F467642

General Info

Members Datasets Scaffolds Average Seq Length
597 367 590 90

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100599869|Ga0068856_1005998692
Length 88
Sequence MAHKKGVGSSRNGRESHSKRLGIKIYGGQVAQAGNILVRQRGTQHHPGLNVGIGKDHTLFALTAGTVVFKKGRKDRSFVVIEPVAEAK

Samples

Sample ID Description Type Environment
1 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
2 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
3 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
4 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
5 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
6 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
7 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
101 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
102 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
103 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
110 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
191 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
192 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
193 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
194 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
195 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
196 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
197 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
211 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
213 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
214 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
215 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
216 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
221 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
222 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
231 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
232 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
233 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
234 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
235 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
236 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
237 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
238 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
239 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
240 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
241 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
242 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
243 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
244 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
247 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
248 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
249 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
250 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
251 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
252 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
255 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
256 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
257 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
258 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
259 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
260 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
261 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
262 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
280 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
284 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
297 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
301 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
302 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
303 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
323 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
346 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
347 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
351 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
352 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
353 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
354 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
355 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
356 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
357 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
358 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
359 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
362 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
363 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
367 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.81
Metatranscriptomes 3.02
Isolates 1.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.04
Nodule 0
Rhizoplane 4.02
Rhizosphere 81.57
Stem 0
Stem Tuber 0
Unclassified 6.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10050513 3300003320 Bacteria 5592
2 Ga0006562J51391_1036509 3300003578 Bacteria 5206
3 Ga0055526_1094353 3300003771 Bacteria 559
4 Ga0055536_1055297 3300003781 Bacteria 849
5 Ga0058861_10016048 3300004800 Bacteria 693
6 Ga0058862_10002028 3300004803 Bacteria 705
7 Ga0065704_10811784 3300005289 Bacteria 521
8 Ga0070676_10010155 3300005328 Bacteria 5103
9 Ga0070670_102194004 3300005331 Bacteria 509
10 Ga0070677_10060459 3300005333 Bacteria 1561
11 Ga0068869_100000612 3300005334 Bacteria 20160
12 Ga0068869_101519059 3300005334 Bacteria 595
13 Ga0070666_10037880 3300005335 Bacteria 3208
14 Ga0070680_100478876 3300005336 Bacteria 1064
15 Ga0070682_100548470 3300005337 Bacteria 904
16 Ga0068868_100288429 3300005338 Bacteria 1391
17 Ga0068868_101710471 3300005338 Bacteria 593
18 Ga0070660_100398500 3300005339 Bacteria 1138
19 Ga0070660_101320627 3300005339 Bacteria 612
20 Ga0070691_10024327 3300005341 Bacteria 2815
21 Ga0070691_10130539 3300005341 Bacteria 1273
22 Ga0070687_100588787 3300005343 Bacteria 762
23 Ga0070668_100483928 3300005347 Bacteria 1069
24 Ga0070675_100062592 3300005354 Bacteria 3074
25 Ga0070671_100434528 3300005355 Bacteria 1125
26 Ga0070674_100000248 3300005356 Bacteria 26777
27 Ga0070673_100268708 3300005364 Bacteria 1492
28 Ga0070688_101034711 3300005365 Bacteria 654
29 Ga0070659_100481843 3300005366 Bacteria 1056
30 Ga0070667_100192087 3300005367 Bacteria 1809
31 Ga0070703_10163233 3300005406 Bacteria 847
32 Ga0070710_10780580 3300005437 Bacteria 681
33 Ga0070710_11232122 3300005437 Bacteria 554
34 Ga0070701_10017696 3300005438 Bacteria 3336
35 Ga0070711_101071417 3300005439 Bacteria 694
36 Ga0070705_100000334 3300005440 Bacteria 27607
37 Ga0070700_100149174 3300005441 Bacteria 1597
38 Ga0070694_100015829 3300005444 Bacteria 4745
39 Ga0070694_100098319 3300005444 Bacteria 2066
40 Ga0070694_100132350 3300005444 Bacteria 1803
41 Ga0070663_100658599 3300005455 Bacteria 886
42 Ga0070663_101663052 3300005455 Bacteria 570
43 Ga0070678_100006191 3300005456 Bacteria 6996
44 Ga0070678_100076480 3300005456 Bacteria 2522
45 Ga0070678_100277400 3300005456 Bacteria 1416
46 Ga0070662_100000325 3300005457 Bacteria 28539
47 Ga0070681_10504411 3300005458 Bacteria 1123
48 Ga0070681_10848805 3300005458 Bacteria 831
49 Ga0068867_100000848 3300005459 Bacteria 20597
50 Ga0068867_100649319 3300005459 Bacteria 926
51 Ga0068867_101352012 3300005459 Bacteria 659
52 Ga0070706_100648510 3300005467 Bacteria 980
53 Ga0070707_100856188 3300005468 Bacteria 873
54 Ga0070699_100104942 3300005518 Bacteria 2479
55 Ga0070679_101479357 3300005530 Bacteria 626
56 Ga0070697_100925519 3300005536 Bacteria 774
57 Ga0070686_100000004 3300005544 Bacteria 262514
58 Ga0070686_100122334 3300005544 Bacteria 1788
59 Ga0070695_100005345 3300005545 Bacteria 7563
60 Ga0070695_100007426 3300005545 Bacteria 6501
61 Ga0070696_100007602 3300005546 Bacteria 7242
62 Ga0070693_100042809 3300005547 Bacteria 2554
63 Ga0070665_100096248 3300005548 Bacteria 2965
64 Ga0070665_101256379 3300005548 Bacteria 751
65 Ga0070665_102649807 3300005548 Bacteria 502
66 Ga0070704_100266363 3300005549 Bacteria 1414
67 Ga0068855_100056196 3300005563 Bacteria 4619
68 Ga0068855_100656708 3300005563 Bacteria 1126
69 Ga0070664_100261657 3300005564 Bacteria 1557
70 Ga0070664_100934650 3300005564 Bacteria 814
71 Ga0068857_100108963 3300005577 Bacteria 2488
72 Ga0068857_100338520 3300005577 Bacteria 1392
73 Ga0068857_100993377 3300005577 Bacteria 808
74 Ga0068857_101099153 3300005577 Bacteria 768
75 Ga0068854_100000421 3300005578 Bacteria 26467
76 Ga0068856_100110715 3300005614 Bacteria 2743
77 Ga0068856_100599869 3300005614 Bacteria 1122
78 Ga0070702_100013531 3300005615 Bacteria 4120
79 Ga0068852_100423905 3300005616 Bacteria 1313
80 Ga0068859_101168430 3300005617 Bacteria 847
81 Ga0068864_100000642 3300005618 Bacteria 29378
82 Ga0068864_100003563 3300005618 Bacteria 12869
83 Ga0068864_101308803 3300005618 Bacteria 725
84 Ga0068866_10000212 3300005718 Bacteria 27530
