 383 | 3300050515 | nmdc:mga0a205_1678_c1 | nmdc:mga0a205_1678_c1_17320_17592 | 85 |
| 384 | 3300053087 | Ga0500643_000620 | Ga0500643_000620_11274_11543 | 85 |
| 385 | 3300053090 | Ga0500646_0050422 | Ga0500646_0050422_132_404 | 85 |
| 386 | 3300053092 | Ga0500583_0040704 | Ga0500583_0040704_509_781 | 85 |
| 387 | 3300053093 | Ga0500651_0665818 | Ga0500651_0665818_245_517 | 85 |
| 388 | 3300053093 | Ga0500651_0669906 | Ga0500651_0669906_274_546 | 85 |
| 389 | 3300053104 | Ga0500556_0103036 | Ga0500556_0103036_79_351 | 85 |
| 390 | 3300053104 | Ga0500556_0235543 | Ga0500556_0235543_391_663 | 85 |
| 391 | 3300053108 | Ga0500562_046713 | Ga0500562_046713_21_293 | 85 |
| 392 | 3300053131 | Ga0500652_004220 | Ga0500652_004220_3453_3722 | 85 |
| 393 | 3300053136 | Ga0500559_0052896 | Ga0500559_0052896_1405_1674 | 85 |
| 394 | 3300053146 | Ga0500588_0008763 | Ga0500588_0008763_455_727 | 85 |
| 395 | 3300053153 | Ga0500616_0449461 | Ga0500616_0449461_66_338 | 85 |
| 396 | 3300053158 | Ga0500627_0112322 | Ga0500627_0112322_87_359 | 85 |
| 397 | 3300054114 | Ga0501084_0821191 | Ga0501084_0821191_299_565 | 85 |
| 398 | 3300003320 | rootH2_10050513 | rootH2_100505133 | 86 |
| 399 | 3300003578 | Ga0006562J51391_1036509 | Ga0006562J51391_10365094 | 86 |
| 400 | 3300003771 | Ga0055526_1094353 | Ga0055526_10943531 | 86 |
| 401 | 3300003781 | Ga0055536_1055297 | Ga0055536_10552972 | 86 |
| 402 | 3300004800 | Ga0058861_10016048 | Ga0058861_100160482 | 86 |
| 403 | 3300004803 | Ga0058862_10002028 | Ga0058862_100020282 | 86 |
| 404 | 3300005289 | Ga0065704_10811784 | Ga0065704_108117841 | 86 |
| 405 | 3300005331 | Ga0070670_102194004 | Ga0070670_1021940041 | 86 |
| 406 | 3300005339 | Ga0070660_100398500 | Ga0070660_1003985002 | 86 |
| 407 | 3300005365 | Ga0070688_101034711 | Ga0070688_1010347112 | 86 |
| 408 | 3300005406 | Ga0070703_10163233 | Ga0070703_101632332 | 86 |
| 409 | 3300005437 | Ga0070710_11232122 | Ga0070710_112321221 | 86 |
| 410 | 3300005439 | Ga0070711_101071417 | Ga0070711_1010714172 | 86 |
| 411 | 3300005455 | Ga0070663_101663052 | Ga0070663_1016630521 | 86 |
| 412 | 3300005563 | Ga0068855_100656708 | Ga0068855_1006567082 | 86 |
| 413 | 3300005577 | Ga0068857_101099153 | Ga0068857_1010991532 | 86 |
| 414 | 3300005614 | Ga0068856_100599869 | Ga0068856_1005998692 | 86 |
| 415 | 3300005617 | Ga0068859_101168430 | Ga0068859_1011684302 | 86 |
| 416 | 3300005841 | Ga0068863_101180230 | Ga0068863_1011802302 | 86 |
| 417 | 3300005842 | Ga0068858_100677348 | Ga0068858_1006773482 | 86 |
| 418 | 3300006048 | Ga0075363_100707272 | Ga0075363_1007072721 | 86 |
| 419 | 3300006177 | Ga0075362_10094835 | Ga0075362_100948351 | 86 |
| 420 | 3300006178 | Ga0075367_10883227 | Ga0075367_108832271 | 86 |
| 421 | 3300006186 | Ga0075369_10002976 | Ga0075369_100029765 | 86 |
| 422 | 3300006186 | Ga0075369_10315732 | Ga0075369_103157322 | 86 |
| 423 | 3300006195 | Ga0075366_10194639 | Ga0075366_101946392 | 86 |
| 424 | 3300006353 | Ga0075370_10146676 | Ga0075370_101466762 | 86 |
| 425 | 3300006358 | Ga0068871_102198770 | Ga0068871_1021987701 | 86 |
| 426 | 3300006871 | Ga0075434_100279936 | Ga0075434_1002799362 | 86 |
| 427 | 3300006914 | Ga0075436_101462241 | Ga0075436_1014622412 | 86 |
| 428 | 3300006931 | Ga0097620_101168687 | Ga0097620_1011686872 | 86 |
| 429 | 3300007076 | Ga0075435_100097945 | Ga0075435_1000979453 | 86 |
| 430 | 3300007076 | Ga0075435_100483629 | Ga0075435_1004836292 | 86 |
| 431 | 3300009101 | Ga0105247_10739851 | Ga0105247_107398512 | 86 |
| 432 | 3300009148 | Ga0105243_13098231 | Ga0105243_130982312 | 86 |
| 433 | 3300009177 | Ga0105248_11124274 | Ga0105248_111242742 | 86 |
| 434 | 3300009177 | Ga0105248_12622735 | Ga0105248_126227351 | 86 |
| 435 | 3300011119 | Ga0105246_11282353 | Ga0105246_112823531 | 86 |
| 436 | 3300012513 | Ga0157326_1035108 | Ga0157326_10351082 | 86 |
| 437 | 3300013100 | Ga0157373_10284061 | Ga0157373_102840611 | 86 |
| 438 | 3300013102 | Ga0157371_10008337 | Ga0157371_1000833712 | 86 |
| 439 | 3300013102 | Ga0157371_10029003 | Ga0157371_100290036 | 86 |
| 440 | 3300013104 | Ga0157370_10014471 | Ga0157370_100144716 | 86 |
| 441 | 3300013104 | Ga0157370_10616493 | Ga0157370_106164932 | 86 |
| 442 | 3300013105 | Ga0157369_10007496 | Ga0157369_100074966 | 86 |
| 443 | 3300013105 | Ga0157369_10008829 | Ga0157369_100088296 | 86 |
| 444 | 3300013105 | Ga0157369_10385659 | Ga0157369_103856592 | 86 |
| 445 | 3300014968 | Ga0157379_11244899 | Ga0157379_112448992 | 86 |
| 446 | 3300017792 | Ga0163161_10666389 | Ga0163161_106663892 | 86 |
| 447 | 3300020069 | Ga0197907_10667977 | Ga0197907_106679772 | 86 |
| 448 | 3300020070 | Ga0206356_11110789 | Ga0206356_111107892 | 86 |
| 449 | 3300020082 | Ga0206353_11674705 | Ga0206353_116747052 | 86 |
| 450 | 3300022467 | Ga0224712_10308432 | Ga0224712_103084322 | 86 |
| 451 | 3300025292 | Ga0209676_1000038 | Ga0209676_100003822 | 86 |
| 452 | 3300025292 | Ga0209676_1000253 | Ga0209676_100025380 | 86 |
| 453 | 3300025292 | Ga0209676_1030538 | Ga0209676_10305382 | 86 |
| 454 | 3300025295 | Ga0209564_1017530 | Ga0209564_10175304 | 86 |
| 455 | 3300025298 | Ga0209050_1000948 | Ga0209050_10009486 | 86 |
| 456 | 3300025298 | Ga0209050_1011769 | Ga0209050_10117696 | 86 |
| 457 | 3300025299 | Ga0209256_1014947 | Ga0209256_10149474 | 86 |
| 458 | 3300025303 | Ga0209051_1015983 | Ga0209051_10159833 | 86 |
| 459 | 3300025304 | Ga0209257_1000525 | Ga0209257_100052522 | 86 |
| 460 | 3300025304 | Ga0209257_1026430 | Ga0209257_10264302 | 86 |
| 461 | 3300025900 | Ga0207710_10423343 | Ga0207710_104233431 | 86 |
| 462 | 3300025915 | Ga0207693_11353120 | Ga0207693_113531201 | 86 |
| 463 | 3300025917 | Ga0207660_10164153 | Ga0207660_101641533 | 86 |
| 464 | 3300025919 | Ga0207657_10207928 | Ga0207657_102079283 | 86 |