85 Ga0068861_100020884 3300005719 Bacteria 4698
86 Ga0068861_100180865 3300005719 Bacteria 1755
87 Ga0068861_100321293 3300005719 Bacteria 1348
88 Ga0068870_10011634 3300005840 Bacteria 4088
89 Ga0068870_10165057 3300005840 Bacteria 1317
90 Ga0068863_101180230 3300005841 Bacteria 771
91 Ga0068863_101342939 3300005841 Bacteria 722
92 Ga0068858_100000304 3300005842 Bacteria 52470
93 Ga0068858_100089233 3300005842 Bacteria 2869
94 Ga0068858_100229150 3300005842 Bacteria 1761
95 Ga0068858_100677348 3300005842 Bacteria 1003
96 Ga0068860_100011032 3300005843 Bacteria 8909
97 Ga0068860_102047393 3300005843 Bacteria 594
98 Ga0068860_102735619 3300005843 Bacteria 512
99 Ga0068862_100189379 3300005844 Bacteria 1850
100 Ga0068862_100645301 3300005844 Bacteria 1021
101 Ga0081455_10000017 3300005937 Bacteria 174550
102 Ga0081455_10001033 3300005937 Bacteria 35145
103 Ga0081455_10997467 3300005937 Bacteria 518
104 Ga0081540_1000059 3300005983 Bacteria 120226
105 Ga0081540_1057782 3300005983 Bacteria 1874
106 Ga0081539_10000160 3300005985 Bacteria 157504
107 Ga0075365_10059288 3300006038 Bacteria 2550
108 Ga0075363_100707272 3300006048 Bacteria 609
109 Ga0075364_10249750 3300006051 Bacteria 1206
110 Ga0075362_10094835 3300006177 Bacteria 1389
111 Ga0075362_10653528 3300006177 Bacteria 546
112 Ga0075367_10883227 3300006178 Bacteria 570
113 Ga0075369_10002976 3300006186 Bacteria 6124
114 Ga0075369_10315732 3300006186 Bacteria 731
115 Ga0075366_10194639 3300006195 Bacteria 1232
116 Ga0097621_100083802 3300006237 Bacteria 2657
117 Ga0075370_10146676 3300006353 Bacteria 1381
118 Ga0068871_100136671 3300006358 Bacteria 2082
119 Ga0068871_101640817 3300006358 Bacteria 609
120 Ga0068871_102198770 3300006358 Bacteria 526
121 Ga0075428_100050560 3300006844 Bacteria 4558
122 Ga0075431_100006658 3300006847 Bacteria 11476
123 Ga0075433_10002019 3300006852 Bacteria 15301
124 Ga0075433_10080276 3300006852 Bacteria 2875
125 Ga0075433_10484571 3300006852 Bacteria 1089
126 Ga0075434_100032393 3300006871 Bacteria 5154
127 Ga0075434_100279936 3300006871 Bacteria 1687
128 Ga0075434_100954721 3300006871 Bacteria 872
129 Ga0075429_100099059 3300006880 Bacteria 2543
130 Ga0068865_100000819 3300006881 Bacteria 17531
131 Ga0068865_101037141 3300006881 Bacteria 720
132 Ga0068865_101405614 3300006881 Bacteria 623
133 Ga0075436_101462241 3300006914 Unclassified 519
134 Ga0097620_101168687 3300006931 Bacteria 847
135 Ga0075435_100097945 3300007076 Bacteria 2427
136 Ga0075435_100133339 3300007076 Bacteria 2079
137 Ga0075435_100483629 3300007076 Bacteria 1069
138 Ga0075435_101863231 3300007076 Bacteria 528
139 Ga0099794_10104128 3300007265 Bacteria 1418
140 Ga0111539_10143371 3300009094 Bacteria 2796
141 Ga0111539_10162770 3300009094 Bacteria 2609
142 Ga0105245_10017257 3300009098 Bacteria 6299
143 Ga0105245_10156504 3300009098 Bacteria 2158
144 Ga0105245_12298117 3300009098 Bacteria 593
145 Ga0105247_10739851 3300009101 Bacteria 744
146 Ga0114129_12852736 3300009147 Bacteria 573
147 Ga0105243_10000488 3300009148 Bacteria 40416
148 Ga0105243_13098231 3300009148 Bacteria 503
149 Ga0105241_10002467 3300009174 Bacteria 13902
150 Ga0105242_10000445 3300009176 Bacteria 32941
151 Ga0105242_10781644 3300009176 Bacteria 943
152 Ga0105248_10006674 3300009177 Bacteria 12666
153 Ga0105248_10011310 3300009177 Bacteria 9840
154 Ga0105248_10110329 3300009177 Bacteria 3102
155 Ga0105248_10944101 3300009177 Bacteria 974
156 Ga0105248_11124274 3300009177 Bacteria 888
157 Ga0105248_12622735 3300009177 Bacteria 575
158 Ga0105237_10026608 3300009545 Bacteria 5913
159 Ga0105238_10514738 3300009551 Bacteria 1199
160 Ga0105249_10004027 3300009553 Bacteria 12680
161 Ga0105249_10360087 3300009553 Bacteria 1476
162 Ga0105249_11034012 3300009553 Bacteria 891
163 Ga0105239_10004845 3300010375 Bacteria 15921
164 Ga0105239_10173676 3300010375 Bacteria 2410
165 Ga0105239_10678160 3300010375 Bacteria 1178
166 Ga0105246_10020057 3300011119 Bacteria 4285
167 Ga0105246_10149888 3300011119 Bacteria 1764
168 Ga0105246_11282353 3300011119 Bacteria 678
169 Ga0105246_11446935 3300011119 Bacteria 643
170 Ga0105246_12072115 3300011119 Bacteria 551
171 Ga0157317_1016786 3300012475 Bacteria 620
172 Ga0157326_1035108 3300012513 Bacteria 681
173 Ga0157373_10284061 3300013100 Bacteria 1173
174 Ga0157371_10008337 3300013102 Bacteria 8271
175 Ga0157371_10029003 3300013102 Bacteria 4006
176 Ga0157371_10062787 3300013102 Bacteria 2633
177 Ga0157370_10014471 3300013104 Bacteria 8065
178 Ga0157370_10616493 3300013104 Bacteria 993
179 Ga0157370_10745202 3300013104 Bacteria 893
180 Ga0157369_10007496 3300013105 Bacteria 12555
181 Ga0157369_10008829 3300013105 Bacteria 11547
182 Ga0157369_10385659 3300013105 Bacteria 1454
183 Ga0157378_10652277 3300013297 Bacteria 1068
184 Ga0163162_10005365 3300013306 Bacteria 12375
185 Ga0163162_13468556 3300013306 Bacteria 502
186 Ga0157372_10440671 3300013307 Bacteria 1518
187 Ga0163163_10154430 3300014325 Bacteria 2339
188 Ga0163163_10571765 3300014325 Bacteria 1193
189 Ga0163163_10648689 3300014325 Bacteria 1119
190 Ga0163163_11483274 3300014325 Bacteria 740
191 Ga0157380_10594732 3300014326 Bacteria 1093
192 Ga0157380_10618020 3300014326 Bacteria 1075
193 Ga0157380_10680205 3300014326 Bacteria 1031
194 Ga0157379_10006100 3300014968 Bacteria 10379
195 Ga0157379_10632045 3300014968 Bacteria 1001
196 Ga0157379_10911954 3300014968 Bacteria 834
197 Ga0157379_11244899 3300014968 Bacteria 717
198 Ga0157379_12453539 3300014968 Bacteria 521
199 Ga0183365_10001 3300015684 Bacteria 2090444
200 Ga0163161_10291514 3300017792 Bacteria 1283
201 Ga0163161_10489070 3300017792 Bacteria 1000
202 Ga0163161_10666389 3300017792 Bacteria 863
203 Ga0197907_10667977 3300020069 Bacteria 890
204 Ga0206356_11110789 3300020070 Bacteria 1432
205 Ga0206355_1015572 3300020076 Bacteria 2043
206 Ga0206354_10138590 3300020081 Bacteria 963
207 Ga0206353_11674705 3300020082 Bacteria 1109
208 Ga0213872_10196973 3300021361 Bacteria 865
209 Ga0213875_10010457 3300021388 Bacteria 4642
210 Ga0224712_10308432 3300022467 Bacteria 741
211 Ga0209233_1050102 3300025261 Bacteria 854
212 Ga0209676_1000038 3300025292 Bacteria 449305
213 Ga0209676_1000253 3300025292 Bacteria 113412
214 Ga0209676_1030538 3300025292 Bacteria 1646
215 Ga0209564_1017530 3300025295 Bacteria 2785
216 Ga0209050_1000948 3300025298 Bacteria 37706
217 Ga0209050_1011769 3300025298 Bacteria 4103
218 Ga0209256_1014947 3300025299 Bacteria 2748
219 Ga0209051_1015983 3300025303 Bacteria 3425
220 Ga0209257_1000525 3300025304 Bacteria 66561
221 Ga0209257_1026430 3300025304 Bacteria 1957
222 Ga0207697_10016637 3300025315 Bacteria 3029
223 Ga0207642_10000214 3300025899 Bacteria 17101
224 Ga0207710_10423343 3300025900 Bacteria 685
225 Ga0207680_10010842 3300025903 Bacteria 4578
226 Ga0207645_10002435 3300025907 Bacteria 14639
227 Ga0207643_10009086 3300025908 Bacteria 5337
228 Ga0207684_11386412 3300025910 Bacteria 576
229 Ga0207654_10091794 3300025911 Bacteria 1853
230 Ga0207671_10010300 3300025914 Bacteria 7727
231 Ga0207693_11353120 3300025915 Bacteria 530
232 Ga0207660_10164153 3300025917 Bacteria 1716
233 Ga0207660_10598766 3300025917 Bacteria 898
234 Ga0207662_10094510 3300025918 Bacteria 1844
235 Ga0207662_10593311 3300025918 Bacteria 770
236 Ga0207657_10207928 3300025919 Bacteria 1572
237 Ga0207657_11151757 3300025919 Bacteria 591
238 Ga0207652_11030995 3300025921 Bacteria 722
239 Ga0207681_10090643 3300025923 Bacteria 2182
240 Ga0207650_11632207 3300025925 Bacteria 547
241 Ga0207650_11909567 3300025925 Bacteria 501
242 Ga0207659_10643706 3300025926 Bacteria 906
243 Ga0207687_10662526 3300025927 Bacteria 884
244 Ga0207687_11773013 3300025927 Bacteria 529
245 Ga0207706_10000116 3300025933 Bacteria 85356
246 Ga0207686_10000245 3300025934 Bacteria 41614
247 Ga0207686_10987231 3300025934 Bacteria 683
248 Ga0207709_10004711 3300025935 Bacteria 7843
249 Ga0207669_10000414 3300025937 Bacteria 18670
250 Ga0207704_10002203 3300025938 Bacteria 8737
251 Ga0207704_10927382 3300025938 Bacteria 733
252 Ga0207691_10511071 3300025940 Bacteria 1020
253 Ga0207711_10061675 3300025941 Bacteria 3233
254 Ga0207711_10099230 3300025941 Bacteria 2574
255 Ga0207711_10419461 3300025941 Bacteria 1245
256 Ga0207689_10001745 3300025942 Bacteria 20517
257 Ga0207689_11403177 3300025942 Bacteria 585
258 Ga0207679_10922726 3300025945 Bacteria 799
259 Ga0207679_10965317 3300025945 Bacteria 781
260 Ga0207679_11039734 3300025945 Bacteria 751
261 Ga0207667_10490310 3300025949 Bacteria 1247
262 Ga0207667_11874214 3300025949 Bacteria 562
263 Ga0207651_10081248 3300025960 Bacteria 2336
264 Ga0207712_10196428 3300025961 Bacteria 1596
265 Ga0207712_11146033 3300025961 Bacteria 693
266 Ga0207668_10154011 3300025972 Bacteria 1783
267 Ga0207668_10422729 3300025972 Bacteria 1131