| 465 | 3300025925 | Ga0207650_11632207 | Ga0207650_116322072 | 86 |
| 466 | 3300025942 | Ga0207689_11403177 | Ga0207689_114031771 | 86 |
| 467 | 3300025945 | Ga0207679_10922726 | Ga0207679_109227262 | 86 |
| 468 | 3300025949 | Ga0207667_11874214 | Ga0207667_118742142 | 86 |
| 469 | 3300026023 | Ga0207677_10716465 | Ga0207677_107164652 | 86 |
| 470 | 3300026035 | Ga0207703_10498440 | Ga0207703_104984402 | 86 |
| 471 | 3300026078 | Ga0207702_10628793 | Ga0207702_106287932 | 86 |
| 472 | 3300027907 | Ga0207428_10160117 | Ga0207428_101601173 | 86 |
| 473 | 3300028563 | Ga0265319_1121503 | Ga0265319_11215032 | 86 |
| 474 | 3300029277 | Ga0311001_1032624 | Ga0311001_10326242 | 86 |
| 475 | 3300031239 | Ga0265328_10403329 | Ga0265328_104033291 | 86 |
| 476 | 3300031241 | Ga0265325_10231624 | Ga0265325_102316241 | 86 |
| 477 | 3300031242 | Ga0265329_10219553 | Ga0265329_102195532 | 86 |
| 478 | 3300031247 | Ga0265340_10172388 | Ga0265340_101723882 | 86 |
| 479 | 3300031249 | Ga0265339_10180145 | Ga0265339_101801452 | 86 |
| 480 | 3300031344 | Ga0265316_10164656 | Ga0265316_101646562 | 86 |
| 481 | 3300031711 | Ga0265314_10432197 | Ga0265314_104321971 | 86 |
| 482 | 3300031712 | Ga0265342_10225169 | Ga0265342_102251692 | 86 |
| 483 | 3300031731 | Ga0307405_11030086 | Ga0307405_110300862 | 86 |
| 484 | 3300031901 | Ga0307406_10001233 | Ga0307406_100012332 | 86 |
| 485 | 3300031901 | Ga0307406_11404827 | Ga0307406_114048272 | 86 |
| 486 | 3300031911 | Ga0307412_10009058 | Ga0307412_100090588 | 86 |
| 487 | 3300031995 | Ga0307409_100274362 | Ga0307409_1002743622 | 86 |
| 488 | 3300031995 | Ga0307409_100317421 | Ga0307409_1003174212 | 86 |
| 489 | 3300032002 | Ga0307416_100196478 | Ga0307416_1001964783 | 86 |
| 490 | 3300032126 | Ga0307415_101201950 | Ga0307415_1012019501 | 86 |
| 491 | 3300032168 | Ga0316593_10316704 | Ga0316593_103167042 | 86 |
| 492 | 3300037312 | Ga0395899_0128632 | Ga0395899_0128632_906_1181 | 86 |
| 493 | 3300037312 | Ga0395899_0191311 | Ga0395899_0191311_841_1116 | 86 |
| 494 | 3300037312 | Ga0395899_0508331 | Ga0395899_0508331_484_756 | 86 |
| 495 | 3300037418 | Ga0395900_0096102 | Ga0395900_0096102_1887_2162 | 86 |
| 496 | 3300037466 | Ga0395898_0090798 | Ga0395898_0090798_662_937 | 86 |
| 497 | 3300037466 | Ga0395898_0769144 | Ga0395898_0769144_329_601 | 86 |
| 498 | 3300037471 | Ga0395905_0218958 | Ga0395905_0218958_930_1205 | 86 |
| 499 | 3300038443 | Ga0395901_0275428 | Ga0395901_0275428_982_1257 | 86 |
| 500 | 3300038741 | Ga0400488_39798 | Ga0400488_39798_784_1044 | 86 |
| 501 | 3300039437 | Ga0436365_1784067 | Ga0436365_1784067_503_772 | 86 |
| 502 | 3300039453 | Ga0436362_0219308 | Ga0436362_0219308_32_301 | 86 |
| 503 | 3300041460 | Ga0451802_0195283 | Ga0451802_0195283_100_369 | 86 |
| 504 | 3300041461 | Ga0451805_025979 | Ga0451805_025979_231_521 | 86 |
| 505 | 3300041498 | Ga0451841_0664151 | Ga0451841_0664151_235_504 | 86 |