268 Ga0207640_10001361 3300025981 Bacteria 13219
269 Ga0207658_10164863 3300025986 Bacteria 1819
270 Ga0207677_10716465 3300026023 Bacteria 889
271 Ga0207677_10746714 3300026023 Bacteria 872
272 Ga0207703_10000435 3300026035 Bacteria 43900
273 Ga0207703_10057550 3300026035 Bacteria 3171
274 Ga0207703_10498440 3300026035 Bacteria 1143
275 Ga0207639_10364649 3300026041 Bacteria 1294
276 Ga0207678_10429514 3300026067 Bacteria 1146
277 Ga0207708_10121162 3300026075 Bacteria 2038
278 Ga0207708_10245196 3300026075 Bacteria 1442
279 Ga0207702_10628793 3300026078 Bacteria 1055
280 Ga0207648_10000030 3300026089 Bacteria 129654
281 Ga0207648_10376312 3300026089 Bacteria 1283
282 Ga0207676_10000603 3300026095 Bacteria 29490
283 Ga0207676_10010071 3300026095 Bacteria 6727
284 Ga0207674_10007183 3300026116 Bacteria 13001
285 Ga0207674_10038821 3300026116 Bacteria 4940
286 Ga0207674_10378757 3300026116 Bacteria 1368
287 Ga0207675_100059407 3300026118 Bacteria 3568
288 Ga0207675_100250019 3300026118 Bacteria 1716
289 Ga0207675_100930676 3300026118 Bacteria 886
290 Ga0207675_101031404 3300026118 Bacteria 841
291 Ga0207683_10038280 3300026121 Bacteria 4179
292 Ga0207683_10096754 3300026121 Bacteria 2632
293 Ga0207698_10599357 3300026142 Bacteria 1086
294 Ga0209974_10252951 3300027876 Bacteria 663
295 Ga0207428_10043517 3300027907 Bacteria 3626
296 Ga0207428_10160117 3300027907 Bacteria 1709
297 Ga0268266_10136255 3300028379 Bacteria 2199
298 Ga0268266_12186136 3300028379 Bacteria 525
299 Ga0268265_10512375 3300028380 Bacteria 1132
300 Ga0268265_10944934 3300028380 Bacteria 849
301 Ga0268265_11190337 3300028380 Bacteria 759
302 Ga0268265_11359482 3300028380 Bacteria 711
303 Ga0268264_10009141 3300028381 Bacteria 8215
304 Ga0268264_11099948 3300028381 Bacteria 803
305 Ga0265319_1121503 3300028563 Bacteria 814
306 Ga0307517_10583140 3300028786 Bacteria 553
307 Ga0311001_1032624 3300029277 Bacteria 738
308 Ga0265328_10403329 3300031239 Bacteria 537
309 Ga0265325_10231624 3300031241 Bacteria 842
310 Ga0265329_10140096 3300031242 Bacteria 781
311 Ga0265329_10219553 3300031242 Bacteria 629
312 Ga0265340_10172388 3300031247 Bacteria 980
313 Ga0265339_10180145 3300031249 Bacteria 1053
314 Ga0265316_10164656 3300031344 Bacteria 1657
315 Ga0307513_10033854 3300031456 Bacteria 5739
316 Ga0307509_10376128 3300031507 Bacteria 1135
317 Ga0307408_101947269 3300031548 Bacteria 564
318 Ga0265314_10242188 3300031711 Bacteria 1040
319 Ga0265314_10432197 3300031711 Bacteria 705
320 Ga0265342_10225169 3300031712 Bacteria 1009
321 Ga0316578_10257515 3300031728 Bacteria 1046
322 Ga0307405_11030086 3300031731 Bacteria 704
323 Ga0316577_10430668 3300031733 Bacteria 749
324 Ga0307406_10001233 3300031901 Bacteria 14337
325 Ga0307406_10093084 3300031901 Bacteria 2034
326 Ga0307406_11404827 3300031901 Bacteria 612
327 Ga0307412_10001766 3300031911 Bacteria 11941
328 Ga0307412_10009058 3300031911 Bacteria 5704
329 Ga0307412_10868354 3300031911 Bacteria 788
330 Ga0307409_100274362 3300031995 Bacteria 1555
331 Ga0307409_100317421 3300031995 Bacteria 1457
332 Ga0307416_100196478 3300032002 Bacteria 1909
333 Ga0307416_102387481 3300032002 Bacteria 628
334 Ga0307415_101201950 3300032126 Bacteria 714
335 Ga0316583_10035019 3300032133 Bacteria 1782
336 Ga0316593_10277332 3300032168 Bacteria 631
337 Ga0316593_10316704 3300032168 Bacteria 593
338 Ga0307510_10003966 3300033180 Bacteria 17345
339 Ga0373959_0023917 3300034820 Bacteria 1191
340 Ga0373938_0025607 3300034957 Bacteria 1229
341 Ga0373928_0023385 3300035084 Bacteria 1318
342 Ga0373929_0130594 3300035085 Bacteria 658
343 Ga0373940_0074401 3300035088 Bacteria 994
344 Ga0373940_0118960 3300035088 Bacteria 818
345 Ga0373949_0004422 3300035090 Bacteria 3227
346 Ga0373951_0007601 3300035091 Bacteria 2461
347 Ga0373952_0001971 3300035092 Bacteria 3709
348 Ga0373941_0002622 3300035115 Bacteria 3987
349 Ga0373941_0227313 3300035115 Bacteria 720
350 Ga0373960_0003749 3300035121 Bacteria 3454
351 Ga0373942_0030882 3300035207 Bacteria 1413
352 Ga0373961_0001996 3300035241 Bacteria 5485
353 Ga0373962_0003662 3300035242 Bacteria 3696
354 Ga0373931_0004929 3300035691 Bacteria 6137
355 Ga0373937_1537196 3300036401 Bacteria 613
356 Ga0395899_0128632 3300037312 Bacteria 1810
357 Ga0395899_0191311 3300037312 Bacteria 1432
358 Ga0395899_0508331 3300037312 Bacteria 781
359 Ga0395900_0096102 3300037418 Bacteria 3044
360 Ga0395900_1184735 3300037418 Bacteria 680
361 Ga0395898_0090798 3300037466 Bacteria 2939
362 Ga0395898_0769144 3300037466 Bacteria 904
363 Ga0395905_0218958 3300037471 Bacteria 1782
364 Ga0316581_0069120 3300037588 Bacteria 1084
365 Ga0436364_1150066 3300037853 Bacteria 29298
366 Ga0395901_0275428 3300038443 Bacteria 1749
367 Ga0400488_39798 3300038741 Bacteria 1352
368 Ga0436365_0115775 3300039437 Bacteria 716
369 Ga0436365_0748526 3300039437 Bacteria 1237
370 Ga0436365_1784067 3300039437 Bacteria 1669
371 Ga0436361_0093866 3300039447 Bacteria 1698
372 Ga0436363_0653852 3300039450 Bacteria 1136
373 Ga0436362_0219308 3300039453 Bacteria 546
374 Ga0451793_1071520 3300041452 Bacteria 565
375 Ga0451800_1394774 3300041459 Bacteria 986
376 Ga0451802_0195283 3300041460 Bacteria 630
377 Ga0451805_025979 3300041461 Bacteria 580
378 Ga0451804_0199340 3300041463 Bacteria 795
379 Ga0451804_0945728 3300041463 Bacteria 546
380 Ga0451807_2077697 3300041486 Bacteria 1293
381 Ga0451833_0599544 3300041491 Bacteria 576
382 Ga0451841_0664151 3300041498 Bacteria 748
383 Ga0451845_0749816 3300041501 Bacteria 570
384 Ga0451853_0109637 3300041512 Bacteria 1262
385 Ga0451853_0965893 3300041512 Bacteria 598
386 Ga0439431_0071041 3300041997 Bacteria 928
387 Ga0439442_066180 3300042002 Bacteria 768
388 Ga0439462_0105760 3300042015 Bacteria 778
389 Ga0451577_0000703 3300042876 Bacteria 52315
390 Ga0451577_0069497 3300042876 Bacteria 3141
391 Ga0451577_0111122 3300042876 Bacteria 2452
392 Ga0451577_0174551 3300042876 Bacteria 1937
393 Ga0466972_0038882 3300044658 Bacteria 2324
394 Ga0453683_0000045 3300044673 Bacteria 211088
395 Ga0453683_0002370 3300044673 Bacteria 14734
396 Ga0453683_0028862 3300044673 Bacteria 3511
397 Ga0453683_0176855 3300044673 Bacteria 1353
398 Ga0453683_0189701 3300044673 Bacteria 1304
399 Ga0466965_0936974 3300044683 Bacteria 506
400 Ga0466963_0548445 3300044694 Bacteria 816
401 Ga0453684_0001990 3300044712 Bacteria 52425
402 Ga0453684_0008021 3300044712 Bacteria 19108
403 Ga0453684_0026846 3300044712 Bacteria 8296
404 Ga0453684_0370049 3300044712 Bacteria 1611
405 Ga0453684_0466332 3300044712 Bacteria 1403
406 Ga0453684_0909661 3300044712 Bacteria 942
407 Ga0451576_0000352 3300045051 Bacteria 110468
408 Ga0451576_0007865 3300045051 Bacteria 12634
409 Ga0451576_0025294 3300045051 Bacteria 6397
410 Ga0451576_0147560 3300045051 Bacteria 2453
411 Ga0451576_0216379 3300045051 Bacteria 2000
412 Ga0451576_0244749 3300045051 Unclassified 1874
413 Ga0451576_0387687 3300045051 Bacteria 1464
414 Ga0451576_0857159 3300045051 Bacteria 953
415 Ga0466967_0125509 3300045976 Bacteria 2377
416 Ga0466967_1016346 3300045976 Bacteria 826
417 Ga0466967_1258560 3300045976 Bacteria 737
418 Ga0495603_0009766 3300046455 Bacteria 5808
419 Ga0495590_0006457 3300046457 Bacteria 4576
420 Ga0495638_0051220 3300046460 Bacteria 2575
421 Ga0495638_0122540 3300046460 Bacteria 1535
422 Ga0495650_0014402 3300046471 Bacteria 4118
423 Ga0495662_0354654 3300046476 Unclassified 721
424 Ga0495584_0346853 3300046491 Bacteria 754
425 Ga0495584_0480986 3300046491 Bacteria 632
426 Ga0495585_0437815 3300046492 Bacteria 626
427 Ga0495594_0022729 3300046499 Bacteria 3355
428 Ga0495583_0128692 3300046506 Bacteria 1061
429 Ga0495583_0210609 3300046506 Bacteria 788
430 Ga0495606_0050694 3300046507 Bacteria 2713
431 Ga0495632_0073983 3300046519 Bacteria 1633
432 Ga0495632_0092109 3300046519 Bacteria 1436
433 Ga0495643_0115052 3300046522 Bacteria 1364
434 Ga0495643_0119942 3300046522 Bacteria 1330
435 Ga0495648_0066404 3300046524 Bacteria 2115
436 Ga0495597_0069789 3300046542 Bacteria 1516
437 Ga0495597_0230572 3300046542 Bacteria 733
438 Ga0495645_0962710 3300046543 Bacteria 504
439 Ga0495668_0016116 3300046616 Bacteria 4348
440 Ga0495668_0404200 3300046616 Bacteria 750
441 Ga0495625_0008402 3300046660 Bacteria 8814
442 Ga0495625_0165668 3300046660 Bacteria 1478
443 Ga0495625_0205165 3300046660 Bacteria 1298
444 Ga0495625_0364127 3300046660 Bacteria 911
445 Ga0495647_0641061 3300046681 Bacteria 500
446 Ga0495636_0684132 3300047318 Bacteria 505
447 Ga0495636_0689485 3300047318 Bacteria 504
448 Ga0495674_0716861 3300047319 Unclassified 784
449 Ga0495680_0217026 3300047322 Bacteria 1367
450 Ga0495677_0001751 3300047445 Bacteria 8698
451 Ga0495686_0034842 3300047472 Bacteria 3239
452 Ga0495686_0055301 3300047472 Bacteria 2482
453 Ga0495686_0142624 3300047472 Bacteria 1412