| 506 | 3300041501 | Ga0451845_0749816 | Ga0451845_0749816_119_388 | 86 |
| 507 | 3300041512 | Ga0451853_0965893 | Ga0451853_0965893_165_455 | 86 |
| 508 | 3300042876 | Ga0451577_0000703 | Ga0451577_0000703_32023_32295 | 86 |
| 509 | 3300042876 | Ga0451577_0111122 | Ga0451577_0111122_1202_1471 | 86 |
| 510 | 3300042876 | Ga0451577_0174551 | Ga0451577_0174551_1415_1684 | 86 |
| 511 | 3300044673 | Ga0453683_0000045 | Ga0453683_0000045_115027_115302 | 86 |
| 512 | 3300044673 | Ga0453683_0002370 | Ga0453683_0002370_7272_7541 | 86 |
| 513 | 3300044673 | Ga0453683_0028862 | Ga0453683_0028862_44_313 | 86 |
| 514 | 3300044673 | Ga0453683_0189701 | Ga0453683_0189701_374_643 | 86 |
| 515 | 3300044694 | Ga0466963_0548445 | Ga0466963_0548445_232_504 | 86 |
| 516 | 3300044712 | Ga0453684_0001990 | Ga0453684_0001990_32133_32405 | 86 |
| 517 | 3300044712 | Ga0453684_0008021 | Ga0453684_0008021_8903_9181 | 86 |
| 518 | 3300044712 | Ga0453684_0026846 | Ga0453684_0026846_4713_4991 | 86 |
| 519 | 3300044712 | Ga0453684_0466332 | Ga0453684_0466332_289_558 | 86 |
| 520 | 3300045051 | Ga0451576_0000352 | Ga0451576_0000352_20015_20287 | 86 |
| 521 | 3300045051 | Ga0451576_0007865 | Ga0451576_0007865_8943_9206 | 86 |
| 522 | 3300045051 | Ga0451576_0025294 | Ga0451576_0025294_781_1050 | 86 |
| 523 | 3300045051 | Ga0451576_0387687 | Ga0451576_0387687_658_933 | 86 |
| 524 | 3300045051 | Ga0451576_0857159 | Ga0451576_0857159_442_720 | 86 |
| 525 | 3300045976 | Ga0466967_0125509 | Ga0466967_0125509_1443_1715 | 86 |
| 526 | 3300045976 | Ga0466967_1258560 | Ga0466967_1258560_336_608 | 86 |
| 527 | 3300046460 | Ga0495638_0051220 | Ga0495638_0051220_1653_1922 | 86 |
| 528 | 3300046506 | Ga0495583_0210609 | Ga0495583_0210609_186_455 | 86 |
| 529 | 3300046507 | Ga0495606_0050694 | Ga0495606_0050694_931_1200 | 86 |
| 530 | 3300046522 | Ga0495643_0115052 | Ga0495643_0115052_730_999 | 86 |
| 531 | 3300046524 | Ga0495648_0066404 | Ga0495648_0066404_1278_1547 | 86 |
| 532 | 3300046542 | Ga0495597_0069789 | Ga0495597_0069789_508_777 | 86 |
| 533 | 3300046543 | Ga0495645_0962710 | Ga0495645_0962710_24_302 | 86 |
| 534 | 3300046616 | Ga0495668_0404200 | Ga0495668_0404200_145_414 | 86 |
| 535 | 3300046660 | Ga0495625_0205165 | Ga0495625_0205165_275_544 | 86 |
| 536 | 3300046660 | Ga0495625_0364127 | Ga0495625_0364127_217_489 | 86 |
| 537 | 3300047318 | Ga0495636_0684132 | Ga0495636_0684132_64_333 | 86 |
| 538 | 3300047472 | Ga0495686_0055301 | Ga0495686_0055301_1745_2014 | 86 |
| 539 | 3300047472 | Ga0495686_0142624 | Ga0495686_0142624_944_1234 | 86 |
| 540 | 3300048090 | Ga0495615_0165720 | Ga0495615_0165720_76_342 | 86 |
| 541 | 3300048907 | Ga0496104_0000560 | Ga0496104_0000560_1977_2252 | 86 |
| 542 | 3300048908 | Ga0496105_0003456 | Ga0496105_0003456_4730_5005 | 86 |
| 543 | 3300048911 | Ga0496108_0005016 | Ga0496108_0005016_518_793 | 86 |