454 Ga0495615_0165720 3300048090 Bacteria 666
455 Ga0496102_0543699 3300048905 Bacteria 1084
456 Ga0496104_0000560 3300048907 Bacteria 31696
457 Ga0496105_0003456 3300048908 Bacteria 11690
458 Ga0496106_0134030 3300048909 Bacteria 1944
459 Ga0496108_0005016 3300048911 Bacteria 10695
460 Ga0496109_0008389 3300048912 Bacteria 8782
461 Ga0496110_0000436 3300048913 Bacteria 28367
462 Ga0496110_1658161 3300048913 Bacteria 549
463 Ga0496111_0003534 3300048914 Bacteria 9669
464 Ga0496111_0575049 3300048914 Bacteria 826
465 Ga0496111_0908890 3300048914 Bacteria 634
466 Ga0496112_0050030 3300048915 Bacteria 4097
467 Ga0496112_0425265 3300048915 Bacteria 1267
468 Ga0496113_0000567 3300048916 Bacteria 18393
469 Ga0496113_0386304 3300048916 Bacteria 1124
470 Ga0496115_0086651 3300048918 Bacteria 2555
471 Ga0496115_1090046 3300048918 Bacteria 606
472 Ga0496116_0117646 3300048919 Bacteria 1546
473 Ga0496120_0066306 3300048923 Bacteria 1997
474 Ga0496122_0012019 3300048925 Bacteria 8680
475 Ga0496122_0476093 3300048925 Bacteria 613
476 Ga0496123_0002911 3300048926 Bacteria 20019
477 Ga0496123_0022534 3300048926 Bacteria 4850
478 Ga0496123_0532543 3300048926 Bacteria 507
479 Ga0496124_0000684 3300048927 Bacteria 55763
480 Ga0496124_0003283 3300048927 Bacteria 19954
481 Ga0496124_0020387 3300048927 Bacteria 6127
482 Ga0496125_0006253 3300048928 Bacteria 12946
483 Ga0496125_0221593 3300048928 Bacteria 1218
484 Ga0496126_0103407 3300048929 Bacteria 2489
485 Ga0496126_0690812 3300048929 Bacteria 794
486 Ga0501307_026944 3300049162 Bacteria 779
487 Ga0495682_0050892 3300049460 Bacteria 1507
488 Ga0501314_032243 3300049530 Bacteria 586
489 Ga0501031_0267974 3300049568 Bacteria 1109
490 Ga0501032_0345317 3300049569 Bacteria 959
491 Ga0501032_0512389 3300049569 Bacteria 766
492 Ga0501033_0043329 3300049570 Bacteria 3352
493 Ga0501034_0001769 3300049571 Bacteria 27612
494 Ga0501034_0088327 3300049571 Bacteria 3098
495 Ga0501034_0091659 3300049571 Bacteria 3036
496 Ga0501034_0429692 3300049571 Bacteria 1241
497 Ga0501034_0704512 3300049571 Bacteria 908
498 Ga0501036_0990916 3300049572 Bacteria 688
499 Ga0501037_0030278 3300049573 Bacteria 4000
500 Ga0501037_0228170 3300049573 Bacteria 1308
501 Ga0501037_0521951 3300049573 Bacteria 804
502 Ga0501037_1008621 3300049573 Bacteria 542
503 Ga0501037_1053088 3300049573 Bacteria 528
504 Ga0501038_0735284 3300049574 Bacteria 737
505 Ga0501039_0012984 3300049575 Bacteria 6369
506 Ga0501039_0255481 3300049575 Bacteria 1378
507 Ga0501039_0619705 3300049575 Bacteria 848
508 Ga0501040_0082033 3300049576 Bacteria 2235
509 Ga0501040_1047283 3300049576 Bacteria 592
510 Ga0501041_0782036 3300049577 Bacteria 612
511 Ga0501041_1151516 3300049577 Bacteria 500
512 Ga0501042_0317779 3300049578 Bacteria 1125
513 Ga0501043_0060465 3300049579 Bacteria 2974
514 Ga0501043_0559274 3300049579 Bacteria 849
515 Ga0501046_0470970 3300049580 Bacteria 902
516 Ga0501047_0074907 3300049581 Bacteria 3258
517 Ga0501047_0505683 3300049581 Bacteria 1035
518 Ga0501068_0425122 3300049584 Unclassified 858
519 Ga0501070_0130207 3300049586 Bacteria 2079
520 Ga0501071_1224329 3300049587 Bacteria 580
521 Ga0501071_1352999 3300049587 Bacteria 550
522 Ga0501072_0004259 3300049588 Bacteria 10851
523 Ga0501072_0172002 3300049588 Bacteria 1729
524 Ga0501073_0346651 3300049589 Bacteria 1025
525 Ga0501074_1338533 3300049590 Bacteria 502
526 Ga0501076_0551202 3300049592 Bacteria 951
527 Ga0501076_0620438 3300049592 Bacteria 892
528 Ga0501076_0691077 3300049592 Bacteria 842
529 Ga0501076_0877952 3300049592 Bacteria 739
530 Ga0501077_0104367 3300049593 Bacteria 1796
531 Ga0501077_0542275 3300049593 Bacteria 746
532 Ga0501079_0644469 3300049741 Bacteria 834
533 Ga0501081_0870598 3300049743 Bacteria 679
534 Ga0501083_0032340 3300049744 Bacteria 3588
535 Ga0501083_0105475 3300049744 Bacteria 1856
536 Ga0501083_0832889 3300049744 Bacteria 600
537 Ga0501035_0743561 3300049822 Bacteria 788
538 Ga0501035_1359439 3300049822 Bacteria 546
539 Ga0501045_0864544 3300049824 Bacteria 665
540 nmdc:mga03n38_734481_c1 3300050490 Bacteria 571
541 nmdc:mga0yw44_185731_c1 3300050492 Bacteria 1370
542 nmdc:mga0k408_23848_c1 3300050493 Bacteria 3456
543 nmdc:mga0k408_272198_c1 3300050493 Bacteria 1011
544 nmdc:mga07m45_25876_c1 3300050496 Bacteria 3222
545 nmdc:mga05p37_501440_c1 3300050507 Bacteria 1393
546 nmdc:mga09592_697099_c1 3300050508 Bacteria 864
547 nmdc:mga06r32_1665_c1 3300050510 Bacteria 20044
548 nmdc:mga08y16_63600_c1 3300050511 Bacteria 3854
549 nmdc:mga08y16_913454_c1 3300050511 Bacteria 863
550 nmdc:mga0n895_1527513_c1 3300050512 Bacteria 633
551 nmdc:mga0n895_3715_c1 3300050512 Bacteria 12345
552 nmdc:mga0n895_46456_c1 3300050512 Bacteria 4242
553 nmdc:mga0n895_719464_c1 3300050512 Bacteria 993
554 nmdc:mga0rr50_127096_c1 3300050513 Bacteria 2037
555 nmdc:mga0rr50_335678_c1 3300050513 Bacteria 1269
556 nmdc:mga08x19_144753_c1 3300050514 Bacteria 1607
557 nmdc:mga0a205_133061_c1 3300050515 Bacteria 2387
558 nmdc:mga0a205_1678_c1 3300050515 Bacteria 19104
559 nmdc:mga0a205_367632_c1 3300050515 Bacteria 1304
560 nmdc:mga0a205_763315_c1 3300050515 Bacteria 815
561 Ga0500578_0052858 3300053086 Bacteria 2601
562 Ga0500643_000620 3300053087 Bacteria 24035
563 Ga0500646_0050422 3300053090 Bacteria 1200
564 Ga0500583_0040704 3300053092 Bacteria 2106
565 Ga0500651_0665818 3300053093 Bacteria 559
566 Ga0500651_0669906 3300053093 Bacteria 557
567 Ga0500650_0083677 3300053098 Bacteria 1492
568 Ga0500555_040251 3300053103 Bacteria 1303
569 Ga0500556_0103036 3300053104 Bacteria 1101
570 Ga0500556_0235543 3300053104 Bacteria 721
571 Ga0500562_046713 3300053108 Bacteria 1155
572 Ga0500608_000544 3300053122 Bacteria 14103
573 Ga0500642_0435744 3300053130 Bacteria 565
574 Ga0500652_004220 3300053131 Bacteria 4428
575 Ga0500559_0052896 3300053136 Bacteria 1796
576 Ga0500559_0168967 3300053136 Bacteria 1029
577 Ga0500588_0008763 3300053146 Bacteria 2377
578 Ga0500616_0449461 3300053153 Bacteria 508
579 Ga0500622_0019061 3300053156 Bacteria 3644
580 Ga0500627_0112322 3300053158 Bacteria 1227
581 Ga0501084_0058626 3300054114 Bacteria 3222
582 Ga0501084_0299868 3300054114 Bacteria 1357
583 Ga0501084_0821191 3300054114 Bacteria 783
584 Ga0501084_1087406 3300054114 Bacteria 671
585 Ga0587101_035285 3300059623 Bacteria 801
586 Ga0587107_096593 3300059652 Bacteria 579
587 Ga0587111_0086681 3300060346 Bacteria 758
588 Ga0501082_0654908 3300060353 Bacteria 919
589 Ga0501082_1196800 3300060353 Bacteria 664
590 Ga0530510_0281835 3300061734 Bacteria 1241

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2522572158 2523104118 82
2 iso_pu_bacteria 2643221574 2643884120 82
3 iso_pu_bacteria 2643221663 2644353379 82
4 iso_pu_bacteria 2643221699 2644551556 82
5 iso_pu_bacteria 2928972540 2928974219 82
6 iso_pu_bacteria 2941485952 2941486183 82
7 iso_pu_bacteria 2977240413 2977240818 82
8 3300005328 Ga0070676_10010155 Ga0070676_100101553 83
9 3300005333 Ga0070677_10060459 Ga0070677_100604592 83
10 3300005334 Ga0068869_100000612 Ga0068869_1000006126 83
11 3300005335 Ga0070666_10037880 Ga0070666_100378802 83
12 3300005336 Ga0070680_100478876 Ga0070680_1004788762 83
13 3300005337 Ga0070682_100548470 Ga0070682_1005484702 83
14 3300005338 Ga0068868_100288429 Ga0068868_1002884292 83
15 3300005338 Ga0068868_101710471 Ga0068868_1017104712 83
16 3300005339 Ga0070660_101320627 Ga0070660_1013206271 83
17 3300005341 Ga0070691_10130539 Ga0070691_101305392 83
18 3300005343 Ga0070687_100588787 Ga0070687_1005887872 83
19 3300005355 Ga0070671_100434528 Ga0070671_1004345282 83
20 3300005356 Ga0070674_100000248 Ga0070674_1000002487 83
21 3300005364 Ga0070673_100268708 Ga0070673_1002687082 83
22 3300005366 Ga0070659_100481843 Ga0070659_1004818432 83
23 3300005367 Ga0070667_100192087 Ga0070667_1001920873 83
24 3300005438 Ga0070701_10017696 Ga0070701_100176963 83
25 3300005440 Ga0070705_100000334 Ga0070705_10000033412 83
26 3300005441 Ga0070700_100149174 Ga0070700_1001491742 83
27 3300005444 Ga0070694_100015829 Ga0070694_1000158296 83
28 3300005444 Ga0070694_100098319 Ga0070694_1000983193 83
29 3300005455 Ga0070663_100658599 Ga0070663_1006585992 83
30 3300005456 Ga0070678_100006191 Ga0070678_1000061919 83
31 3300005457 Ga0070662_100000325 Ga0070662_10000032525 83
32 3300005459 Ga0068867_100000848 Ga0068867_10000084812 83
33 3300005467 Ga0070706_100648510 Ga0070706_1006485103 83
34 3300005468 Ga0070707_100856188 Ga0070707_1008561882 83
35 3300005518 Ga0070699_100104942 Ga0070699_1001049422 83
36 3300005530 Ga0070679_101479357 Ga0070679_1014793571 83
37 3300005536 Ga0070697_100925519 Ga0070697_1009255191 83
38 3300005544 Ga0070686_100122334 Ga0070686_1001223343 83
39 3300005545 Ga0070695_100007426 Ga0070695_1000074263 83
40 3300005546 Ga0070696_100007602 Ga0070696_1000076023 83
41 3300005547 Ga0070693_100042809 Ga0070693_1000428093 83
42 3300005548 Ga0070665_100096248 Ga0070665_1000962483 83
43 3300005549 Ga0070704_100266363 Ga0070704_1002663633 83
44 3300005563 Ga0068855_100056196 Ga0068855_1000561969 83
45 3300005564 Ga0070664_100934650 Ga0070664_1009346502 83
46 3300005577 Ga0068857_100108963 Ga0068857_1001089633 83
47 3300005577 Ga0068857_100338520 Ga0068857_1003385203 83
48 3300005578 Ga0068854_100000421 Ga0068854_10000042116 83
49 3300005614 Ga0068856_100110715 Ga0068856_1001107153 83
50 3300005615 Ga0070702_100013531 Ga0070702_1000135313 83
51 3300005618 Ga0068864_100003563 Ga0068864_1000035638 83
52 3300005718 Ga0068866_10000212 Ga0068866_100002127 83
53 3300005719 Ga0068861_100020884 Ga0068861_1000208843 83
54 3300005840 Ga0068870_10011634 Ga0068870_100116342 83
55 3300005842 Ga0068858_100089233 Ga0068858_1000892336 83
56 3300005842 Ga0068858_100229150 Ga0068858_1002291502 83
57 3300005843 Ga0068860_100011032 Ga0068860_1000110324 83
58 3300005844 Ga0068862_100189379 Ga0068862_1001893794 83
59 3300006237 Ga0097621_100083802 Ga0097621_1000838023 83
60 3300006358 Ga0068871_100136671 Ga0068871_1001366714 83
61 3300006852 Ga0075433_10080276 Ga0075433_100802766 83
62 3300006852 Ga0075433_10484571 Ga0075433_104845712 83
63 3300006871 Ga0075434_100954721 Ga0075434_1009547211 83
64 3300006881 Ga0068865_100000819 Ga0068865_1000008193 83
65 3300007076 Ga0075435_101863231 Ga0075435_1018632311 83
66 3300009098 Ga0105245_10017257 Ga0105245_100172572 83
67 3300009148 Ga0105243_10000488 Ga0105243_1000048819 83
68 3300009174 Ga0105241_10002467 Ga0105241_1000246716 83
69 3300009176 Ga0105242_10000445 Ga0105242_1000044524 83
70 3300009177 Ga0105248_10006674 Ga0105248_100066747 83
71 3300009177 Ga0105248_10110329 Ga0105248_101103293 83
72 3300009551 Ga0105238_10514738 Ga0105238_105147382 83
73 3300009553 Ga0105249_10004027 Ga0105249_100040273 83
74 3300009553 Ga0105249_11034012 Ga0105249_110340122 83
75 3300010375 Ga0105239_10004845 Ga0105239_100048455 83
76 3300011119 Ga0105246_10020057 Ga0105246_100200572 83
77 3300011119 Ga0105246_11446935 Ga0105246_114469351 83
78 3300013102 Ga0157371_10062787 Ga0157371_100627871 83
79 3300013306 Ga0163162_10005365 Ga0163162_100053653 83
80 3300013307 Ga0157372_10440671 Ga0157372_104406712 83
81 3300014325 Ga0163163_10571765 Ga0163163_105717652 83
82 3300014326 Ga0157380_10618020 Ga0157380_106180201 83
83 3300014326 Ga0157380_10680205 Ga0157380_106802053 83
84 3300014968 Ga0157379_10006100 Ga0157379_1000610015 83
85 3300014968 Ga0157379_12453539 Ga0157379_124535391 83
86 3300025899 Ga0207642_10000214 Ga0207642_1000021416 83
87 3300025903 Ga0207680_10010842 Ga0207680_100108423 83
88 3300025907 Ga0207645_10002435 Ga0207645_100024356 83
89 3300025908 Ga0207643_10009086 Ga0207643_100090865 83
90 3300025910 Ga0207684_11386412 Ga0207684_113864122 83
91 3300025911 Ga0207654_10091794 Ga0207654_100917942 83
92 3300025917 Ga0207660_10598766 Ga0207660_105987662 83
93 3300025918 Ga0207662_10593311 Ga0207662_105933112 83
94 3300025919 Ga0207657_11151757 Ga0207657_111517572 83
95 3300025921 Ga0207652_11030995 Ga0207652_110309952 83
96 3300025923 Ga0207681_10090643 Ga0207681_100906432 83
97 3300025925 Ga0207650_11909567 Ga0207650_119095671 83
98 3300025926 Ga0207659_10643706 Ga0207659_106437062 83
99 3300025927 Ga0207687_11773013 Ga0207687_117730132 83
100 3300025933 Ga0207706_10000116 Ga0207706_1000011614 83
101 3300025934 Ga0207686_10000245 Ga0207686_1000024527 83
102 3300025935 Ga0207709_10004711 Ga0207709_100047115 83
103 3300025937 Ga0207669_10000414 Ga0207669_100004147 83
104 3300025938 Ga0207704_10002203 Ga0207704_100022033 83
105 3300025940 Ga0207691_10511071 Ga0207691_105110712 83
106 3300025941 Ga0207711_10061675 Ga0207711_100616756 83
107 3300025942 Ga0207689_10001745 Ga0207689_1000174519 83
108 3300025945 Ga0207679_11039734 Ga0207679_110397342 83
109 3300025949 Ga0207667_10490310 Ga0207667_104903102 83
110 3300025960 Ga0207651_10081248 Ga0207651_100812482 83
111 3300025961 Ga0207712_11146033 Ga0207712_111460332 83
112 3300025972 Ga0207668_10154011 Ga0207668_101540112 83
113 3300025981 Ga0207640_10001361 Ga0207640_100013617 83
114 3300025986 Ga0207658_10164863 Ga0207658_101648633 83
115 3300026023 Ga0207677_10746714 Ga0207677_107467142 83
116 3300026035 Ga0207703_10057550 Ga0207703_100575506 83
117 3300026041 Ga0207639_10364649 Ga0207639_103646493 83
118 3300026067 Ga0207678_10429514 Ga0207678_104295142 83
119 3300026075 Ga0207708_10121162 Ga0207708_101211623 83
120 3300026089 Ga0207648_10000030 Ga0207648_10000030107 83
121 3300026095 Ga0207676_10010071 Ga0207676_100100713 83
122 3300026116 Ga0207674_10007183 Ga0207674_100071838 83
123 3300026116 Ga0207674_10378757 Ga0207674_103787572 83
124 3300026121 Ga0207683_10038280 Ga0207683_100382805 83
125 3300026142 Ga0207698_10599357 Ga0207698_105993572 83
126 3300027876 Ga0209974_10252951 Ga0209974_102529513 83
127 3300028379 Ga0268266_10136255 Ga0268266_101362554 83
128 3300028380 Ga0268265_10512375 Ga0268265_105123751 83
129 3300028381 Ga0268264_10009141 Ga0268264_100091412 83
130 3300031728 Ga0316578_10257515 Ga0316578_102575153 83
131 3300031733 Ga0316577_10430668 Ga0316577_104306682 83
132 3300032133 Ga0316583_10035019 Ga0316583_100350192 83
133 3300032168 Ga0316593_10277332 Ga0316593_102773322 83
134 3300037588 Ga0316581_0069120 Ga0316581_0069120_573_845 83
135 3300042015 Ga0439462_0105760 Ga0439462_0105760_225_491 83
136 3300042876 Ga0451577_0069497 Ga0451577_0069497_2295_2564 83
137 3300044673 Ga0453683_0176855 Ga0453683_0176855_448_717 83
138 3300044712 Ga0453684_0370049 Ga0453684_0370049_297_566 83
139 3300045051 Ga0451576_0216379 Ga0451576_0216379_1049_1318 83
140 3300045051 Ga0451576_0244749 Ga0451576_0244749_657_944 83
141 3300046455 Ga0495603_0009766 Ga0495603_0009766_4115_4384 83
142 3300046499 Ga0495594_0022729 Ga0495594_0022729_1533_1802 83
143 3300048909 Ga0496106_0134030 Ga0496106_0134030_348_617 83
144 3300048913 Ga0496110_1658161 Ga0496110_1658161_41_307 83
145 3300048914 Ga0496111_0908890 Ga0496111_0908890_185_451 83
146 3300049573 Ga0501037_0521951 Ga0501037_0521951_80_349 83
147 3300049573 Ga0501037_1053088 Ga0501037_1053088_223_492 83
148 3300049574 Ga0501038_0735284 Ga0501038_0735284_445_714 83
149 3300049575 Ga0501039_0012984 Ga0501039_0012984_6083_6352 83
150 3300049576 Ga0501040_0082033 Ga0501040_0082033_55_324 83
151 3300049577 Ga0501041_1151516 Ga0501041_1151516_210_479 83
152 3300049584 Ga0501068_0425122 Ga0501068_0425122_413_679 83
153 3300049588 Ga0501072_0004259 Ga0501072_0004259_5322_5591 83
154 3300049592 Ga0501076_0877952 Ga0501076_0877952_433_702 83
155 3300049593 Ga0501077_0104367 Ga0501077_0104367_894_1163 83
156 3300049822 Ga0501035_1359439 Ga0501035_1359439_111_380 83
157 3300049824 Ga0501045_0864544 Ga0501045_0864544_49_318 83
158 3300050512 nmdc:mga0n895_719464_c1 nmdc:mga0n895_719464_c1_132_401 83
159 3300050513 nmdc:mga0rr50_335678_c1 nmdc:mga0rr50_335678_c1_974_1243 83
160 3300050515 nmdc:mga0a205_133061_c1 nmdc:mga0a205_133061_c1_308_577 83
161 3300050515 nmdc:mga0a205_763315_c1 nmdc:mga0a205_763315_c1_227_496 83
162 3300061734 Ga0530510_0281835 Ga0530510_0281835_338_607 83
163 3300005544 Ga0070686_100000004 Ga0070686_100000004152 84
164 3300005843 Ga0068860_102047393 Ga0068860_1020473932 84
165 3300005843 Ga0068860_102735619 Ga0068860_1027356191 84
166 3300005985 Ga0081539_10000160 Ga0081539_10000160120 84
167 3300006847 Ga0075431_100006658 Ga0075431_1000066584 84
168 3300025918 Ga0207662_10094510 Ga0207662_100945102 84
169 3300026118 Ga0207675_100059407 Ga0207675_1000594071 84
170 3300028381 Ga0268264_11099948 Ga0268264_110999482 84
171 3300037418 Ga0395900_1184735 Ga0395900_1184735_142_414 84
172 3300041997 Ga0439431_0071041 Ga0439431_0071041_378_644 84
173 3300042002 Ga0439442_066180 Ga0439442_066180_64_330 84
174 3300046471 Ga0495650_0014402 Ga0495650_0014402_1216_1482 84
175 3300046681 Ga0495647_0641061 Ga0495647_0641061_180_449 84
176 3300047322 Ga0495680_0217026 Ga0495680_0217026_450_719 84
177 3300050510 nmdc:mga06r32_1665_c1 nmdc:mga06r32_1665_c1_11936_12214 84
178 3300005334 Ga0068869_101519059 Ga0068869_1015190592 85
179 3300005341 Ga0070691_10024327 Ga0070691_100243272 85
180 3300005347 Ga0070668_100483928 Ga0070668_1004839281 85
181 3300005354 Ga0070675_100062592 Ga0070675_1000625923 85
182 3300005437 Ga0070710_10780580 Ga0070710_107805801 85
183 3300005444 Ga0070694_100132350 Ga0070694_1001323502 85
184 3300005456 Ga0070678_100076480 Ga0070678_1000764803 85
185 3300005456 Ga0070678_100277400 Ga0070678_1002774002 85
186 3300005458 Ga0070681_10504411 Ga0070681_105044113 85
187 3300005458 Ga0070681_10848805 Ga0070681_108488052 85
188 3300005459 Ga0068867_100649319 Ga0068867_1006493192 85
189 3300005459 Ga0068867_101352012 Ga0068867_1013520123 85
190 3300005545 Ga0070695_100005345 Ga0070695_1000053453 85
191 3300005548 Ga0070665_101256379 Ga0070665_1012563792 85
192 3300005548 Ga0070665_102649807 Ga0070665_1026498071 85
193 3300005564 Ga0070664_100261657 Ga0070664_1002616572 85
194 3300005577 Ga0068857_100993377 Ga0068857_1009933772 85
195 3300005616 Ga0068852_100423905 Ga0068852_1004239052 85
196 3300005618 Ga0068864_100000642 Ga0068864_10000064226 85
197 3300005618 Ga0068864_101308803 Ga0068864_1013088032 85
198 3300005719 Ga0068861_100180865 Ga0068861_1001808653 85
199 3300005719 Ga0068861_100321293 Ga0068861_1003212932 85
200 3300005840 Ga0068870_10165057 Ga0068870_101650573 85
201 3300005841 Ga0068863_101342939 Ga0068863_1013429392 85
202 3300005842 Ga0068858_100000304 Ga0068858_10000030412 85
203 3300005844 Ga0068862_100645301 Ga0068862_1006453012 85
204 3300005937 Ga0081455_10000017 Ga0081455_10000017111 85
205 3300005937 Ga0081455_10001033 Ga0081455_1000103321 85
206 3300005937 Ga0081455_10997467 Ga0081455_109974672 85
207 3300005983 Ga0081540_1000059 Ga0081540_100005959 85
208 3300005983 Ga0081540_1057782 Ga0081540_10577822 85
209 3300006038 Ga0075365_10059288 Ga0075365_100592883 85
210 3300006051 Ga0075364_10249750 Ga0075364_102497502 85
211 3300006177 Ga0075362_10653528 Ga0075362_106535281 85
212 3300006358 Ga0068871_101640817 Ga0068871_1016408172 85
213 3300006844 Ga0075428_100050560 Ga0075428_1000505603 85
214 3300006852 Ga0075433_10002019 Ga0075433_100020193 85
215 3300006871 Ga0075434_100032393 Ga0075434_1000323936 85
216 3300006880 Ga0075429_100099059 Ga0075429_1000990592 85
217 3300006881 Ga0068865_101037141 Ga0068865_1010371412 85
218 3300006881 Ga0068865_101405614 Ga0068865_1014056142 85
219 3300007076 Ga0075435_100133339 Ga0075435_1001333393 85
220 3300007265 Ga0099794_10104128 Ga0099794_101041281 85
221 3300009094 Ga0111539_10143371 Ga0111539_101433713 85
222 3300009094 Ga0111539_10162770 Ga0111539_101627703 85
223 3300009098 Ga0105245_10156504 Ga0105245_101565042 85
224 3300009098 Ga0105245_12298117 Ga0105245_122981172 85
225 3300009147 Ga0114129_12852736 Ga0114129_128527362 85
226 3300009176 Ga0105242_10781644 Ga0105242_107816443 85
227 3300009177 Ga0105248_10011310 Ga0105248_100113103 85
228 3300009177 Ga0105248_10944101 Ga0105248_109441012 85
229 3300009545 Ga0105237_10026608 Ga0105237_100266082 85
230 3300009553 Ga0105249_10360087 Ga0105249_103600872 85
231 3300010375 Ga0105239_10173676 Ga0105239_101736765 85
232 3300010375 Ga0105239_10678160 Ga0105239_106781602 85
233 3300011119 Ga0105246_10149888 Ga0105246_101498883 85
234 3300011119 Ga0105246_12072115 Ga0105246_120721152 85
235 3300012475 Ga0157317_1016786 Ga0157317_10167861 85
236 3300013104 Ga0157370_10745202 Ga0157370_107452021 85
237 3300013297 Ga0157378_10652277 Ga0157378_106522773 85
238 3300013306 Ga0163162_13468556 Ga0163162_134685561 85
239 3300014325 Ga0163163_10154430 Ga0163163_101544305 85
240 3300014325 Ga0163163_10648689 Ga0163163_106486892 85
241 3300014325 Ga0163163_11483274 Ga0163163_114832742 85
242 3300014326 Ga0157380_10594732 Ga0157380_105947322 85
243 3300014968 Ga0157379_10632045 Ga0157379_106320452 85
244 3300014968 Ga0157379_10911954 Ga0157379_109119542 85
245 3300015684 Ga0183365_10001 Ga0183365_10001635 85
246 3300017792 Ga0163161_10291514 Ga0163161_102915142 85
247 3300017792 Ga0163161_10489070 Ga0163161_104890702 85
248 3300020076 Ga0206355_1015572 Ga0206355_10155724 85
249 3300020081 Ga0206354_10138590 Ga0206354_101385902 85
250 3300021361 Ga0213872_10196973 Ga0213872_101969732 85
251 3300021388 Ga0213875_10010457 Ga0213875_100104574 85
252 3300025261 Ga0209233_1050102 Ga0209233_10501022 85
253 3300025315 Ga0207697_10016637 Ga0207697_100166372 85
254 3300025914 Ga0207671_10010300 Ga0207671_100103009 85
255 3300025927 Ga0207687_10662526 Ga0207687_106625261 85
256 3300025934 Ga0207686_10987231 Ga0207686_109872312 85
257 3300025938 Ga0207704_10927382 Ga0207704_109273821 85
258 3300025941 Ga0207711_10099230 Ga0207711_100992303 85
259 3300025941 Ga0207711_10419461 Ga0207711_104194612 85
260 3300025945 Ga0207679_10965317 Ga0207679_109653172 85
261 3300025961 Ga0207712_10196428 Ga0207712_101964283 85
262 3300025972 Ga0207668_10422729 Ga0207668_104227292 85
263 3300026035 Ga0207703_10000435 Ga0207703_100004356 85
264 3300026075 Ga0207708_10245196 Ga0207708_102451963 85
265 3300026089 Ga0207648_10376312 Ga0207648_103763123 85
266 3300026095 Ga0207676_10000603 Ga0207676_100006036 85
267 3300026116 Ga0207674_10038821 Ga0207674_100388215 85
268 3300026118 Ga0207675_100250019 Ga0207675_1002500193 85
269 3300026118 Ga0207675_100930676 Ga0207675_1009306762 85
270 3300026118 Ga0207675_101031404 Ga0207675_1010314041 85
271 3300026121 Ga0207683_10096754 Ga0207683_100967543 85
272 3300027907 Ga0207428_10043517 Ga0207428_100435173 85
273 3300028379 Ga0268266_12186136 Ga0268266_121861362 85
274 3300028380 Ga0268265_10944934 Ga0268265_109449341 85
275 3300028380 Ga0268265_11190337 Ga0268265_111903372 85
276 3300028380 Ga0268265_11359482 Ga0268265_113594822 85
277 3300028786 Ga0307517_10583140 Ga0307517_105831402 85
278 3300031242 Ga0265329_10140096 Ga0265329_101400962 85
279 3300031456 Ga0307513_10033854 Ga0307513_100338543 85
280 3300031507 Ga0307509_10376128 Ga0307509_103761282 85
281 3300031548 Ga0307408_101947269 Ga0307408_1019472691 85
282 3300031711 Ga0265314_10242188 Ga0265314_102421882 85
283 3300031901 Ga0307406_10093084 Ga0307406_100930844 85
284 3300031911 Ga0307412_10001766 Ga0307412_100017668 85
285 3300031911 Ga0307412_10868354 Ga0307412_108683542 85
286 3300032002 Ga0307416_102387481 Ga0307416_1023874812 85
287 3300033180 Ga0307510_10003966 Ga0307510_100039662 85
288 3300034820 Ga0373959_0023917 Ga0373959_0023917_673_945 85
289 3300034957 Ga0373938_0025607 Ga0373938_0025607_818_1090 85
290 3300035084 Ga0373928_0023385 Ga0373928_0023385_465_737 85
291 3300035085 Ga0373929_0130594 Ga0373929_0130594_125_397 85
292 3300035088 Ga0373940_0074401 Ga0373940_0074401_96_368 85
293 3300035088 Ga0373940_0118960 Ga0373940_0118960_17_295 85
294 3300035090 Ga0373949_0004422 Ga0373949_0004422_1193_1465 85
295 3300035091 Ga0373951_0007601 Ga0373951_0007601_1552_1824 85
296 3300035092 Ga0373952_0001971 Ga0373952_0001971_2361_2633 85
297 3300035115 Ga0373941_0002622 Ga0373941_0002622_3081_3353 85
298 3300035115 Ga0373941_0227313 Ga0373941_0227313_169_447 85
299 3300035121 Ga0373960_0003749 Ga0373960_0003749_1936_2208 85
300 3300035207 Ga0373942_0030882 Ga0373942_0030882_76_348 85
301 3300035241 Ga0373961_0001996 Ga0373961_0001996_1519_1791 85
302 3300035242 Ga0373962_0003662 Ga0373962_0003662_1170_1442 85
303 3300035691 Ga0373931_0004929 Ga0373931_0004929_2267_2539 85
304 3300036401 Ga0373937_1537196 Ga0373937_1537196_33_299 85
305 3300037853 Ga0436364_1150066 Ga0436364_1150066_431_700 85
306 3300039437 Ga0436365_0115775 Ga0436365_0115775_252_521 85
307 3300039437 Ga0436365_0748526 Ga0436365_0748526_219_488 85
308 3300039447 Ga0436361_0093866 Ga0436361_0093866_714_983 85
309 3300039450 Ga0436363_0653852 Ga0436363_0653852_252_521 85
310 3300041452 Ga0451793_1071520 Ga0451793_1071520_138_416 85
311 3300041459 Ga0451800_1394774 Ga0451800_1394774_111_377 85
312 3300041463 Ga0451804_0199340 Ga0451804_0199340_34_300 85
313 3300041463 Ga0451804_0945728 Ga0451804_0945728_204_470 85
314 3300041486 Ga0451807_2077697 Ga0451807_2077697_529_795 85
315 3300041491 Ga0451833_0599544 Ga0451833_0599544_197_463 85
316 3300041512 Ga0451853_0109637 Ga0451853_0109637_353_619 85
317 3300044658 Ga0466972_0038882 Ga0466972_0038882_76_351 85
318 3300044683 Ga0466965_0936974 Ga0466965_0936974_204_479 85
319 3300044712 Ga0453684_0909661 Ga0453684_0909661_193_462 85
320 3300045051 Ga0451576_0147560 Ga0451576_0147560_2010_2276 85
321 3300045976 Ga0466967_1016346 Ga0466967_1016346_465_734 85
322 3300046457 Ga0495590_0006457 Ga0495590_0006457_117_395 85
323 3300046460 Ga0495638_0122540 Ga0495638_0122540_433_702 85
324 3300046476 Ga0495662_0354654 Ga0495662_0354654_115_381 85
325 3300046491 Ga0495584_0346853 Ga0495584_0346853_286_558 85
326 3300046491 Ga0495584_0480986 Ga0495584_0480986_41_307 85
327 3300046492 Ga0495585_0437815 Ga0495585_0437815_230_496 85
328 3300046506 Ga0495583_0128692 Ga0495583_0128692_357_623 85
329 3300046519 Ga0495632_0073983 Ga0495632_0073983_796_1068 85
330 3300046519 Ga0495632_0092109 Ga0495632_0092109_975_1241 85
331 3300046522 Ga0495643_0119942 Ga0495643_0119942_836_1105 85
332 3300046542 Ga0495597_0230572 Ga0495597_0230572_440_718 85
333 3300046616 Ga0495668_0016116 Ga0495668_0016116_1569_1838 85
334 3300046660 Ga0495625_0008402 Ga0495625_0008402_1896_2165 85
335 3300046660 Ga0495625_0165668 Ga0495625_0165668_813_1079 85
336 3300047318 Ga0495636_0689485 Ga0495636_0689485_94_366 85
337 3300047319 Ga0495674_0716861 Ga0495674_0716861_338_604 85
338 3300047445 Ga0495677_0001751 Ga0495677_0001751_4845_5114 85
339 3300047472 Ga0495686_0034842 Ga0495686_0034842_1933_2202 85
340 3300048905 Ga0496102_0543699 Ga0496102_0543699_188_460 85
341 3300048914 Ga0496111_0575049 Ga0496111_0575049_67_333 85
342 3300048915 Ga0496112_0425265 Ga0496112_0425265_779_1048 85
343 3300048916 Ga0496113_0386304 Ga0496113_0386304_325_594 85
344 3300048918 Ga0496115_1090046 Ga0496115_1090046_147_419 85
345 3300048923 Ga0496120_0066306 Ga0496120_0066306_389_658 85
346 3300048926 Ga0496123_0022534 Ga0496123_0022534_3616_3885 85
347 3300048926 Ga0496123_0532543 Ga0496123_0532543_141_410 85
348 3300048927 Ga0496124_0000684 Ga0496124_0000684_38738_39007 85
349 3300048927 Ga0496124_0003283 Ga0496124_0003283_14195_14464 85
350 3300048928 Ga0496125_0221593 Ga0496125_0221593_141_410 85
351 3300048929 Ga0496126_0103407 Ga0496126_0103407_1216_1485 85
352 3300049162 Ga0501307_026944 Ga0501307_026944_455_733 85
353 3300049460 Ga0495682_0050892 Ga0495682_0050892_569_835 85
354 3300049530 Ga0501314_032243 Ga0501314_032243_213_482 85
355 3300049568 Ga0501031_0267974 Ga0501031_0267974_620_889 85
356 3300049569 Ga0501032_0345317 Ga0501032_0345317_294_563 85
357 3300049569 Ga0501032_0512389 Ga0501032_0512389_129_398 85
358 3300049571 Ga0501034_0001769 Ga0501034_0001769_17674_17943 85
359 3300049571 Ga0501034_0088327 Ga0501034_0088327_1022_1291 85
360 3300049571 Ga0501034_0091659 Ga0501034_0091659_1677_1946 85
361 3300049571 Ga0501034_0704512 Ga0501034_0704512_342_611 85
362 3300049573 Ga0501037_0030278 Ga0501037_0030278_144_413 85
363 3300049573 Ga0501037_0228170 Ga0501037_0228170_323_592 85
364 3300049575 Ga0501039_0255481 Ga0501039_0255481_176_442 85
365 3300049576 Ga0501040_1047283 Ga0501040_1047283_226_498 85
366 3300049579 Ga0501043_0060465 Ga0501043_0060465_844_1113 85
367 3300049579 Ga0501043_0559274 Ga0501043_0559274_502_771 85
368 3300049580 Ga0501046_0470970 Ga0501046_0470970_273_542 85
369 3300049581 Ga0501047_0074907 Ga0501047_0074907_2946_3215 85
370 3300049581 Ga0501047_0505683 Ga0501047_0505683_712_981 85
371 3300049587 Ga0501071_1224329 Ga0501071_1224329_89_355 85
372 3300049588 Ga0501072_0172002 Ga0501072_0172002_644_910 85
373 3300049592 Ga0501076_0551202 Ga0501076_0551202_110_376 85
374 3300049741 Ga0501079_0644469 Ga0501079_0644469_366_632 85
375 3300049744 Ga0501083_0832889 Ga0501083_0832889_140_409 85
376 3300050492 nmdc:mga0yw44_185731_c1 nmdc:mga0yw44_185731_c1_505_777 85
377 3300050507 nmdc:mga05p37_501440_c1 nmdc:mga05p37_501440_c1_542_814 85
378 3300050508 nmdc:mga09592_697099_c1 nmdc:mga09592_697099_c1_170_436 85
379 3300050511 nmdc:mga08y16_63600_c1 nmdc:mga08y16_63600_c1_1825_2097 85
380 3300050511 nmdc:mga08y16_913454_c1 nmdc:mga08y16_913454_c1_194_460 85
381 3300050512 nmdc:mga0n895_1527513_c1 nmdc:mga0n895_1527513_c1_173_442 85
382 3300050512 nmdc:mga0n895_3715_c1 nmdc:mga0n895_3715_c1_1817_2089 85
383 3300050515 nmdc:mga0a205_1678_c1 nmdc:mga0a205_1678_c1_17320_17592 85
384 3300053087 Ga0500643_000620 Ga0500643_000620_11274_11543 85
385 3300053090 Ga0500646_0050422 Ga0500646_0050422_132_404 85
386 3300053092 Ga0500583_0040704 Ga0500583_0040704_509_781 85
387 3300053093 Ga0500651_0665818 Ga0500651_0665818_245_517 85
388 3300053093 Ga0500651_0669906 Ga0500651_0669906_274_546 85
389 3300053104 Ga0500556_0103036 Ga0500556_0103036_79_351 85
390 3300053104 Ga0500556_0235543 Ga0500556_0235543_391_663 85
391 3300053108 Ga0500562_046713 Ga0500562_046713_21_293 85
392 3300053131 Ga0500652_004220 Ga0500652_004220_3453_3722 85
393 3300053136 Ga0500559_0052896 Ga0500559_0052896_1405_1674 85
394 3300053146 Ga0500588_0008763 Ga0500588_0008763_455_727 85
395 3300053153 Ga0500616_0449461 Ga0500616_0449461_66_338 85
396 3300053158 Ga0500627_0112322 Ga0500627_0112322_87_359 85
397 3300054114 Ga0501084_0821191 Ga0501084_0821191_299_565 85
398 3300003320 rootH2_10050513 rootH2_100505133 86
399 3300003578 Ga0006562J51391_1036509 Ga0006562J51391_10365094 86
400 3300003771 Ga0055526_1094353 Ga0055526_10943531 86
401 3300003781 Ga0055536_1055297 Ga0055536_10552972 86
402 3300004800 Ga0058861_10016048 Ga0058861_100160482 86
403 3300004803 Ga0058862_10002028 Ga0058862_100020282 86
404 3300005289 Ga0065704_10811784 Ga0065704_108117841 86
405 3300005331 Ga0070670_102194004 Ga0070670_1021940041 86
406 3300005339 Ga0070660_100398500 Ga0070660_1003985002 86
407 3300005365 Ga0070688_101034711 Ga0070688_1010347112 86
408 3300005406 Ga0070703_10163233 Ga0070703_101632332 86
409 3300005437 Ga0070710_11232122 Ga0070710_112321221 86
410 3300005439 Ga0070711_101071417 Ga0070711_1010714172 86
411 3300005455 Ga0070663_101663052 Ga0070663_1016630521 86
412 3300005563 Ga0068855_100656708 Ga0068855_1006567082 86
413 3300005577 Ga0068857_101099153 Ga0068857_1010991532 86
414 3300005614 Ga0068856_100599869 Ga0068856_1005998692 86
415 3300005617 Ga0068859_101168430 Ga0068859_1011684302 86
416 3300005841 Ga0068863_101180230 Ga0068863_1011802302 86
417 3300005842 Ga0068858_100677348 Ga0068858_1006773482 86
418 3300006048 Ga0075363_100707272 Ga0075363_1007072721 86
419 3300006177 Ga0075362_10094835 Ga0075362_100948351 86
420 3300006178 Ga0075367_10883227 Ga0075367_108832271 86
421 3300006186 Ga0075369_10002976 Ga0075369_100029765 86
422 3300006186 Ga0075369_10315732 Ga0075369_103157322 86
423 3300006195 Ga0075366_10194639 Ga0075366_101946392 86
424 3300006353 Ga0075370_10146676 Ga0075370_101466762 86
425 3300006358 Ga0068871_102198770 Ga0068871_1021987701 86
426 3300006871 Ga0075434_100279936 Ga0075434_1002799362 86
427 3300006914 Ga0075436_101462241 Ga0075436_1014622412 86
428 3300006931 Ga0097620_101168687 Ga0097620_1011686872 86
429 3300007076 Ga0075435_100097945 Ga0075435_1000979453 86
430 3300007076 Ga0075435_100483629 Ga0075435_1004836292 86
431 3300009101 Ga0105247_10739851 Ga0105247_107398512 86
432 3300009148 Ga0105243_13098231 Ga0105243_130982312 86
433 3300009177 Ga0105248_11124274 Ga0105248_111242742 86
434 3300009177 Ga0105248_12622735 Ga0105248_126227351 86
435 3300011119 Ga0105246_11282353 Ga0105246_112823531 86
436 3300012513 Ga0157326_1035108 Ga0157326_10351082 86
437 3300013100 Ga0157373_10284061 Ga0157373_102840611 86
438 3300013102 Ga0157371_10008337 Ga0157371_1000833712 86
439 3300013102 Ga0157371_10029003 Ga0157371_100290036 86
440 3300013104 Ga0157370_10014471 Ga0157370_100144716 86
441 3300013104 Ga0157370_10616493 Ga0157370_106164932 86
442 3300013105 Ga0157369_10007496 Ga0157369_100074966 86
443 3300013105 Ga0157369_10008829 Ga0157369_100088296 86
444 3300013105 Ga0157369_10385659 Ga0157369_103856592 86
445 3300014968 Ga0157379_11244899 Ga0157379_112448992 86
446 3300017792 Ga0163161_10666389 Ga0163161_106663892 86
447 3300020069 Ga0197907_10667977 Ga0197907_106679772 86
448 3300020070 Ga0206356_11110789 Ga0206356_111107892 86
449 3300020082 Ga0206353_11674705 Ga0206353_116747052 86
450 3300022467 Ga0224712_10308432 Ga0224712_103084322 86
451 3300025292 Ga0209676_1000038 Ga0209676_100003822 86
452 3300025292 Ga0209676_1000253 Ga0209676_100025380 86
453 3300025292 Ga0209676_1030538 Ga0209676_10305382 86
454 3300025295 Ga0209564_1017530 Ga0209564_10175304 86
455 3300025298 Ga0209050_1000948 Ga0209050_10009486 86
456 3300025298 Ga0209050_1011769 Ga0209050_10117696 86
457 3300025299 Ga0209256_1014947 Ga0209256_10149474 86
458 3300025303 Ga0209051_1015983 Ga0209051_10159833 86
459 3300025304 Ga0209257_1000525 Ga0209257_100052522 86
460 3300025304 Ga0209257_1026430 Ga0209257_10264302 86
461 3300025900 Ga0207710_10423343 Ga0207710_104233431 86
462 3300025915 Ga0207693_11353120 Ga0207693_113531201 86
463 3300025917 Ga0207660_10164153 Ga0207660_101641533 86
464 3300025919 Ga0207657_10207928 Ga0207657_102079283 86
465 3300025925 Ga0207650_11632207 Ga0207650_116322072 86
466 3300025942 Ga0207689_11403177 Ga0207689_114031771 86
467 3300025945 Ga0207679_10922726 Ga0207679_109227262 86
468 3300025949 Ga0207667_11874214 Ga0207667_118742142 86
469 3300026023 Ga0207677_10716465 Ga0207677_107164652 86
470 3300026035 Ga0207703_10498440 Ga0207703_104984402 86
471 3300026078 Ga0207702_10628793 Ga0207702_106287932 86
472 3300027907 Ga0207428_10160117 Ga0207428_101601173 86
473 3300028563 Ga0265319_1121503 Ga0265319_11215032 86
474 3300029277 Ga0311001_1032624 Ga0311001_10326242 86
475 3300031239 Ga0265328_10403329 Ga0265328_104033291 86
476 3300031241 Ga0265325_10231624 Ga0265325_102316241 86
477 3300031242 Ga0265329_10219553 Ga0265329_102195532 86
478 3300031247 Ga0265340_10172388 Ga0265340_101723882 86
479 3300031249 Ga0265339_10180145 Ga0265339_101801452 86
480 3300031344 Ga0265316_10164656 Ga0265316_101646562 86
481 3300031711 Ga0265314_10432197 Ga0265314_104321971 86
482 3300031712 Ga0265342_10225169 Ga0265342_102251692 86
483 3300031731 Ga0307405_11030086 Ga0307405_110300862 86
484 3300031901 Ga0307406_10001233 Ga0307406_100012332 86
485 3300031901 Ga0307406_11404827 Ga0307406_114048272 86
486 3300031911 Ga0307412_10009058 Ga0307412_100090588 86
487 3300031995 Ga0307409_100274362 Ga0307409_1002743622 86
488 3300031995 Ga0307409_100317421 Ga0307409_1003174212 86
489 3300032002 Ga0307416_100196478 Ga0307416_1001964783 86
490 3300032126 Ga0307415_101201950 Ga0307415_1012019501 86
491 3300032168 Ga0316593_10316704 Ga0316593_103167042 86
492 3300037312 Ga0395899_0128632 Ga0395899_0128632_906_1181 86
493 3300037312 Ga0395899_0191311 Ga0395899_0191311_841_1116 86
494 3300037312 Ga0395899_0508331 Ga0395899_0508331_484_756 86
495 3300037418 Ga0395900_0096102 Ga0395900_0096102_1887_2162 86
496 3300037466 Ga0395898_0090798 Ga0395898_0090798_662_937 86
497 3300037466 Ga0395898_0769144 Ga0395898_0769144_329_601 86
498 3300037471 Ga0395905_0218958 Ga0395905_0218958_930_1205 86
499 3300038443 Ga0395901_0275428 Ga0395901_0275428_982_1257 86
500 3300038741 Ga0400488_39798 Ga0400488_39798_784_1044 86
501 3300039437 Ga0436365_1784067 Ga0436365_1784067_503_772 86
502 3300039453 Ga0436362_0219308 Ga0436362_0219308_32_301 86
503 3300041460 Ga0451802_0195283 Ga0451802_0195283_100_369 86
504 3300041461 Ga0451805_025979 Ga0451805_025979_231_521 86
505 3300041498 Ga0451841_0664151 Ga0451841_0664151_235_504 86
506 3300041501 Ga0451845_0749816 Ga0451845_0749816_119_388 86
507 3300041512 Ga0451853_0965893 Ga0451853_0965893_165_455 86
508 3300042876 Ga0451577_0000703 Ga0451577_0000703_32023_32295 86
509 3300042876 Ga0451577_0111122 Ga0451577_0111122_1202_1471 86
510 3300042876 Ga0451577_0174551 Ga0451577_0174551_1415_1684 86
511 3300044673 Ga0453683_0000045 Ga0453683_0000045_115027_115302 86
512 3300044673 Ga0453683_0002370 Ga0453683_0002370_7272_7541 86
513 3300044673 Ga0453683_0028862 Ga0453683_0028862_44_313 86
514 3300044673 Ga0453683_0189701 Ga0453683_0189701_374_643 86
515 3300044694 Ga0466963_0548445 Ga0466963_0548445_232_504 86
516 3300044712 Ga0453684_0001990 Ga0453684_0001990_32133_32405 86
517 3300044712 Ga0453684_0008021 Ga0453684_0008021_8903_9181 86
518 3300044712 Ga0453684_0026846 Ga0453684_0026846_4713_4991 86
519 3300044712 Ga0453684_0466332 Ga0453684_0466332_289_558 86
520 3300045051 Ga0451576_0000352 Ga0451576_0000352_20015_20287 86
521 3300045051 Ga0451576_0007865 Ga0451576_0007865_8943_9206 86
522 3300045051 Ga0451576_0025294 Ga0451576_0025294_781_1050 86
523 3300045051 Ga0451576_0387687 Ga0451576_0387687_658_933 86
524 3300045051 Ga0451576_0857159 Ga0451576_0857159_442_720 86
525 3300045976 Ga0466967_0125509 Ga0466967_0125509_1443_1715 86
526 3300045976 Ga0466967_1258560 Ga0466967_1258560_336_608 86
527 3300046460 Ga0495638_0051220 Ga0495638_0051220_1653_1922 86
528 3300046506 Ga0495583_0210609 Ga0495583_0210609_186_455 86
529 3300046507 Ga0495606_0050694 Ga0495606_0050694_931_1200 86
530 3300046522 Ga0495643_0115052 Ga0495643_0115052_730_999 86
531 3300046524 Ga0495648_0066404 Ga0495648_0066404_1278_1547 86
532 3300046542 Ga0495597_0069789 Ga0495597_0069789_508_777 86
533 3300046543 Ga0495645_0962710 Ga0495645_0962710_24_302 86
534 3300046616 Ga0495668_0404200 Ga0495668_0404200_145_414 86
535 3300046660 Ga0495625_0205165 Ga0495625_0205165_275_544 86
536 3300046660 Ga0495625_0364127 Ga0495625_0364127_217_489 86
537 3300047318 Ga0495636_0684132 Ga0495636_0684132_64_333 86
538 3300047472 Ga0495686_0055301 Ga0495686_0055301_1745_2014 86
539 3300047472 Ga0495686_0142624 Ga0495686_0142624_944_1234 86
540 3300048090 Ga0495615_0165720 Ga0495615_0165720_76_342 86
541 3300048907 Ga0496104_0000560 Ga0496104_0000560_1977_2252 86
542 3300048908 Ga0496105_0003456 Ga0496105_0003456_4730_5005 86
543 3300048911 Ga0496108_0005016 Ga0496108_0005016_518_793 86
544 3300048912 Ga0496109_0008389 Ga0496109_0008389_3454_3729 86
545 3300048913 Ga0496110_0000436 Ga0496110_0000436_23044_23319 86
546 3300048914 Ga0496111_0003534 Ga0496111_0003534_4605_4880 86
547 3300048915 Ga0496112_0050030 Ga0496112_0050030_625_900 86
548 3300048916 Ga0496113_0000567 Ga0496113_0000567_14533_14808 86
549 3300048918 Ga0496115_0086651 Ga0496115_0086651_995_1282 86
550 3300048919 Ga0496116_0117646 Ga0496116_0117646_707_991 86
551 3300048925 Ga0496122_0012019 Ga0496122_0012019_22_309 86
552 3300048925 Ga0496122_0476093 Ga0496122_0476093_186_470 86
553 3300048926 Ga0496123_0002911 Ga0496123_0002911_1759_2046 86
554 3300048927 Ga0496124_0020387 Ga0496124_0020387_3555_3824 86
555 3300048928 Ga0496125_0006253 Ga0496125_0006253_9911_10195 86
556 3300048929 Ga0496126_0690812 Ga0496126_0690812_99_386 86
557 3300049570 Ga0501033_0043329 Ga0501033_0043329_1806_2084 86
558 3300049571 Ga0501034_0429692 Ga0501034_0429692_737_1009 86
559 3300049572 Ga0501036_0990916 Ga0501036_0990916_374_652 86
560 3300049573 Ga0501037_1008621 Ga0501037_1008621_161_439 86
561 3300049575 Ga0501039_0619705 Ga0501039_0619705_173_445 86
562 3300049577 Ga0501041_0782036 Ga0501041_0782036_62_340 86
563 3300049578 Ga0501042_0317779 Ga0501042_0317779_505_777 86
564 3300049586 Ga0501070_0130207 Ga0501070_0130207_1190_1462 86
565 3300049587 Ga0501071_1352999 Ga0501071_1352999_205_477 86
566 3300049589 Ga0501073_0346651 Ga0501073_0346651_686_964 86
567 3300049590 Ga0501074_1338533 Ga0501074_1338533_130_408 86
568 3300049592 Ga0501076_0620438 Ga0501076_0620438_528_800 86
569 3300049592 Ga0501076_0691077 Ga0501076_0691077_413_691 86
570 3300049593 Ga0501077_0542275 Ga0501077_0542275_444_722 86
571 3300049743 Ga0501081_0870598 Ga0501081_0870598_18_290 86
572 3300049744 Ga0501083_0032340 Ga0501083_0032340_3240_3518 86
573 3300049744 Ga0501083_0105475 Ga0501083_0105475_698_976 86
574 3300049822 Ga0501035_0743561 Ga0501035_0743561_239_517 86
575 3300050490 nmdc:mga03n38_734481_c1 nmdc:mga03n38_734481_c1_128_400 86
576 3300050493 nmdc:mga0k408_23848_c1 nmdc:mga0k408_23848_c1_1216_1485 86
577 3300050493 nmdc:mga0k408_272198_c1 nmdc:mga0k408_272198_c1_585_857 86
578 3300050496 nmdc:mga07m45_25876_c1 nmdc:mga07m45_25876_c1_1817_2086 86
579 3300050512 nmdc:mga0n895_46456_c1 nmdc:mga0n895_46456_c1_2398_2670 86
580 3300050513 nmdc:mga0rr50_127096_c1 nmdc:mga0rr50_127096_c1_1408_1680 86
581 3300050514 nmdc:mga08x19_144753_c1 nmdc:mga08x19_144753_c1_553_825 86
582 3300050515 nmdc:mga0a205_367632_c1 nmdc:mga0a205_367632_c1_699_971 86
583 3300053086 Ga0500578_0052858 Ga0500578_0052858_1591_1860 86
584 3300053098 Ga0500650_0083677 Ga0500650_0083677_635_904 86
585 3300053103 Ga0500555_040251 Ga0500555_040251_602_874 86
586 3300053122 Ga0500608_000544 Ga0500608_000544_11079_11348 86
587 3300053130 Ga0500642_0435744 Ga0500642_0435744_141_410 86
588 3300053136 Ga0500559_0168967 Ga0500559_0168967_412_681 86
589 3300053156 Ga0500622_0019061 Ga0500622_0019061_796_1065 86
590 3300054114 Ga0501084_0058626 Ga0501084_0058626_2492_2770 86
591 3300054114 Ga0501084_0299868 Ga0501084_0299868_457_735 86
592 3300054114 Ga0501084_1087406 Ga0501084_1087406_48_320 86
593 3300059623 Ga0587101_035285 Ga0587101_035285_115_396 86
594 3300059652 Ga0587107_096593 Ga0587107_096593_277_558 86
595 3300060346 Ga0587111_0086681 Ga0587111_0086681_342_623 86
596 3300060353 Ga0501082_0654908 Ga0501082_0654908_486_758 86
597 3300060353 Ga0501082_1196800 Ga0501082_1196800_238_516 86

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01016

Ribosomal_L27

Ribosomal L27 protein

2

81

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9741 20 85
1v8q-assembly1.cif.gz_A crystal structure of ribosomal protein l27 from thermus thermophilus hb8 0.9598 20 85
6yws-assembly1.cif.gz_R the structure of the large subunit of the mitoribosome from neurospora crassa 0.934 19 84
6ywy-assembly1.cif.gz_R the structure of the mitoribosome from neurospora crassa with bound trna at the p-site 0.934 19 84
8c8z-assembly1.cif.gz_W cryo-em captures early ribosome assembly in action 0.9336 17 84
ID Description Score Start End Superfamily
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9741 20 85 2.40.50.100
1v8qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9598 20 85 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9157 29 82 2.40.50.100
af_C0Z3L6_20_123_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8911 21 86 2.40.50.100
af_Q8IBQ2_8_59_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.8832 29 82 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A525J835-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9981 21 86 GO:0003735
GO:0006412
GO:0022625
AF-A0A328ESH9-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9878 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A660TPI7-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9826 20 84 GO:0003735
GO:0006412
GO:0022625
AF-A0A382C6Q8-F1-model_v4 Ribosomal protein L27 0.9825 21 83 GO:0003735
GO:0006412
GO:0022625
AF-K2DRZ8-F1-model_v4 Large ribosomal subunit protein bL27 (50S ribosomal protein L27) 0.9803 21 84 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
83.88 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map