| 544 | 3300048912 | Ga0496109_0008389 | Ga0496109_0008389_3454_3729 | 86 |
| 545 | 3300048913 | Ga0496110_0000436 | Ga0496110_0000436_23044_23319 | 86 |
| 546 | 3300048914 | Ga0496111_0003534 | Ga0496111_0003534_4605_4880 | 86 |
| 547 | 3300048915 | Ga0496112_0050030 | Ga0496112_0050030_625_900 | 86 |
| 548 | 3300048916 | Ga0496113_0000567 | Ga0496113_0000567_14533_14808 | 86 |
| 549 | 3300048918 | Ga0496115_0086651 | Ga0496115_0086651_995_1282 | 86 |
| 550 | 3300048919 | Ga0496116_0117646 | Ga0496116_0117646_707_991 | 86 |
| 551 | 3300048925 | Ga0496122_0012019 | Ga0496122_0012019_22_309 | 86 |
| 552 | 3300048925 | Ga0496122_0476093 | Ga0496122_0476093_186_470 | 86 |
| 553 | 3300048926 | Ga0496123_0002911 | Ga0496123_0002911_1759_2046 | 86 |
| 554 | 3300048927 | Ga0496124_0020387 | Ga0496124_0020387_3555_3824 | 86 |
| 555 | 3300048928 | Ga0496125_0006253 | Ga0496125_0006253_9911_10195 | 86 |
| 556 | 3300048929 | Ga0496126_0690812 | Ga0496126_0690812_99_386 | 86 |
| 557 | 3300049570 | Ga0501033_0043329 | Ga0501033_0043329_1806_2084 | 86 |
| 558 | 3300049571 | Ga0501034_0429692 | Ga0501034_0429692_737_1009 | 86 |
| 559 | 3300049572 | Ga0501036_0990916 | Ga0501036_0990916_374_652 | 86 |
| 560 | 3300049573 | Ga0501037_1008621 | Ga0501037_1008621_161_439 | 86 |
| 561 | 3300049575 | Ga0501039_0619705 | Ga0501039_0619705_173_445 | 86 |
| 562 | 3300049577 | Ga0501041_0782036 | Ga0501041_0782036_62_340 | 86 |
| 563 | 3300049578 | Ga0501042_0317779 | Ga0501042_0317779_505_777 | 86 |
| 564 | 3300049586 | Ga0501070_0130207 | Ga0501070_0130207_1190_1462 | 86 |
| 565 | 3300049587 | Ga0501071_1352999 | Ga0501071_1352999_205_477 | 86 |
| 566 | 3300049589 | Ga0501073_0346651 | Ga0501073_0346651_686_964 | 86 |
| 567 | 3300049590 | Ga0501074_1338533 | Ga0501074_1338533_130_408 | 86 |
| 568 | 3300049592 | Ga0501076_0620438 | Ga0501076_0620438_528_800 | 86 |
| 569 | 3300049592 | Ga0501076_0691077 | Ga0501076_0691077_413_691 | 86 |
| 570 | 3300049593 | Ga0501077_0542275 | Ga0501077_0542275_444_722 | 86 |
| 571 | 3300049743 | Ga0501081_0870598 | Ga0501081_0870598_18_290 | 86 |
| 572 | 3300049744 | Ga0501083_0032340 | Ga0501083_0032340_3240_3518 | 86 |
| 573 | 3300049744 | Ga0501083_0105475 | Ga0501083_0105475_698_976 | 86 |
| 574 | 3300049822 | Ga0501035_0743561 | Ga0501035_0743561_239_517 | 86 |
| 575 | 3300050490 | nmdc:mga03n38_734481_c1 | nmdc:mga03n38_734481_c1_128_400 | 86 |
| 576 | 3300050493 | nmdc:mga0k408_23848_c1 | nmdc:mga0k408_23848_c1_1216_1485 | 86 |
| 577 | 3300050493 | nmdc:mga0k408_272198_c1 | nmdc:mga0k408_272198_c1_585_857 | 86 |
| 578 | 3300050496 | nmdc:mga07m45_25876_c1 | nmdc:mga07m45_25876_c1_1817_2086 | 86 |
| 579 | 3300050512 | nmdc:mga0n895_46456_c1 | nmdc:mga0n895_46456_c1_2398_2670 | 86 |
| 580 | 3300050513 | nmdc:mga0rr50_127096_c1 | nmdc:mga0rr50_127096_c1_1408_1680 | 86 |
| 581 | 3300050514 | nmdc:mga08x19_144753_c1 | nmdc:mga08x19_144753_c1_553_825 | 86 |
| 582 | 3300050515 | nmdc:mga0a205_367632_c1 | nmdc:mga0a205_367632_c1_699_971 | 86 |
| 583 | 3300053086 | Ga0500578_0052858 | Ga0500578_0052858_1591_1860 | 86 |
| 584 | 3300053098 | Ga0500650_0083677 | Ga0500650_0083677_635_904 | 86 |
| 585 | 3300053103 | Ga0500555_040251 | Ga0500555_040251_602_874 | 86 |
| 586 | 3300053122 | Ga0500608_000544 | Ga0500608_000544_11079_11348 | 86 |
| 587 | 3300053130 | Ga0500642_0435744 | Ga0500642_0435744_141_410 | 86 |
| 588 | 3300053136 | Ga0500559_0168967 | Ga0500559_0168967_412_681 | 86 |
| 589 | 3300053156 | Ga0500622_0019061 | Ga0500622_0019061_796_1065 | 86 |
| 590 | 3300054114 | Ga0501084_0058626 | Ga0501084_0058626_2492_2770 | 86 |
| 591 | 3300054114 | Ga0501084_0299868 | Ga0501084_0299868_457_735 | 86 |
| 592 | 3300054114 | Ga0501084_1087406 | Ga0501084_1087406_48_320 | 86 |
| 593 | 3300059623 | Ga0587101_035285 | Ga0587101_035285_115_396 | 86 |
| 594 | 3300059652 | Ga0587107_096593 | Ga0587107_096593_277_558 | 86 |
| 595 | 3300060346 | Ga0587111_0086681 | Ga0587111_0086681_342_623 | 86 |
| 596 | 3300060353 | Ga0501082_0654908 | Ga0501082_0654908_486_758 | 86 |
| 597 | 3300060353 | Ga0501082_1196800 | Ga0501082_1196800_238_516 | 86 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9741 | 20 | 85 |
| 1v8q-assembly1.cif.gz_A | crystal structure of ribosomal protein l27 from thermus thermophilus hb8 | 0.9598 | 20 | 85 |
| 6yws-assembly1.cif.gz_R | the structure of the large subunit of the mitoribosome from neurospora crassa | 0.934 | 19 | 84 |
| 6ywy-assembly1.cif.gz_R | the structure of the mitoribosome from neurospora crassa with bound trna at the p-site | 0.934 | 19 | 84 |
| 8c8z-assembly1.cif.gz_W | cryo-em captures early ribosome assembly in action | 0.9336 | 17 | 84 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9741 | 20 | 85 | 2.40.50.100 |
| 1v8qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9598 | 20 | 85 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9157 | 29 | 82 | 2.40.50.100 |
| af_C0Z3L6_20_123_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8911 | 21 | 86 | 2.40.50.100 |
| af_Q8IBQ2_8_59_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.8832 | 29 | 82 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A525J835-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9981 | 21 | 86 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A328ESH9-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9878 | 21 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A660TPI7-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9826 | 20 | 84 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-A0A382C6Q8-F1-model_v4 | Ribosomal protein L27 | 0.9825 | 21 | 83 |
GO:0003735
GO:0006412 GO:0022625 |
| AF-K2DRZ8-F1-model_v4 | Large ribosomal subunit protein bL27 (50S ribosomal protein L27) | 0.9803 | 21 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar