F467308

General Info

Members Datasets Scaffolds Average Seq Length
594 310 593 185

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000045|Ga0070665_10000004549
Length 216
Sequence MPPKTDPIIEEKIAEETVVVDXXXXAAAVAPTEQRTDHRGGQGENKSDLLEKVVFINRCAKVVKGGRRFSFSALLVVGDRKGKVGVGFGKANEVTEAIRKATDAARKHLEPVSLRGNTIPHEVMGQFGGGRVFLRPASPGTGLIAGGGVRAVVEAAGIKDLLAKSLGSGNPANVVRATLQALKQLRQKEVIFQLRGKTVKPAAPAVAGESDPALAS

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2718217752 Candidatus Xiphinematobacter sp. Idaho Grape Isolate Unclassified
4 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
104 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
181 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
208 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
209 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
210 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
224 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
225 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
226 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
230 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
231 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
238 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
295 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
296 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
304 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
305 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
306 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
309 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
310 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 2.02
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.04
Nodule 0
Rhizoplane 5.39
Rhizosphere 86.53
Stem 0
Stem Tuber 0
Unclassified 4.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_111370 2162886006 Bacteria 2236
2 SwRhRL3b_contig_2227077 2162886006 Unclassified 1583
3 SwRhRL2b_contig_128758 2162886007 Bacteria 2329
4 JGI24743J22301_10000748 3300001991 Bacteria 4062
5 JGI24743J22301_10010320 3300001991 Bacteria 1666
6 JGI24744J21845_10011528 3300002077 Bacteria 1807
7 JGI24033J26618_1000142 3300002155 Bacteria 9538
8 JGI25406J46586_10000001 3300003203 Bacteria 251772
9 JGI25406J46586_10000007 3300003203 Bacteria 112227
10 rootH2_10050166 3300003320 Bacteria 16007
11 rootL2_10030599 3300003322 Bacteria 2291
12 rootL2_10139488 3300003322 Bacteria 1084
13 rootH1_10007007 3300003316 Bacteria 7034
14 rootH1_10007007 3300003323 Bacteria 6457
15 Ga0055530_10029193 3300003791 Bacteria 1477
16 Ga0065704_10115944 3300005289 Bacteria 1863
17 Ga0065712_10088457 3300005290 Bacteria 2519
18 Ga0065712_10145424 3300005290 Bacteria 1413
19 Ga0065715_10001491 3300005293 Bacteria 7335
20 Ga0065707_10102203 3300005295 Bacteria 2810
21 Ga0070658_10018594 3300005327 Bacteria 5565
22 Ga0070676_10079494 3300005328 Bacteria 1986
23 Ga0070676_10305976 3300005328 Bacteria 1079
24 Ga0070676_10428966 3300005328 Bacteria 925
25 Ga0070683_100055457 3300005329 Bacteria 3678
26 Ga0070670_100003742 3300005331 Bacteria 12666
27 Ga0070670_100205578 3300005331 Bacteria 1711
28 Ga0070670_100314402 3300005331 Bacteria 1371
29 Ga0070670_100359756 3300005331 Bacteria 1280
30 Ga0068869_100697020 3300005334 Bacteria 866
31 Ga0070666_10001876 3300005335 Bacteria 12791
32 Ga0070666_10002056 3300005335 Bacteria 12212
33 Ga0070666_10037886 3300005335 Bacteria 3207
34 Ga0068868_100215528 3300005338 Bacteria 1606
35 Ga0068868_100221974 3300005338 Bacteria 1582
36 Ga0070660_100151607 3300005339 Bacteria 1864
37 Ga0070689_100100534 3300005340 Bacteria 2288
38 Ga0070687_100411748 3300005343 Bacteria 889
39 Ga0070661_100000386 3300005344 Bacteria 34590
40 Ga0070661_100097194 3300005344 Bacteria 2186
41 Ga0070661_100288697 3300005344 Bacteria 1274
42 Ga0070668_100069825 3300005347 Bacteria 2734
43 Ga0070668_100182452 3300005347 Bacteria 1715
44 Ga0070668_100497705 3300005347 Bacteria 1055
45 Ga0070669_100002011 3300005353 Bacteria 14710
46 Ga0070669_100004431 3300005353 Bacteria 10120
47 Ga0070669_100033015 3300005353 Bacteria 3741
48 Ga0070669_100157939 3300005353 Bacteria 1760
49 Ga0070669_100199988 3300005353 Unclassified 1572
50 Ga0070675_100004678 3300005354 Bacteria 10447
51 Ga0070675_100133137 3300005354 Bacteria 2120
52 Ga0070675_100137843 3300005354 Bacteria 2083
53 Ga0070675_100193153 3300005354 Bacteria 1765
54 Ga0070671_100000283 3300005355 Bacteria 34469
55 Ga0070671_100011134 3300005355 Bacteria 7224
56 Ga0070671_100016515 3300005355 Bacteria 5967
57 Ga0070674_100013872 3300005356 Bacteria 4993
58 Ga0070674_100034793 3300005356 Bacteria 3368
59 Ga0070674_100048927 3300005356 Bacteria 2904
60 Ga0070674_100064027 3300005356 Bacteria 2575
61 Ga0070674_100293714 3300005356 Bacteria 1293
62 Ga0070673_100008141 3300005364 Bacteria 6955
63 Ga0070673_100014325 3300005364 Bacteria 5516
64 Ga0070673_100075213 3300005364 Bacteria 2724
65 Ga0070688_100000733 3300005365 Bacteria 16191
66 Ga0070667_100004665 3300005367 Bacteria 11504
67 Ga0070667_100072064 3300005367 Bacteria 2943
68 Ga0070667_100258686 3300005367 Bacteria 1558
69 Ga0070667_100449308 3300005367 Bacteria 1178
70 Ga0070709_10408304 3300005434 Bacteria 1015
71 Ga0070709_10499439 3300005434 Bacteria 924
72 Ga0070714_100337764 3300005435 Bacteria 1412
73 Ga0070714_100879043 3300005435 Bacteria 870
74 Ga0070713_100354871 3300005436 Bacteria 1361
75 Ga0070710_10136557 3300005437 Bacteria 1500
76 Ga0070710_10207762 3300005437 Bacteria 1240
77 Ga0070710_10236095 3300005437 Bacteria 1169
78 Ga0070701_10075691 3300005438 Bacteria 1810
79 Ga0070711_100006116 3300005439 Bacteria 7237
80 Ga0070711_100226319 3300005439 Bacteria 1456
81 Ga0070708_100054749 3300005445 Bacteria 3545
82 Ga0070708_100076149 3300005445 Bacteria 3030
83 Ga0070708_100393362 3300005445 Unclassified 1307
84 Ga0070708_100591210 3300005445 Bacteria 1046
85 Ga0070708_100903773 3300005445 Bacteria 829
86 Ga0070678_100001511 3300005456 Bacteria 12415
87 Ga0070678_100013072 3300005456 Bacteria 5189
88 Ga0070678_100033505 3300005456 Unclassified 3567
89 Ga0070678_100043541 3300005456 Bacteria 3198
90 Ga0070678_100053192 3300005456 Bacteria 2943
91 Ga0070678_100223073 3300005456 Bacteria 1567
92 Ga0070678_100444107 3300005456 Bacteria 1135
93 Ga0070662_100008169 3300005457 Bacteria 6816
94 Ga0070662_100471626 3300005457 Bacteria 1044
95 Ga0068867_100000218 3300005459 Bacteria 37862
96 Ga0068867_100007340 3300005459 Bacteria 7800
97 Ga0068867_100044767 3300005459 Bacteria 3243
98 Ga0068867_100235448 3300005459 Bacteria 1482
99 Ga0070685_10099962 3300005466 Bacteria 1770
100 Ga0070706_100006435 3300005467 Bacteria 11091
101 Ga0070706_100146613 3300005467 Bacteria 2204
102 Ga0070706_100416544 3300005467 Bacteria 1250
103 Ga0070706_100624420 3300005467 Unclassified 1001
104 Ga0070706_100729309 3300005467 Bacteria 919
105 Ga0070707_100072311 3300005468 Bacteria 3323
106 Ga0070707_100159765 3300005468 Bacteria 2196
107 Ga0070707_100411612 3300005468 Unclassified 1312
108 Ga0070698_100001910 3300005471 Bacteria 23223
109 Ga0070698_100007384 3300005471 Bacteria 11891
110 Ga0070699_100030476 3300005518 Bacteria 4657
111 Ga0070699_100036501 3300005518 Bacteria 4251
112 Ga0070699_100051877 3300005518 Unclassified 3551
113 Ga0070699_100093749 3300005518 Bacteria 2627
114 Ga0070699_100643205 3300005518 Bacteria 968
115 Ga0070697_100004958 3300005536 Bacteria 10219
116 Ga0070697_100005694 3300005536 Bacteria 9598
117 Ga0070697_100025782 3300005536 Bacteria 4689
118 Ga0070697_100031906 3300005536 Bacteria 4239
119 Ga0070697_100141887 3300005536 Bacteria 2021
120 Ga0070697_100611835 3300005536 Unclassified 958
121 Ga0070672_100004247 3300005543 Bacteria 9368
122 Ga0070672_100041736 3300005543 Bacteria 3529
123 Ga0070672_100182796 3300005543 Bacteria 1748
124 Ga0070672_100202353 3300005543 Bacteria 1661
125 Ga0070695_100561239 3300005545 Bacteria 891
126 Ga0070665_100000045 3300005548 Bacteria 275023
127 Ga0070665_100008787 3300005548 Bacteria 10223
128 Ga0070665_100114878 3300005548 Bacteria 2694
129 Ga0070665_100476535 3300005548 Bacteria 1259
130 Ga0070665_100673722 3300005548 Bacteria 1047
131 Ga0070665_100853228 3300005548 Bacteria 924
132 Ga0070704_100083567 3300005549 Bacteria 2357
133 Ga0068855_100597968 3300005563 Bacteria 1190
134 Ga0068855_100851325 3300005563 Bacteria 966
135 Ga0070664_100000199 3300005564 Bacteria 42634
136 Ga0070664_100360619 3300005564 Bacteria 1324
137 Ga0068857_100221076 3300005577 Bacteria 1730
138 Ga0068856_100004352 3300005614 Bacteria 14113
139 Ga0068856_100017528 3300005614 Bacteria 6939
140 Ga0068859_101731931 3300005617 Bacteria 690
141 Ga0068866_10121420 3300005718 Bacteria 1473
142 Ga0068866_10623252 3300005718 Bacteria 731
143 Ga0068861_100390918 3300005719 Bacteria 1232
144 Ga0068863_100029029 3300005841 Bacteria 5284
145 Ga0068863_100054836 3300005841 Bacteria 3776
146 Ga0068858_100055768 3300005842 Bacteria 3653
147 Ga0068858_100134565 3300005842 Bacteria 2319
148 Ga0068858_100800210 3300005842 Bacteria 920
149 Ga0068860_100001380 3300005843 Bacteria 26358
150 Ga0068860_100672444 3300005843 Bacteria 1044
151 Ga0081538_10015344 3300005981 Bacteria 5937
152 Ga0081539_10000014 3300005985 Bacteria 411270
153 Ga0070717_10037326 3300006028 Bacteria 3945
154 Ga0070717_10195964 3300006028 Bacteria 1767
155 Ga0075363_100004668 3300006048 Bacteria 6026
156 Ga0075363_100128694 3300006048 Bacteria 1419
157 Ga0070715_10015930 3300006163 Bacteria 2813
158 Ga0070716_100031746 3300006173 Bacteria 2875
159 Ga0070716_100086652 3300006173 Bacteria 1884
160 Ga0070716_100677467 3300006173 Bacteria 785
161 Ga0070712_100093977 3300006175 Bacteria 2202
162 Ga0070712_100105455 3300006175 Unclassified 2093
163 Ga0070712_100996564 3300006175 Bacteria 725
164 Ga0075362_10004435 3300006177 Bacteria 5044
165 Ga0075366_10047853 3300006195 Bacteria 2535
166 Ga0097621_100024099 3300006237 Bacteria 4748
167 Ga0097621_100605107 3300006237 Bacteria 1002
168 Ga0097621_100827666 3300006237 Bacteria 859
169 Ga0075370_10306692 3300006353 Bacteria 945
170 Ga0068871_100005514 3300006358 Bacteria 8875
171 Ga0068871_100012344 3300006358 Bacteria 6294
172 Ga0068871_100084135 3300006358 Bacteria 2640
173 Ga0075433_10286694 3300006852 Unclassified 1458
174 Ga0075429_100583814 3300006880 Bacteria 979
175 Ga0068865_100000462 3300006881 Bacteria 22708
176 Ga0068865_100013318 3300006881 Bacteria 5196
177 Ga0097620_101732031 3300006931 Bacteria 690
178 Ga0075435_100470464 3300007076 Bacteria 1085
179 Ga0099795_10326251 3300007788 Unclassified 681
180 Ga0105240_10007047 3300009093 Bacteria 16398
181 Ga0111539_10048674 3300009094 Bacteria 5060
182 Ga0111539_10387272 3300009094 Bacteria 1628
183 Ga0105245_10015121 3300009098 Bacteria 6722
184 Ga0105245_10158539 3300009098 Bacteria 2146
185 Ga0105245_10823160 3300009098 Bacteria 967
186 Ga0105243_10000049 3300009148 Bacteria 145575
187 Ga0105242_10451840 3300009176 Bacteria 1211
188 Ga0105248_10312261 3300009177 Bacteria 1770
189 Ga0105237_10009019 3300009545 Bacteria 10721
190 Ga0105237_10044182 3300009545 Bacteria 4486
191 Ga0105237_10385391 3300009545 Bacteria 1407
192 Ga0099796_10040234 3300010159 Bacteria 1577
193 Ga0105239_10048890 3300010375 Bacteria 4637
194 Ga0157373_10004932 3300013100 Bacteria 10042
195 Ga0157371_10058341 3300013102 Bacteria 2738
196 Ga0157371_10247936 3300013102 Bacteria 1282
197 Ga0157374_10000026 3300013296 Bacteria 238236
198 Ga0157374_10001473 3300013296 Bacteria 19879
199 Ga0157374_10017996 3300013296 Bacteria 6230
200 Ga0157374_10055882 3300013296 Bacteria 3685
201 Ga0157374_10121480 3300013296 Bacteria 2521
202 Ga0157374_10127435 3300013296 Bacteria 2461
203 Ga0157374_10498498 3300013296 Bacteria 1222
204 Ga0157374_10569942 3300013296 Bacteria 1141
205 Ga0157374_11100808 3300013296 Bacteria 815
206 Ga0157374_11130585 3300013296 Bacteria 804
207 Ga0157374_11937884 3300013296 Bacteria 615
208 Ga0157378_10001234 3300013297 Bacteria 23136
209 Ga0157378_10005509 3300013297 Bacteria 11097
210 Ga0157378_10026553 3300013297 Bacteria 5104
211 Ga0157378_10043528 3300013297 Bacteria 3987
212 Ga0157378_10058061 3300013297 Bacteria 3451
213 Ga0157378_10107467 3300013297 Bacteria 2553
214 Ga0157378_10119918 3300013297 Bacteria 2423
215 Ga0157378_10174062 3300013297 Unclassified 2021
216 Ga0163162_10017445 3300013306 Bacteria 7024
217 Ga0163162_10023520 3300013306 Bacteria 6081
218 Ga0163162_10052794 3300013306 Bacteria 4083
219 Ga0163162_10370423 3300013306 Bacteria 1565
220 Ga0163162_10410273 3300013306 Bacteria 1487
221 Ga0157372_10167743 3300013307 Bacteria 2539
222 Ga0157372_10360562 3300013307 Bacteria 1694
223 Ga0157372_10631782 3300013307 Bacteria 1247
224 Ga0157372_11295485 3300013307 Bacteria 841
225 Ga0157375_10001868 3300013308 Bacteria 18135
226 Ga0157375_10044228 3300013308 Bacteria 4324
227 Ga0157375_10082239 3300013308 Bacteria 3261
228 Ga0157375_10144146 3300013308 Bacteria 2511
229 Ga0157375_10198646 3300013308 Bacteria 2161
230 Ga0157375_10668197 3300013308 Bacteria 1194
231 Ga0157377_10033289 3300014745 Bacteria 2813
232 Ga0157376_10000112 3300014969 Bacteria 58430
233 Ga0157376_10031061 3300014969 Bacteria 4273
234 Ga0157376_10102835 3300014969 Bacteria 2500
235 Ga0157376_10390349 3300014969 Bacteria 1343
236 Ga0157376_11254406 3300014969 Bacteria 770
237 Ga0163161_10042654 3300017792 Bacteria 3264
238 Ga0163161_10245059 3300017792 Bacteria 1395
239 Ga0206355_1200566 3300020076 Bacteria 843
240 Ga0213873_10016590 3300021358 Bacteria 1667
241 Ga0213873_10030819 3300021358 Bacteria 1330
242 Ga0213872_10010006 3300021361 Bacteria 4525
243 Ga0213872_10158708 3300021361 Bacteria 985
244 Ga0213874_10001478 3300021377 Bacteria 4877
245 Ga0213876_10000361 3300021384 Bacteria 38897
246 Ga0213876_10073114 3300021384 Bacteria 1810
247 Ga0213876_10483064 3300021384 Bacteria 659
248 Ga0213875_10079664 3300021388 Bacteria 1528
249 Ga0213871_10012351 3300021441 Bacteria 1982
250 Ga0209050_1000629 3300025298 Bacteria 54939
251 Ga0207697_10000131 3300025315 Bacteria 36154
252 Ga0207697_10002322 3300025315 Bacteria 9909
253 Ga0207697_10031631 3300025315 Bacteria 2165
254 Ga0207642_10062069 3300025899 Bacteria 1741
255 Ga0207642_10063829 3300025899 Bacteria 1724
256 Ga0207688_10001208 3300025901 Bacteria 13377
257 Ga0207688_10042403 3300025901 Bacteria 2533
258 Ga0207680_10104042 3300025903 Bacteria 1829
259 Ga0207680_10150458 3300025903 Bacteria 1551
260 Ga0207680_10205844 3300025903 Bacteria 1343
261 Ga0207685_10139437 3300025905 Unclassified 1086
262 Ga0207685_10171988 3300025905 Bacteria 997
263 Ga0207699_10181274 3300025906 Bacteria 1416
264 Ga0207645_10001641 3300025907 Bacteria 18232
265 Ga0207645_10002762 3300025907 Bacteria 13659
266 Ga0207705_10033535 3300025909 Bacteria 3669
267 Ga0207684_10019695 3300025910 Bacteria 5771
268 Ga0207684_10048446 3300025910 Bacteria 3604
269 Ga0207684_10151385 3300025910 Bacteria 1996
270 Ga0207684_10252293 3300025910 Bacteria 1522
271 Ga0207695_10002221 3300025913 Bacteria 29193
272 Ga0207695_10008540 3300025913 Bacteria 12801
273 Ga0207671_10020842 3300025914 Bacteria 4985
274 Ga0207671_10025222 3300025914 Bacteria 4465
275 Ga0207693_10000889 3300025915 Bacteria 26818
276 Ga0207693_10092069 3300025915 Bacteria 2376
277 Ga0207693_10389591 3300025915 Bacteria 1090
278 Ga0207663_10005429 3300025916 Bacteria 6420
279 Ga0207663_10396750 3300025916 Bacteria 1054
280 Ga0207662_10432993 3300025918 Bacteria 897
281 Ga0207657_10066683 3300025919 Bacteria 3063
282 Ga0207657_10073181 3300025919 Bacteria 2897
283 Ga0207649_10007825 3300025920 Bacteria 5815
284 Ga0207649_10150356 3300025920 Bacteria 1603
285 Ga0207646_10005692 3300025922 Bacteria 13070
286 Ga0207646_10084385 3300025922 Bacteria 2842
287 Ga0207646_10137954 3300025922 Bacteria 2196
288 Ga0207681_10014902 3300025923 Bacteria 4842
289 Ga0207681_10072736 3300025923 Bacteria 2402
290 Ga0207681_10175206 3300025923 Unclassified 1629
291 Ga0207650_10006836 3300025925 Bacteria 7782
292 Ga0207650_10018287 3300025925 Bacteria 4917
293 Ga0207659_10020696 3300025926 Bacteria 4353
294 Ga0207659_10045484 3300025926 Bacteria 3095
295 Ga0207659_10179827 3300025926 Bacteria 1675
296 Ga0207659_10419064 3300025926 Bacteria 1123
297 Ga0207659_10469124 3300025926 Bacteria 1062
298 Ga0207659_10682627 3300025926 Bacteria 879
299 Ga0207687_10051760 3300025927 Bacteria 2863
300 Ga0207700_10318513 3300025928 Bacteria 1347
301 Ga0207664_10120019 3300025929 Bacteria 2199
302 Ga0207644_10035251 3300025931 Bacteria 3504
303 Ga0207644_10049869 3300025931 Bacteria 2998
304 Ga0207644_10237270 3300025931 Bacteria 1451
305 Ga0207644_10266435 3300025931 Bacteria 1371
306 Ga0207690_10023803 3300025932 Bacteria 3828
307 Ga0207690_10086786 3300025932 Unclassified 2200
308 Ga0207706_10027339 3300025933 Bacteria 5102
309 Ga0207709_10000097 3300025935 Bacteria 136507
310 Ga0207669_10002532 3300025937 Bacteria 7802
311 Ga0207669_10073225 3300025937 Bacteria 2160
312 Ga0207704_10040566 3300025938 Bacteria 2722
313 Ga0207665_10025655 3300025939 Bacteria 3889
314 Ga0207665_10140744 3300025939 Bacteria 1720
315 Ga0207665_10180266 3300025939 Bacteria 1529
316 Ga0207691_10000247 3300025940 Bacteria 53502
317 Ga0207691_10016028 3300025940 Bacteria 7119
318 Ga0207691_10228367 3300025940 Bacteria 1612
319 Ga0207691_10235331 3300025940 Bacteria 1585
320 Ga0207711_10232457 3300025941 Bacteria 1689
321 Ga0207661_10077884 3300025944 Bacteria 2728
322 Ga0207679_10000541 3300025945 Bacteria 25439
323 Ga0207679_10279684 3300025945 Bacteria 1431
324 Ga0207679_10374795 3300025945 Bacteria 1246
325 Ga0207667_10766901 3300025949 Bacteria 963
326 Ga0207651_10007253 3300025960 Bacteria 5894
327 Ga0207651_10019560 3300025960 Bacteria 4061
328 Ga0207651_10027669 3300025960 Bacteria 3565
329 Ga0207651_10634914 3300025960 Bacteria 936
330 Ga0207668_10035962 3300025972 Bacteria 3303
331 Ga0207668_10057405 3300025972 Bacteria 2715
332 Ga0207668_10156576 3300025972 Bacteria 1770
333 Ga0207668_10203825 3300025972 Bacteria 1577
334 Ga0207668_10629956 3300025972 Bacteria 937
335 Ga0207668_10931305 3300025972 Bacteria 774
336 Ga0207668_10957154 3300025972 Bacteria 764
337 Ga0207658_10302012 3300025986 Bacteria 1379
338 Ga0207677_10008042 3300026023 Bacteria 5871
339 Ga0207677_10021108 3300026023 Bacteria 3973
340 Ga0207677_10021545 3300026023 Bacteria 3940
341 Ga0207677_10111866 3300026023 Bacteria 2035
342 Ga0207677_10252081 3300026023 Bacteria 1434
343 Ga0207703_10024292 3300026035 Bacteria 4768
344 Ga0207703_10175845 3300026035 Bacteria 1886
345 Ga0207639_10621551 3300026041 Bacteria 997
346 Ga0207702_10003580 3300026078 Bacteria 14118
347 Ga0207702_10038562 3300026078 Bacteria 4001
348 Ga0207641_10005226 3300026088 Bacteria 11107
349 Ga0207641_10452994 3300026088 Bacteria 1240
350 Ga0207641_10626592 3300026088 Bacteria 1055
351 Ga0207648_10000083 3300026089 Bacteria 89416
352 Ga0207648_10237363 3300026089 Bacteria 1623
353 Ga0207674_10107042 3300026116 Bacteria 2773
354 Ga0207675_100323714 3300026118 Bacteria 1506
355 Ga0207683_10006308 3300026121 Bacteria 10158
356 Ga0207683_10006977 3300026121 Bacteria 9683
357 Ga0207683_10008842 3300026121 Bacteria 8591
358 Ga0207683_10015583 3300026121 Bacteria 6470
359 Ga0207698_10222182 3300026142 Bacteria 1708
360 Ga0207698_10283620 3300026142 Bacteria 1533
361 Ga0207698_10923389 3300026142 Bacteria 881
362 Ga0209974_10022093 3300027876 Bacteria 2107
363 Ga0207428_10514354 3300027907 Bacteria 868
364 Ga0268266_10000251 3300028379 Bacteria 91204
365 Ga0268266_10097330 3300028379 Bacteria 2588
366 Ga0268266_10238441 3300028379 Bacteria 1677
367 Ga0268266_10325400 3300028379 Bacteria 1440
368 Ga0268266_10501180 3300028379 Bacteria 1159
369 Ga0268266_11148552 3300028379 Bacteria 751
370 Ga0268265_10116094 3300028380 Bacteria 2196
371 Ga0268264_10001807 3300028381 Bacteria 19555
372 Ga0268264_10149965 3300028381 Bacteria 2089
373 Ga0268264_10473591 3300028381 Bacteria 1217
374 Ga0265318_10001452 3300028577 Bacteria 13930
375 Ga0307511_10000117 3300030521 Bacteria 71587
376 Ga0307512_10104901 3300030522 Bacteria 1894
377 Ga0265328_10052198 3300031239 Bacteria 1501
378 Ga0265320_10013095 3300031240 Bacteria 4785
379 Ga0265327_10011153 3300031251 Bacteria 6230
380 Ga0265316_10186665 3300031344 Bacteria 1542
381 Ga0307408_100000009 3300031548 Bacteria 426576
382 Ga0307408_100000021 3300031548 Bacteria 312158
383 Ga0307408_100414755 3300031548 Bacteria 1159
384 Ga0265313_10004186 3300031595 Bacteria 11195
385 Ga0307413_10364847 3300031824 Bacteria 1119
386 Ga0307410_10000097 3300031852 Bacteria 30229
387 Ga0307407_10000468 3300031903 Bacteria 12384
388 Ga0307409_100000037 3300031995 Bacteria 47029
389 Ga0307416_100000018 3300032002 Bacteria 200227
390 Ga0307411_10054437 3300032005 Bacteria 2627
391 Ga0316593_10000659 3300032168 Bacteria 6648
392 Ga0373944_0080838 3300035089 Bacteria 1073
393 Ga0373945_0053651 3300035116 Bacteria 1489
394 Ga0373945_0059303 3300035116 Unclassified 1425
395 Ga0373945_0232692 3300035116 Bacteria 774
396 Ga0373957_0405744 3300035120 Bacteria 587
397 Ga0373943_0005531 3300035170 Bacteria 5673
398 Ga0373943_0092490 3300035170 Bacteria 1568
399 Ga0373946_0078616 3300035171 Bacteria 1440
400 Ga0373946_0096119 3300035171 Unclassified 1321
401 Ga0373955_0008379 3300035172 Bacteria 4800
402 Ga0316574_0010564 3300035398 Bacteria 5224
403 Ga0373931_0036970 3300035691 Bacteria 2548
404 Ga0373935_0067275 3300035692 Bacteria 2303
405 Ga0373927_0200535 3300035695 Bacteria 1310
406 Ga0373927_0608304 3300035695 Bacteria 722
407 Ga0373933_0052084 3300035724 Bacteria 2448
408 Ga0373933_0108221 3300035724 Bacteria 1731
409 Ga0373947_0015443 3300035725 Bacteria 4383
410 Ga0373947_0159967 3300035725 Unclassified 1456
411 Ga0373947_0173463 3300035725 Bacteria 1400
412 Ga0373937_0282498 3300036401 Bacteria 1567
413 Ga0373937_0331794 3300036401 Unclassified 1440
414 Ga0373937_0824342 3300036401 Unclassified 876
415 Ga0373925_0014401 3300037068 Bacteria 5718
416 Ga0373925_0155902 3300037068 Bacteria 1796
417 Ga0373925_0501751 3300037068 Bacteria 996
418 Ga0395899_0000039 3300037312 Bacteria 269620
419 Ga0395900_0002526 3300037418 Bacteria 20035
420 Ga0395898_0000226 3300037466 Bacteria 144727
421 Ga0395898_0079141 3300037466 Bacteria 3171
422 Ga0436364_0070502 3300037853 Bacteria 2321
423 Ga0436364_0339363 3300037853 Bacteria 2525
424 Ga0436364_0785290 3300037853 Bacteria 2181
425 Ga0395901_0039538 3300038443 Bacteria 4881
426 Ga0436365_0798127 3300039437 Bacteria 1243
427 Ga0436365_1314581 3300039437 Bacteria 1388
428 Ga0436365_1383407 3300039437 Bacteria 77328
429 Ga0436360_0051782 3300039438 Bacteria 1147
430 Ga0436360_0111982 3300039438 Bacteria 10219
431 Ga0436360_0751309 3300039438 Bacteria 1931
432 Ga0436360_0817873 3300039438 Bacteria 4105
433 Ga0436360_0823493 3300039438 Unclassified 2742
434 Ga0436361_0088096 3300039447 Bacteria 12647
435 Ga0436361_0096493 3300039447 Unclassified 782
436 Ga0436361_0363848 3300039447 Bacteria 21994
437 Ga0436361_0382718 3300039447 Bacteria 2021
438 Ga0436361_0960224 3300039447 Bacteria 2589
439 Ga0436361_1103431 3300039447 Bacteria 1468
440 Ga0436363_0072645 3300039450 Bacteria 6996
441 Ga0436362_0931802 3300039453 Unclassified 3056
442 Ga0436362_1110217 3300039453 Unclassified 1534
443 Ga0439453_0000086 3300041408 Bacteria 7091
444 Ga0451807_0122896 3300041486 Bacteria 635
445 Ga0451853_3388316 3300041512 Bacteria 732
446 Ga0450888_001605 3300042126 Bacteria 2179
447 Ga0450890_000001 3300042127 Bacteria 192635
448 Ga0450891_002487 3300042129 Bacteria 1853
449 Ga0450893_0005197 3300042532 Bacteria 2083
450 Ga0451577_0186388 3300042876 Bacteria 1871
451 Ga0453683_0004775 3300044673 Bacteria 9552
452 Ga0466965_0058570 3300044683 Bacteria 1921
453 Ga0453684_0000516 3300044712 Bacteria 147788
454 Ga0453684_0109566 3300044712 Bacteria 3358
455 Ga0466971_0000005 3300044719 Bacteria 137073
456 Ga0466957_0069306 3300044842 Bacteria 2178
457 Ga0451576_0024674 3300045051 Bacteria 6490
458 Ga0451576_0027216 3300045051 Bacteria 6143
459 Ga0466967_0088574 3300045976 Bacteria 2809
460 Ga0495592_0102898 3300046454 Bacteria 2033
461 Ga0495651_0162026 3300046462 Bacteria 1601
462 Ga0495580_0109086 3300046472 Bacteria 1922
463 Ga0495605_0063477 3300046474 Bacteria 1762
464 Ga0495584_0022505 3300046491 Bacteria 3197
465 Ga0495585_0065325 3300046492 Bacteria 1994
466 Ga0495608_0095489 3300046511 Bacteria 1921
467 Ga0495618_0068826 3300046514 Bacteria 2251
468 Ga0495628_0040395 3300046516 Bacteria 3728
469 Ga0495630_0017678 3300046517 Bacteria 5227
470 Ga0495663_0019332 3300046525 Bacteria 1949
471 Ga0495642_0022869 3300046528 Bacteria 2465
472 Ga0495652_0018013 3300046529 Bacteria 6301
473 Ga0495598_0000901 3300046537 Bacteria 5725
474 Ga0495598_0043361 3300046537 Unclassified 1325
475 Ga0495645_0063981 3300046543 Bacteria 2662
476 Ga0495633_0056070 3300046558 Unclassified 1852
477 Ga0495656_0049027 3300046615 Bacteria 1797
478 Ga0495634_0048412 3300046642 Bacteria 2862
479 Ga0495661_0193660 3300046665 Unclassified 1069
480 Ga0495599_0142934 3300046678 Bacteria 1484
481 Ga0495658_0011003 3300046683 Bacteria 4538
482 Ga0495669_0009247 3300046684 Bacteria 4152
483 Ga0495670_0082094 3300046691 Bacteria 1643
484 Ga0495649_0204851 3300046694 Bacteria 1024
485 Ga0495581_0106207 3300047315 Bacteria 1632
486 Ga0495674_0415532 3300047319 Bacteria 1084
487 Ga0495675_0002584 3300047444 Bacteria 10850
488 Ga0495677_0064905 3300047445 Unclassified 1357
489 Ga0495684_0164535 3300047471 Unclassified 1653
490 Ga0495602_0309980 3300048088 Bacteria 1152
491 Ga0496100_0021201 3300048903 Bacteria 3910
492 Ga0496100_0356210 3300048903 Bacteria 1106
493 Ga0496101_0031362 3300048904 Bacteria 3735
494 Ga0496102_0009851 3300048905 Bacteria 8216
495 Ga0496102_0251367 3300048905 Unclassified 1667
496 Ga0496103_0011535 3300048906 Bacteria 5238
497 Ga0496104_0014963 3300048907 Bacteria 7017
498 Ga0496104_0356276 3300048907 Bacteria 1376
499 Ga0496106_0002174 3300048909 Bacteria 14655
500 Ga0496106_0264949 3300048909 Bacteria 1375
501 Ga0496106_0292110 3300048909 Bacteria 1307
502 Ga0496107_0018540 3300048910 Bacteria 4901
503 Ga0496107_0286116 3300048910 Bacteria 1227
504 Ga0496108_0042309 3300048911 Bacteria 3803
505 Ga0496109_0040844 3300048912 Bacteria 4202
506 Ga0496109_0241538 3300048912 Unclassified 1700
507 Ga0496109_0287838 3300048912 Bacteria 1549
508 Ga0496109_0327535 3300048912 Unclassified 1446
509 Ga0496110_0132415 3300048913 Bacteria 2252
510 Ga0496110_0330391 3300048913 Bacteria 1389
511 Ga0496111_0102523 3300048914 Bacteria 2104
512 Ga0496112_0017121 3300048915 Bacteria 6804
513 Ga0496112_0046152 3300048915 Bacteria 4272
514 Ga0496112_0050307 3300048915 Bacteria 4086
515 Ga0496112_0161160 3300048915 Bacteria 2210
516 Ga0496112_0273283 3300048915 Unclassified 1638
517 Ga0496113_0188201 3300048916 Bacteria 1638
518 Ga0496113_0476967 3300048916 Unclassified 1002
519 Ga0496113_0528149 3300048916 Bacteria 947
520 Ga0496114_0172612 3300048917 Bacteria 1885
521 Ga0496115_0009615 3300048918 Bacteria 7191
522 Ga0496121_0548309 3300048924 Bacteria 724
523 Ga0496124_0198492 3300048927 Bacteria 1528
524 Ga0496125_0000110 3300048928 Bacteria 192693
525 Ga0501308_002090 3300049128 Bacteria 1710
526 Ga0501310_000737 3300049130 Bacteria 2892
527 Ga0501304_000153 3300049160 Bacteria 2865
528 Ga0501305_000001 3300049161 Bacteria 19709
529 Ga0501305_015896 3300049161 Bacteria 1067
530 Ga0501307_000001 3300049162 Bacteria 10981
531 Ga0501312_000001 3300049528 Bacteria 18666
532 Ga0501316_006032 3300049532 Bacteria 1277
533 Ga0501317_004444 3300049533 Bacteria 1459
534 Ga0501320_001877 3300049536 Bacteria 1608
535 Ga0501031_0000635 3300049568 Bacteria 20764
536 Ga0501032_0000390 3300049569 Bacteria 36137
537 Ga0501032_0046887 3300049569 Bacteria 2920
538 Ga0501032_0244194 3300049569 Bacteria 1166
539 Ga0501033_0000003 3300049570 Bacteria 586973
540 Ga0501033_0000015 3300049570 Bacteria 218502
541 Ga0501033_0006719 3300049570 Bacteria 8988
542 Ga0501036_0013849 3300049572 Bacteria 6707
543 Ga0501037_0000295 3300049573 Bacteria 42165
544 Ga0501037_0011831 3300049573 Bacteria 6427
545 Ga0501038_0000480 3300049574 Bacteria 35161
546 Ga0501038_0073690 3300049574 Bacteria 2890
547 Ga0501038_0456810 3300049574 Bacteria 981
548 Ga0501039_0022279 3300049575 Bacteria 4863
549 Ga0501039_0284451 3300049575 Bacteria 1300
550 Ga0501041_0177330 3300049577 Bacteria 1334
551 Ga0501043_0069626 3300049579 Bacteria 2763
552 Ga0501043_0289131 3300049579 Bacteria 1255
553 Ga0501046_0005999 3300049580 Bacteria 10806
554 Ga0501047_0009121 3300049581 Bacteria 9369
555 Ga0501047_0042858 3300049581 Bacteria 4372
556 Ga0501047_0086476 3300049581 Bacteria 3012
557 Ga0501048_0015870 3300049582 Bacteria 5558
558 Ga0501070_0002360 3300049586 Bacteria 16550
559 Ga0501070_0033242 3300049586 Bacteria 4316
560 Ga0501070_0142209 3300049586 Bacteria 1981
561 Ga0501071_0074202 3300049587 Bacteria 2483
562 Ga0501080_0023861 3300049742 Bacteria 5668
563 Ga0501080_0345987 3300049742 Bacteria 1343
564 Ga0501083_0059867 3300049744 Bacteria 2546
565 Ga0501035_0000004 3300049822 Bacteria 403650
566 Ga0501035_0040870 3300049822 Bacteria 4189
567 Ga0501044_0000740 3300049823 Bacteria 39382
568 Ga0501045_0827532 3300049824 Bacteria 681
569 nmdc:mga03683_281_c1 3300050489 Bacteria 15224
570 nmdc:mga03683_93017_c1 3300050489 Bacteria 1317
571 nmdc:mga03n38_195087_c1 3300050490 Bacteria 1045
572 nmdc:mga03n38_86065_c1 3300050490 Bacteria 1487
573 nmdc:mga0k408_12560_c1 3300050493 Bacteria 4632
574 nmdc:mga0k408_1699_c1 3300050493 Bacteria 11859
575 nmdc:mga08y16_168750_c1 3300050511 Bacteria 2273
576 nmdc:mga08y16_94064_c1 3300050511 Bacteria 3122
577 nmdc:mga0rr50_168592_c1 3300050513 Bacteria 1782
578 nmdc:mga08x19_555035_c1 3300050514 Unclassified 813
579 nmdc:mga08x19_81630_c1 3300050514 Bacteria 2123
580 Ga0495601_0267157 3300053077 Bacteria 1116
581 Ga0495619_0109404 3300053085 Bacteria 1887
582 Ga0500555_000015 3300053103 Bacteria 230204
583 Ga0500555_000055 3300053103 Bacteria 58298
584 Ga0500556_0000420 3300053104 Bacteria 30531
585 Ga0500556_0002977 3300053104 Bacteria 5115
586 Ga0500642_0004954 3300053130 Bacteria 4237
587 Ga0500642_0123785 3300053130 Bacteria 1210
588 Ga0500658_0073733 3300053134 Bacteria 1446
589 Ga0500559_0000861 3300053136 Bacteria 19493
590 Ga0500616_0006731 3300053153 Bacteria 7458
591 Ga0500616_0006989 3300053153 Bacteria 7263
592 Ga0500645_012211 3300053730 Bacteria 2780
593 Ga0466962_0000007 3300061719 Bacteria 157857

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049162 Ga0501307_000001 Ga0501307_000001_9519_10127 162
2 3300049533 Ga0501317_004444 Ga0501317_004444_25_636 162
3 3300028577 Ga0265318_10001452 Ga0265318_1000145213 163
4 3300031240 Ga0265320_10013095 Ga0265320_100130954 163
5 3300049161 Ga0501305_015896 Ga0501305_015896_278_886 163
6 3300049570 Ga0501033_0006719 Ga0501033_0006719_2289_2906 163
7 3300049573 Ga0501037_0011831 Ga0501037_0011831_49_666 163
8 3300049574 Ga0501038_0456810 Ga0501038_0456810_303_920 163
9 3300049579 Ga0501043_0289131 Ga0501043_0289131_200_817 163
10 3300049580 Ga0501046_0005999 Ga0501046_0005999_3409_4026 163
11 3300049581 Ga0501047_0042858 Ga0501047_0042858_388_1005 163
12 3300049581 Ga0501047_0086476 Ga0501047_0086476_954_1571 163
13 3300049582 Ga0501048_0015870 Ga0501048_0015870_3816_4433 163
14 3300049586 Ga0501070_0033242 Ga0501070_0033242_2696_3313 163
15 3300049822 Ga0501035_0040870 Ga0501035_0040870_151_768 163
16 3300049128 Ga0501308_002090 Ga0501308_002090_822_1475 164
17 3300049160 Ga0501304_000153 Ga0501304_000153_112_765 164
18 3300049161 Ga0501305_000001 Ga0501305_000001_6853_7506 164
19 3300049528 Ga0501312_000001 Ga0501312_000001_12197_12850 164
20 3300005459 Ga0068867_100007340 Ga0068867_1000073403 165
21 3300006237 Ga0097621_100605107 Ga0097621_1006051072 165
22 3300006358 Ga0068871_100005514 Ga0068871_1000055147 165
23 3300006881 Ga0068865_100000462 Ga0068865_1000004623 165
24 3300030521 Ga0307511_10000117 Ga0307511_1000011742 165
25 3300049130 Ga0501310_000737 Ga0501310_000737_2148_2804 167
26 3300049536 Ga0501320_001877 Ga0501320_001877_822_1478 167
27 3300009093 Ga0105240_10007047 Ga0105240_100070478 169
28 3300025913 Ga0207695_10008540 Ga0207695_100085407 169
29 3300031595 Ga0265313_10004186 Ga0265313_1000418612 169
30 3300045051 Ga0451576_0027216 Ga0451576_0027216_230_877 169
31 3300013100 Ga0157373_10004932 Ga0157373_100049327 170
32 3300003320 rootH2_10050166 rootH2_1005016613 171
33 3300003322 rootL2_10139488 rootL2_101394882 171
34 3300005614 Ga0068856_100004352 Ga0068856_10000435224 171
35 3300013307 Ga0157372_10631782 Ga0157372_106317821 171
36 3300026078 Ga0207702_10003580 Ga0207702_1000358022 171
37 3300026142 Ga0207698_10923389 Ga0207698_109233891 171
38 3300031548 Ga0307408_100000009 Ga0307408_10000000984 171
39 3300031824 Ga0307413_10364847 Ga0307413_103648472 171
40 3300031852 Ga0307410_10000097 Ga0307410_1000009729 171
41 3300031995 Ga0307409_100000037 Ga0307409_1000000373 171
42 3300032002 Ga0307416_100000018 Ga0307416_100000018121 171
43 3300032005 Ga0307411_10054437 Ga0307411_100544373 171
44 3300041486 Ga0451807_0122896 Ga0451807_0122896_10_537 171
45 3300049574 Ga0501038_0000480 Ga0501038_0000480_3628_4212 171
46 3300049586 Ga0501070_0142209 Ga0501070_0142209_50_652 171
47 3300005518 Ga0070699_100093749 Ga0070699_1000937493 172
48 3300014969 Ga0157376_11254406 Ga0157376_112544061 172
49 3300020076 Ga0206355_1200566 Ga0206355_12005662 172
50 3300026088 Ga0207641_10452994 Ga0207641_104529942 172
51 3300031239 Ga0265328_10052198 Ga0265328_100521982 172
52 3300031548 Ga0307408_100414755 Ga0307408_1004147552 172
53 3300032168 Ga0316593_10000659 Ga0316593_1000065910 172
54 3300044712 Ga0453684_0000516 Ga0453684_0000516_23305_23880 172
55 3300005445 Ga0070708_100076149 Ga0070708_1000761496 173
56 3300005471 Ga0070698_100001910 Ga0070698_10000191021 173
57 3300005518 Ga0070699_100030476 Ga0070699_1000304766 173
58 3300005536 Ga0070697_100004958 Ga0070697_1000049585 173
59 3300005563 Ga0068855_100597968 Ga0068855_1005979683 173
60 3300005842 Ga0068858_100800210 Ga0068858_1008002102 173
61 3300006028 Ga0070717_10195964 Ga0070717_101959644 173
62 3300006048 Ga0075363_100004668 Ga0075363_1000046684 173
63 3300006177 Ga0075362_10004435 Ga0075362_100044352 173
64 3300009545 Ga0105237_10009019 Ga0105237_1000901912 173
65 3300013296 Ga0157374_10569942 Ga0157374_105699422 173
66 3300021358 Ga0213873_10016590 Ga0213873_100165903 173
67 3300021361 Ga0213872_10010006 Ga0213872_100100063 173
68 3300021361 Ga0213872_10158708 Ga0213872_101587082 173
69 3300021377 Ga0213874_10001478 Ga0213874_100014783 173
70 3300021384 Ga0213876_10000361 Ga0213876_100003618 173
71 3300021441 Ga0213871_10012351 Ga0213871_100123512 173
72 3300025903 Ga0207680_10150458 Ga0207680_101504583 173
73 3300025910 Ga0207684_10151385 Ga0207684_101513853 173
74 3300025914 Ga0207671_10020842 Ga0207671_100208422 173
75 3300025919 Ga0207657_10066683 Ga0207657_100666833 173
76 3300025922 Ga0207646_10084385 Ga0207646_100843851 173
77 3300037853 Ga0436364_0070502 Ga0436364_0070502_1230_1754 173
78 3300039437 Ga0436365_1383407 Ga0436365_1383407_24673_25197 173
79 3300039438 Ga0436360_0111982 Ga0436360_0111982_3062_3586 173
80 3300039438 Ga0436360_0751309 Ga0436360_0751309_1166_1690 173
81 3300039438 Ga0436360_0817873 Ga0436360_0817873_240_764 173
82 3300039438 Ga0436360_0823493 Ga0436360_0823493_1427_1951 173
83 3300039447 Ga0436361_0088096 Ga0436361_0088096_5727_6251 173
84 3300039447 Ga0436361_0096493 Ga0436361_0096493_15_539 173
85 3300039447 Ga0436361_0960224 Ga0436361_0960224_153_677 173
86 3300039447 Ga0436361_1103431 Ga0436361_1103431_154_678 173
87 3300039450 Ga0436363_0072645 Ga0436363_0072645_4831_5355 173
88 3300039453 Ga0436362_1110217 Ga0436362_1110217_733_1257 173
89 3300041512 Ga0451853_3388316 Ga0451853_3388316_196_720 173
90 3300044673 Ga0453683_0004775 Ga0453683_0004775_1965_2603 173
91 3300044712 Ga0453684_0109566 Ga0453684_0109566_1111_1749 173
92 3300045051 Ga0451576_0024674 Ga0451576_0024674_2117_2755 173
93 3300048924 Ga0496121_0548309 Ga0496121_0548309_62_613 173
94 3300049569 Ga0501032_0000390 Ga0501032_0000390_3584_4174 173
95 3300049570 Ga0501033_0000003 Ga0501033_0000003_165942_166532 173
96 3300049744 Ga0501083_0059867 Ga0501083_0059867_398_1063 173
97 3300050489 nmdc:mga03683_281_c1 nmdc:mga03683_281_c1_7440_7964 173
98 3300050490 nmdc:mga03n38_86065_c1 nmdc:mga03n38_86065_c1_217_741 173
99 3300050493 nmdc:mga0k408_12560_c1 nmdc:mga0k408_12560_c1_1114_1638 173
100 3300050493 nmdc:mga0k408_1699_c1 nmdc:mga0k408_1699_c1_1787_2311 173
101 3300053103 Ga0500555_000055 Ga0500555_000055_51743_52267 173
102 3300053104 Ga0500556_0000420 Ga0500556_0000420_2415_2939 173
103 3300053130 Ga0500642_0004954 Ga0500642_0004954_770_1294 173
104 3300053130 Ga0500642_0123785 Ga0500642_0123785_560_1141 173
105 3300053134 Ga0500658_0073733 Ga0500658_0073733_736_1260 173
106 3300002155 JGI24033J26618_1000142 JGI24033J26618_100014211 174
107 3300003322 rootL2_10030599 rootL2_100305993 174
108 3300005344 Ga0070661_100000386 Ga0070661_10000038633 174
109 3300005356 Ga0070674_100034793 Ga0070674_1000347933 174
110 3300005456 Ga0070678_100013072 Ga0070678_1000130724 174
111 3300006237 Ga0097621_100827666 Ga0097621_1008276662 174
112 3300006358 Ga0068871_100012344 Ga0068871_1000123446 174
113 3300013296 Ga0157374_10000026 Ga0157374_10000026122 174
114 3300013296 Ga0157374_10017996 Ga0157374_100179967 174
115 3300013297 Ga0157378_10001234 Ga0157378_1000123419 174
116 3300013308 Ga0157375_10198646 Ga0157375_101986463 174
117 3300014969 Ga0157376_10000112 Ga0157376_1000011242 174
118 3300021358 Ga0213873_10030819 Ga0213873_100308192 174
119 3300021388 Ga0213875_10079664 Ga0213875_100796643 174
120 3300025920 Ga0207649_10007825 Ga0207649_100078252 174
121 3300025932 Ga0207690_10023803 Ga0207690_100238038 174
122 3300026121 Ga0207683_10006308 Ga0207683_100063089 174
123 3300031548 Ga0307408_100000021 Ga0307408_100000021141 174
124 3300031903 Ga0307407_10000468 Ga0307407_100004688 174
125 3300037853 Ga0436364_0339363 Ga0436364_0339363_178_705 174
126 3300037853 Ga0436364_0785290 Ga0436364_0785290_359_886 174
127 3300039438 Ga0436360_0051782 Ga0436360_0051782_28_555 174
128 3300039447 Ga0436361_0363848 Ga0436361_0363848_12958_13485 174
129 3300039447 Ga0436361_0382718 Ga0436361_0382718_456_983 174
130 3300039453 Ga0436362_0931802 Ga0436362_0931802_2185_2712 174
131 3300041408 Ga0439453_0000086 Ga0439453_0000086_1835_2533 174
132 3300042126 Ga0450888_001605 Ga0450888_001605_774_1472 174
133 3300042127 Ga0450890_000001 Ga0450890_000001_72431_73129 174
134 3300042129 Ga0450891_002487 Ga0450891_002487_86_784 174
135 3300042532 Ga0450893_0005197 Ga0450893_0005197_1004_1702 174
136 3300049575 Ga0501039_0284451 Ga0501039_0284451_550_1224 174
137 3300049577 Ga0501041_0177330 Ga0501041_0177330_435_1109 174
138 3300002077 JGI24744J21845_10011528 JGI24744J21845_100115282 175
139 3300005327 Ga0070658_10018594 Ga0070658_100185942 175
140 3300005564 Ga0070664_100360619 Ga0070664_1003606193 175
141 3300005842 Ga0068858_100055768 Ga0068858_1000557683 175
142 3300025909 Ga0207705_10033535 Ga0207705_100335352 175
143 3300025945 Ga0207679_10374795 Ga0207679_103747952 175
144 3300026035 Ga0207703_10024292 Ga0207703_100242924 175
145 3300037312 Ga0395899_0000039 Ga0395899_0000039_170547_171146 175
146 3300048927 Ga0496124_0198492 Ga0496124_0198492_442_987 175
147 3300048928 Ga0496125_0000110 Ga0496125_0000110_36027_36572 175
148 3300053136 Ga0500559_0000861 Ga0500559_0000861_6768_7424 175
149 3300053153 Ga0500616_0006731 Ga0500616_0006731_5223_5759 175
150 3300005331 Ga0070670_100205578 Ga0070670_1002055781 176
151 3300005331 Ga0070670_100359756 Ga0070670_1003597563 176
152 3300005344 Ga0070661_100288697 Ga0070661_1002886973 176
153 3300005456 Ga0070678_100223073 Ga0070678_1002230733 176
154 3300005548 Ga0070665_100673722 Ga0070665_1006737222 176
155 3300006353 Ga0075370_10306692 Ga0075370_103066921 176
156 3300009545 Ga0105237_10044182 Ga0105237_100441824 176
157 3300021384 Ga0213876_10073114 Ga0213876_100731143 176
158 3300025914 Ga0207671_10025222 Ga0207671_100252223 176
159 3300025926 Ga0207659_10419064 Ga0207659_104190642 176
160 3300025931 Ga0207644_10237270 Ga0207644_102372702 176
161 3300037466 Ga0395898_0000226 Ga0395898_0000226_97130_97729 176
162 3300039437 Ga0436365_0798127 Ga0436365_0798127_307_942 176
163 3300039437 Ga0436365_1314581 Ga0436365_1314581_349_984 176
164 3300003203 JGI25406J46586_10000001 JGI25406J46586_10000001201 177
165 3300003203 JGI25406J46586_10000007 JGI25406J46586_1000000773 177
166 3300003323 rootH1_10007007 rootH1_100070072 177
167 3300005617 Ga0068859_101731931 Ga0068859_1017319311 177
168 3300005985 Ga0081539_10000014 Ga0081539_10000014307 177
169 3300006931 Ga0097620_101732031 Ga0097620_1017320311 177
170 3300025972 Ga0207668_10957154 Ga0207668_109571542 177
171 3300028379 Ga0268266_11148552 Ga0268266_111485522 177
172 3300030522 Ga0307512_10104901 Ga0307512_101049013 177
173 3300035724 Ga0373933_0108221 Ga0373933_0108221_725_1267 177
174 3300036401 Ga0373937_0331794 Ga0373937_0331794_222_773 177
175 3300044683 Ga0466965_0058570 Ga0466965_0058570_1004_1597 177
176 3300044719 Ga0466971_0000005 Ga0466971_0000005_56592_57185 177
177 3300044842 Ga0466957_0069306 Ga0466957_0069306_207_800 177
178 3300045976 Ga0466967_0088574 Ga0466967_0088574_1259_1852 177
179 3300053104 Ga0500556_0002977 Ga0500556_0002977_252_791 177
180 3300053730 Ga0500645_012211 Ga0500645_012211_532_1281 177
181 3300061719 Ga0466962_0000007 Ga0466962_0000007_143365_143958 177
182 iso_pu_bacteria 2786546548 2787506692 177
183 3300005328 Ga0070676_10305976 Ga0070676_103059762 178
184 3300005334 Ga0068869_100697020 Ga0068869_1006970201 178
185 3300005344 Ga0070661_100097194 Ga0070661_1000971944 178
186 3300005459 Ga0068867_100000218 Ga0068867_10000021821 178
187 3300005548 Ga0070665_100000045 Ga0070665_10000004549 178
188 3300005564 Ga0070664_100000199 Ga0070664_10000019950 178
189 3300005577 Ga0068857_100221076 Ga0068857_1002210763 178
190 3300005841 Ga0068863_100054836 Ga0068863_1000548363 178
191 3300009098 Ga0105245_10015121 Ga0105245_1001512110 178
192 3300009148 Ga0105243_10000049 Ga0105243_10000049134 178
193 3300013102 Ga0157371_10247936 Ga0157371_102479362 178
194 3300014745 Ga0157377_10033289 Ga0157377_100332893 178
195 3300025927 Ga0207687_10051760 Ga0207687_100517602 178
196 3300025935 Ga0207709_10000097 Ga0207709_1000009720 178
197 3300025945 Ga0207679_10000541 Ga0207679_1000054124 178
198 3300026023 Ga0207677_10252081 Ga0207677_102520812 178
199 3300026089 Ga0207648_10000083 Ga0207648_1000008371 178
200 3300026116 Ga0207674_10107042 Ga0207674_101070422 178
201 3300028379 Ga0268266_10000251 Ga0268266_1000025148 178
202 3300031344 Ga0265316_10186665 Ga0265316_101866652 178
203 iso_pu_bacteria 2718217752 2718716241 178
204 3300005548 Ga0070665_100476535 Ga0070665_1004765351 179
205 3300005841 Ga0068863_100029029 Ga0068863_1000290293 179
206 3300005843 Ga0068860_100001380 Ga0068860_10000138022 179
207 3300005981 Ga0081538_10015344 Ga0081538_100153443 179
208 3300009094 Ga0111539_10048674 Ga0111539_100486743 179
209 3300009177 Ga0105248_10312261 Ga0105248_103122613 179
210 3300010375 Ga0105239_10048890 Ga0105239_100488904 179
211 3300025913 Ga0207695_10002221 Ga0207695_1000222128 179
212 3300025941 Ga0207711_10232457 Ga0207711_102324573 179
213 3300026088 Ga0207641_10005226 Ga0207641_1000522619 179
214 3300027907 Ga0207428_10514354 Ga0207428_105143542 179
215 3300028379 Ga0268266_10501180 Ga0268266_105011802 179
216 3300028381 Ga0268264_10001807 Ga0268264_1000180713 179
217 3300031251 Ga0265327_10011153 Ga0265327_100111532 179
218 3300049532 Ga0501316_006032 Ga0501316_006032_376_927 179
219 3300049569 Ga0501032_0244194 Ga0501032_0244194_293_886 179
220 3300049742 Ga0501080_0023861 Ga0501080_0023861_3533_4078 179
221 3300050511 nmdc:mga08y16_94064_c1 nmdc:mga08y16_94064_c1_2279_2833 179
222 3300053103 Ga0500555_000015 Ga0500555_000015_118091_118825 179
223 3300053153 Ga0500616_0006989 Ga0500616_0006989_593_1327 179
224 3300005435 Ga0070714_100337764 Ga0070714_1003377642 180
225 3300005445 Ga0070708_100054749 Ga0070708_1000547495 180
226 3300005445 Ga0070708_100393362 Ga0070708_1003933622 180
227 3300005445 Ga0070708_100591210 Ga0070708_1005912102 180
228 3300005467 Ga0070706_100416544 Ga0070706_1004165443 180
229 3300005467 Ga0070706_100624420 Ga0070706_1006244201 180
230 3300005467 Ga0070706_100729309 Ga0070706_1007293092 180
231 3300005468 Ga0070707_100072311 Ga0070707_1000723118 180
232 3300005468 Ga0070707_100411612 Ga0070707_1004116122 180
233 3300005518 Ga0070699_100051877 Ga0070699_1000518771 180
234 3300005518 Ga0070699_100643205 Ga0070699_1006432051 180
235 3300005536 Ga0070697_100025782 Ga0070697_1000257825 180
236 3300005536 Ga0070697_100031906 Ga0070697_1000319063 180
237 3300006173 Ga0070716_100677467 Ga0070716_1006774671 180
238 3300009545 Ga0105237_10385391 Ga0105237_103853913 180
239 3300013296 Ga0157374_11937884 Ga0157374_119378841 180
240 3300013297 Ga0157378_10005509 Ga0157378_100055098 180
241 3300021384 Ga0213876_10483064 Ga0213876_104830642 180
242 3300025910 Ga0207684_10252293 Ga0207684_102522933 180
243 3300025915 Ga0207693_10389591 Ga0207693_103895912 180
244 3300025922 Ga0207646_10137954 Ga0207646_101379543 180
245 3300025929 Ga0207664_10120019 Ga0207664_101200194 180
246 3300037068 Ga0373925_0501751 Ga0373925_0501751_252_812 180
247 3300048912 Ga0496109_0327535 Ga0496109_0327535_731_1288 180
248 3300050514 nmdc:mga08x19_81630_c1 nmdc:mga08x19_81630_c1_515_1081 180
249 3300005295 Ga0065707_10102203 Ga0065707_101022031 181
250 3300005445 Ga0070708_100903773 Ga0070708_1009037731 181
251 3300005457 Ga0070662_100471626 Ga0070662_1004716262 181
252 3300005467 Ga0070706_100006435 Ga0070706_10000643516 181
253 3300005467 Ga0070706_100146613 Ga0070706_1001466132 181
254 3300005468 Ga0070707_100159765 Ga0070707_1001597653 181
255 3300005471 Ga0070698_100007384 Ga0070698_1000073848 181
256 3300005518 Ga0070699_100036501 Ga0070699_1000365019 181
257 3300005536 Ga0070697_100005694 Ga0070697_10000569410 181
258 3300005536 Ga0070697_100611835 Ga0070697_1006118352 181
259 3300005718 Ga0068866_10623252 Ga0068866_106232521 181
260 3300006028 Ga0070717_10037326 Ga0070717_100373268 181
261 3300006173 Ga0070716_100031746 Ga0070716_1000317464 181
262 3300006852 Ga0075433_10286694 Ga0075433_102866942 181
263 3300007076 Ga0075435_100470464 Ga0075435_1004704642 181
264 3300009098 Ga0105245_10158539 Ga0105245_101585393 181
265 3300013296 Ga0157374_10121480 Ga0157374_101214803 181
266 3300013297 Ga0157378_10043528 Ga0157378_100435283 181
267 3300013306 Ga0163162_10052794 Ga0163162_100527948 181
268 3300013307 Ga0157372_10167743 Ga0157372_101677431 181
269 3300025910 Ga0207684_10019695 Ga0207684_100196955 181
270 3300025910 Ga0207684_10048446 Ga0207684_100484463 181
271 3300025922 Ga0207646_10005692 Ga0207646_100056927 181
272 3300025932 Ga0207690_10086786 Ga0207690_100867863 181
273 3300025939 Ga0207665_10140744 Ga0207665_101407441 181
274 3300025972 Ga0207668_10203825 Ga0207668_102038253 181
275 3300026023 Ga0207677_10111866 Ga0207677_101118664 181
276 3300035725 Ga0373947_0159967 Ga0373947_0159967_755_1324 181
277 3300035725 Ga0373947_0173463 Ga0373947_0173463_155_724 181
278 3300037068 Ga0373925_0155902 Ga0373925_0155902_651_1220 181
279 3300046472 Ga0495580_0109086 Ga0495580_0109086_93_662 181
280 3300050513 nmdc:mga0rr50_168592_c1 nmdc:mga0rr50_168592_c1_320_886 181
281 3300050514 nmdc:mga08x19_555035_c1 nmdc:mga08x19_555035_c1_229_801 181
282 3300006048 Ga0075363_100128694 Ga0075363_1001286943 182
283 3300006195 Ga0075366_10047853 Ga0075366_100478532 182
284 3300042876 Ga0451577_0186388 Ga0451577_0186388_812_1375 182
285 3300050489 nmdc:mga03683_93017_c1 nmdc:mga03683_93017_c1_182_748 182
286 3300050490 nmdc:mga03n38_195087_c1 nmdc:mga03n38_195087_c1_97_663 182
287 3300001991 JGI24743J22301_10010320 JGI24743J22301_100103204 183
288 3300005290 Ga0065712_10088457 Ga0065712_100884574 183
289 3300005290 Ga0065712_10145424 Ga0065712_101454242 183
290 3300005328 Ga0070676_10428966 Ga0070676_104289661 183
291 3300005329 Ga0070683_100055457 Ga0070683_1000554575 183
292 3300005331 Ga0070670_100003742 Ga0070670_10000374211 183
293 3300005335 Ga0070666_10001876 Ga0070666_1000187612 183
294 3300005338 Ga0068868_100215528 Ga0068868_1002155282 183
295 3300005340 Ga0070689_100100534 Ga0070689_1001005341 183
296 3300005343 Ga0070687_100411748 Ga0070687_1004117482 183
297 3300005353 Ga0070669_100002011 Ga0070669_1000020119 183
298 3300005354 Ga0070675_100004678 Ga0070675_1000046786 183
299 3300005354 Ga0070675_100133137 Ga0070675_1001331374 183
300 3300005355 Ga0070671_100000283 Ga0070671_10000028329 183
301 3300005356 Ga0070674_100013872 Ga0070674_1000138725 183
302 3300005364 Ga0070673_100008141 Ga0070673_1000081413 183
303 3300005364 Ga0070673_100075213 Ga0070673_1000752135 183
304 3300005365 Ga0070688_100000733 Ga0070688_1000007332 183
305 3300005367 Ga0070667_100004665 Ga0070667_10000466518 183
306 3300005367 Ga0070667_100258686 Ga0070667_1002586862 183
307 3300005456 Ga0070678_100001511 Ga0070678_10000151113 183
308 3300005456 Ga0070678_100444107 Ga0070678_1004441072 183
309 3300005459 Ga0068867_100044767 Ga0068867_1000447672 183
310 3300005466 Ga0070685_10099962 Ga0070685_100999623 183
311 3300005543 Ga0070672_100202353 Ga0070672_1002023532 183
312 3300005843 Ga0068860_100672444 Ga0068860_1006724442 183
313 3300006175 Ga0070712_100996564 Ga0070712_1009965641 183
314 3300006358 Ga0068871_100084135 Ga0068871_1000841355 183
315 3300013296 Ga0157374_10001473 Ga0157374_100014735 183
316 3300013297 Ga0157378_10119918 Ga0157378_101199183 183
317 3300013306 Ga0163162_10370423 Ga0163162_103704233 183
318 3300013308 Ga0157375_10001868 Ga0157375_100018685 183
319 3300014969 Ga0157376_10390349 Ga0157376_103903492 183
320 3300025899 Ga0207642_10062069 Ga0207642_100620693 183
321 3300025901 Ga0207688_10001208 Ga0207688_100012087 183
322 3300025918 Ga0207662_10432993 Ga0207662_104329932 183
323 3300025923 Ga0207681_10014902 Ga0207681_100149024 183
324 3300025925 Ga0207650_10018287 Ga0207650_100182878 183
325 3300025926 Ga0207659_10045484 Ga0207659_100454842 183
326 3300025926 Ga0207659_10179827 Ga0207659_101798273 183
327 3300025931 Ga0207644_10035251 Ga0207644_100352515 183
328 3300025937 Ga0207669_10002532 Ga0207669_1000253210 183
329 3300025940 Ga0207691_10228367 Ga0207691_102283673 183
330 3300025960 Ga0207651_10007253 Ga0207651_1000725310 183
331 3300025960 Ga0207651_10027669 Ga0207651_100276697 183
332 3300025972 Ga0207668_10156576 Ga0207668_101565763 183
333 3300026023 Ga0207677_10021108 Ga0207677_100211084 183
334 3300026041 Ga0207639_10621551 Ga0207639_106215512 183
335 3300026088 Ga0207641_10626592 Ga0207641_106265922 183
336 3300026142 Ga0207698_10222182 Ga0207698_102221822 183
337 3300026142 Ga0207698_10283620 Ga0207698_102836201 183
338 3300028379 Ga0268266_10097330 Ga0268266_100973303 183
339 3300028381 Ga0268264_10149965 Ga0268264_101499655 183
340 3300028381 Ga0268264_10473591 Ga0268264_104735913 183
341 3300035120 Ga0373957_0405744 Ga0373957_0405744_10_573 183
342 3300035171 Ga0373946_0096119 Ga0373946_0096119_505_1068 183
343 3300046683 Ga0495658_0011003 Ga0495658_0011003_1219_1782 183
344 3300047315 Ga0495581_0106207 Ga0495581_0106207_970_1533 183
345 3300003791 Ga0055530_10029193 Ga0055530_100291932 184
346 3300005331 Ga0070670_100314402 Ga0070670_1003144022 184
347 3300005335 Ga0070666_10002056 Ga0070666_1000205612 184
348 3300005347 Ga0070668_100497705 Ga0070668_1004977051 184
349 3300005353 Ga0070669_100033015 Ga0070669_1000330153 184
350 3300005353 Ga0070669_100157939 Ga0070669_1001579393 184
351 3300005355 Ga0070671_100011134 Ga0070671_1000111345 184
352 3300005356 Ga0070674_100048927 Ga0070674_1000489273 184
353 3300005364 Ga0070673_100014325 Ga0070673_1000143255 184
354 3300005456 Ga0070678_100043541 Ga0070678_1000435414 184
355 3300005543 Ga0070672_100004247 Ga0070672_1000042478 184
356 3300005548 Ga0070665_100008787 Ga0070665_1000087874 184
357 3300005563 Ga0068855_100851325 Ga0068855_1008513251 184
358 3300005842 Ga0068858_100134565 Ga0068858_1001345652 184
359 3300006237 Ga0097621_100024099 Ga0097621_1000240993 184
360 3300006880 Ga0075429_100583814 Ga0075429_1005838142 184
361 3300009094 Ga0111539_10387272 Ga0111539_103872722 184
362 3300013296 Ga0157374_10127435 Ga0157374_101274354 184
363 3300013296 Ga0157374_11100808 Ga0157374_111008082 184
364 3300013297 Ga0157378_10026553 Ga0157378_100265533 184
365 3300013297 Ga0157378_10174062 Ga0157378_101740621 184
366 3300013306 Ga0163162_10410273 Ga0163162_104102733 184
367 3300013308 Ga0157375_10082239 Ga0157375_100822392 184
368 3300014969 Ga0157376_10031061 Ga0157376_100310614 184
369 3300025298 Ga0209050_1000629 Ga0209050_100062932 184
370 3300025315 Ga0207697_10002322 Ga0207697_100023228 184
371 3300025903 Ga0207680_10104042 Ga0207680_101040422 184
372 3300025907 Ga0207645_10002762 Ga0207645_100027623 184
373 3300025920 Ga0207649_10150356 Ga0207649_101503563 184
374 3300025926 Ga0207659_10469124 Ga0207659_104691241 184
375 3300025926 Ga0207659_10682627 Ga0207659_106826272 184
376 3300025931 Ga0207644_10266435 Ga0207644_102664352 184
377 3300025940 Ga0207691_10016028 Ga0207691_100160288 184
378 3300025944 Ga0207661_10077884 Ga0207661_100778842 184
379 3300025945 Ga0207679_10279684 Ga0207679_102796843 184
380 3300025949 Ga0207667_10766901 Ga0207667_107669011 184
381 3300025960 Ga0207651_10019560 Ga0207651_100195603 184
382 3300025972 Ga0207668_10057405 Ga0207668_100574053 184
383 3300025972 Ga0207668_10931305 Ga0207668_109313052 184
384 3300026023 Ga0207677_10008042 Ga0207677_100080424 184
385 3300026035 Ga0207703_10175845 Ga0207703_101758452 184
386 3300026121 Ga0207683_10015583 Ga0207683_100155833 184
387 3300027876 Ga0209974_10022093 Ga0209974_100220933 184
388 3300028379 Ga0268266_10238441 Ga0268266_102384412 184
389 3300028380 Ga0268265_10116094 Ga0268265_101160943 184
390 3300035116 Ga0373945_0059303 Ga0373945_0059303_27_596 184
391 3300035172 Ga0373955_0008379 Ga0373955_0008379_2910_3479 184
392 3300035398 Ga0316574_0010564 Ga0316574_0010564_4273_4842 184
393 3300035724 Ga0373933_0052084 Ga0373933_0052084_1702_2271 184
394 3300036401 Ga0373937_0282498 Ga0373937_0282498_302_871 184
395 3300036401 Ga0373937_0824342 Ga0373937_0824342_219_788 184
396 3300046454 Ga0495592_0102898 Ga0495592_0102898_1255_1824 184
397 3300046462 Ga0495651_0162026 Ga0495651_0162026_285_854 184
398 3300046511 Ga0495608_0095489 Ga0495608_0095489_1203_1772 184
399 3300046514 Ga0495618_0068826 Ga0495618_0068826_1404_1973 184
400 3300046516 Ga0495628_0040395 Ga0495628_0040395_2385_2954 184
401 3300046517 Ga0495630_0017678 Ga0495630_0017678_692_1261 184
402 3300046529 Ga0495652_0018013 Ga0495652_0018013_1170_1739 184
403 3300046537 Ga0495598_0043361 Ga0495598_0043361_524_1093 184
404 3300046543 Ga0495645_0063981 Ga0495645_0063981_1112_1681 184
405 3300046642 Ga0495634_0048412 Ga0495634_0048412_1317_1886 184
406 3300046678 Ga0495599_0142934 Ga0495599_0142934_340_909 184
407 3300047319 Ga0495674_0415532 Ga0495674_0415532_285_854 184
408 3300047444 Ga0495675_0002584 Ga0495675_0002584_5712_6281 184
409 3300047471 Ga0495684_0164535 Ga0495684_0164535_950_1519 184
410 3300048088 Ga0495602_0309980 Ga0495602_0309980_216_785 184
411 3300048907 Ga0496104_0356276 Ga0496104_0356276_367_936 184
412 3300048912 Ga0496109_0241538 Ga0496109_0241538_720_1292 184
413 3300048915 Ga0496112_0273283 Ga0496112_0273283_84_656 184
414 3300050511 nmdc:mga08y16_168750_c1 nmdc:mga08y16_168750_c1_699_1268 184
415 3300053077 Ga0495601_0267157 Ga0495601_0267157_266_835 184
416 3300053085 Ga0495619_0109404 Ga0495619_0109404_755_1324 184
417 3300001991 JGI24743J22301_10000748 JGI24743J22301_100007483 185
418 3300025315 Ga0207697_10031631 Ga0207697_100316313 185
419 3300025901 Ga0207688_10042403 Ga0207688_100424032 185
420 3300049568 Ga0501031_0000635 Ga0501031_0000635_4728_5321 185
421 3300049569 Ga0501032_0046887 Ga0501032_0046887_49_642 185
422 3300049570 Ga0501033_0000015 Ga0501033_0000015_60658_61251 185
423 3300049572 Ga0501036_0013849 Ga0501036_0013849_2004_2597 185
424 3300049573 Ga0501037_0000295 Ga0501037_0000295_31859_32452 185
425 3300049574 Ga0501038_0073690 Ga0501038_0073690_1720_2313 185
426 3300049575 Ga0501039_0022279 Ga0501039_0022279_1469_2062 185
427 3300049579 Ga0501043_0069626 Ga0501043_0069626_1071_1664 185
428 3300049581 Ga0501047_0009121 Ga0501047_0009121_8313_8906 185
429 3300049586 Ga0501070_0002360 Ga0501070_0002360_14773_15366 185
430 3300049587 Ga0501071_0074202 Ga0501071_0074202_443_1036 185
431 3300049742 Ga0501080_0345987 Ga0501080_0345987_502_1095 185
432 3300049822 Ga0501035_0000004 Ga0501035_0000004_14785_15378 185
433 3300049823 Ga0501044_0000740 Ga0501044_0000740_5929_6522 185
434 3300049824 Ga0501045_0827532 Ga0501045_0827532_73_666 185
435 2162886006 SwRhRL3b_contig_111370 SwRhRL3b_0945.00000070 186
436 2162886006 SwRhRL3b_contig_2227077 SwRhRL3b_0661.00001900 186
437 2162886007 SwRhRL2b_contig_128758 SwRhRL2b_0493.00002170 186
438 3300005289 Ga0065704_10115944 Ga0065704_101159442 186
439 3300005293 Ga0065715_10001491 Ga0065715_1000149110 186
440 3300005328 Ga0070676_10079494 Ga0070676_100794944 186
441 3300005335 Ga0070666_10037886 Ga0070666_100378863 186
442 3300005338 Ga0068868_100221974 Ga0068868_1002219742 186
443 3300005339 Ga0070660_100151607 Ga0070660_1001516072 186
444 3300005347 Ga0070668_100069825 Ga0070668_1000698255 186
445 3300005347 Ga0070668_100182452 Ga0070668_1001824524 186
446 3300005353 Ga0070669_100004431 Ga0070669_1000044314 186
447 3300005353 Ga0070669_100199988 Ga0070669_1001999882 186
448 3300005354 Ga0070675_100137843 Ga0070675_1001378433 186
449 3300005354 Ga0070675_100193153 Ga0070675_1001931533 186
450 3300005355 Ga0070671_100016515 Ga0070671_1000165152 186
451 3300005356 Ga0070674_100064027 Ga0070674_1000640272 186
452 3300005356 Ga0070674_100293714 Ga0070674_1002937142 186
453 3300005367 Ga0070667_100072064 Ga0070667_1000720643 186
454 3300005367 Ga0070667_100449308 Ga0070667_1004493081 186
455 3300005434 Ga0070709_10408304 Ga0070709_104083042 186
456 3300005434 Ga0070709_10499439 Ga0070709_104994392 186
457 3300005435 Ga0070714_100879043 Ga0070714_1008790431 186
458 3300005436 Ga0070713_100354871 Ga0070713_1003548712 186
459 3300005437 Ga0070710_10136557 Ga0070710_101365572 186
460 3300005437 Ga0070710_10207762 Ga0070710_102077622 186
461 3300005437 Ga0070710_10236095 Ga0070710_102360952 186
462 3300005438 Ga0070701_10075691 Ga0070701_100756913 186
463 3300005439 Ga0070711_100006116 Ga0070711_1000061165 186
464 3300005439 Ga0070711_100226319 Ga0070711_1002263192 186
465 3300005456 Ga0070678_100033505 Ga0070678_1000335052 186
466 3300005456 Ga0070678_100053192 Ga0070678_1000531924 186
467 3300005457 Ga0070662_100008169 Ga0070662_1000081692 186
468 3300005459 Ga0068867_100235448 Ga0068867_1002354483 186
469 3300005536 Ga0070697_100141887 Ga0070697_1001418875 186
470 3300005543 Ga0070672_100041736 Ga0070672_1000417365 186
471 3300005543 Ga0070672_100182796 Ga0070672_1001827962 186
472 3300005545 Ga0070695_100561239 Ga0070695_1005612392 186
473 3300005548 Ga0070665_100114878 Ga0070665_1001148786 186
474 3300005548 Ga0070665_100853228 Ga0070665_1008532282 186
475 3300005549 Ga0070704_100083567 Ga0070704_1000835674 186
476 3300005614 Ga0068856_100017528 Ga0068856_1000175287 186
477 3300005718 Ga0068866_10121420 Ga0068866_101214203 186
478 3300005719 Ga0068861_100390918 Ga0068861_1003909182 186
479 3300006163 Ga0070715_10015930 Ga0070715_100159306 186
480 3300006173 Ga0070716_100086652 Ga0070716_1000866522 186
481 3300006175 Ga0070712_100093977 Ga0070712_1000939772 186
482 3300006175 Ga0070712_100105455 Ga0070712_1001054553 186
483 3300006881 Ga0068865_100013318 Ga0068865_1000133183 186
484 3300007788 Ga0099795_10326251 Ga0099795_103262511 186
485 3300009098 Ga0105245_10823160 Ga0105245_108231602 186
486 3300009176 Ga0105242_10451840 Ga0105242_104518403 186
487 3300010159 Ga0099796_10040234 Ga0099796_100402342 186
488 3300013102 Ga0157371_10058341 Ga0157371_100583412 186
489 3300013296 Ga0157374_10055882 Ga0157374_100558823 186
490 3300013296 Ga0157374_10498498 Ga0157374_104984982 186
491 3300013296 Ga0157374_11130585 Ga0157374_111305852 186
492 3300013297 Ga0157378_10058061 Ga0157378_100580612 186
493 3300013297 Ga0157378_10107467 Ga0157378_101074673 186
494 3300013306 Ga0163162_10017445 Ga0163162_1001744513 186
495 3300013306 Ga0163162_10023520 Ga0163162_100235205 186
496 3300013307 Ga0157372_10360562 Ga0157372_103605623 186
497 3300013307 Ga0157372_11295485 Ga0157372_112954852 186
498 3300013308 Ga0157375_10044228 Ga0157375_100442285 186
499 3300013308 Ga0157375_10144146 Ga0157375_101441461 186
500 3300013308 Ga0157375_10668197 Ga0157375_106681972 186
501 3300014969 Ga0157376_10102835 Ga0157376_101028353 186
502 3300017792 Ga0163161_10042654 Ga0163161_100426543 186
503 3300017792 Ga0163161_10245059 Ga0163161_102450592 186
504 3300025315 Ga0207697_10000131 Ga0207697_1000013124 186
505 3300025899 Ga0207642_10063829 Ga0207642_100638293 186
506 3300025903 Ga0207680_10205844 Ga0207680_102058442 186
507 3300025905 Ga0207685_10139437 Ga0207685_101394372 186
508 3300025905 Ga0207685_10171988 Ga0207685_101719882 186
509 3300025906 Ga0207699_10181274 Ga0207699_101812743 186
510 3300025907 Ga0207645_10001641 Ga0207645_1000164120 186
511 3300025915 Ga0207693_10000889 Ga0207693_1000088933 186
512 3300025915 Ga0207693_10092069 Ga0207693_100920693 186
513 3300025916 Ga0207663_10005429 Ga0207663_100054299 186
514 3300025916 Ga0207663_10396750 Ga0207663_103967502 186
515 3300025919 Ga0207657_10073181 Ga0207657_100731816 186
516 3300025923 Ga0207681_10072736 Ga0207681_100727363 186
517 3300025923 Ga0207681_10175206 Ga0207681_101752063 186
518 3300025925 Ga0207650_10006836 Ga0207650_100068363 186
519 3300025926 Ga0207659_10020696 Ga0207659_100206965 186
520 3300025928 Ga0207700_10318513 Ga0207700_103185132 186
521 3300025931 Ga0207644_10049869 Ga0207644_100498696 186
522 3300025933 Ga0207706_10027339 Ga0207706_100273397 186
523 3300025937 Ga0207669_10073225 Ga0207669_100732252 186
524 3300025938 Ga0207704_10040566 Ga0207704_100405661 186
525 3300025939 Ga0207665_10025655 Ga0207665_100256553 186
526 3300025939 Ga0207665_10180266 Ga0207665_101802662 186
527 3300025940 Ga0207691_10000247 Ga0207691_100002476 186
528 3300025940 Ga0207691_10235331 Ga0207691_102353312 186
529 3300025960 Ga0207651_10634914 Ga0207651_106349142 186
530 3300025972 Ga0207668_10035962 Ga0207668_100359623 186
531 3300025972 Ga0207668_10629956 Ga0207668_106299562 186
532 3300025986 Ga0207658_10302012 Ga0207658_103020123 186
533 3300026023 Ga0207677_10021545 Ga0207677_100215452 186
534 3300026078 Ga0207702_10038562 Ga0207702_100385625 186
535 3300026089 Ga0207648_10237363 Ga0207648_102373633 186
536 3300026118 Ga0207675_100323714 Ga0207675_1003237143 186
537 3300026121 Ga0207683_10006977 Ga0207683_1000697712 186
538 3300026121 Ga0207683_10008842 Ga0207683_1000884215 186
539 3300028379 Ga0268266_10325400 Ga0268266_103254003 186
540 3300035089 Ga0373944_0080838 Ga0373944_0080838_23_583 186
541 3300035116 Ga0373945_0053651 Ga0373945_0053651_156_716 186
542 3300035116 Ga0373945_0232692 Ga0373945_0232692_192_752 186
543 3300035170 Ga0373943_0005531 Ga0373943_0005531_3292_3852 186
544 3300035170 Ga0373943_0092490 Ga0373943_0092490_542_1102 186
545 3300035171 Ga0373946_0078616 Ga0373946_0078616_672_1232 186
546 3300035691 Ga0373931_0036970 Ga0373931_0036970_601_1161 186
547 3300035692 Ga0373935_0067275 Ga0373935_0067275_1305_1865 186
548 3300035695 Ga0373927_0200535 Ga0373927_0200535_237_797 186
549 3300035695 Ga0373927_0608304 Ga0373927_0608304_110_670 186
550 3300035725 Ga0373947_0015443 Ga0373947_0015443_2881_3441 186
551 3300037068 Ga0373925_0014401 Ga0373925_0014401_2842_3402 186
552 3300037418 Ga0395900_0002526 Ga0395900_0002526_3032_3592 186
553 3300037466 Ga0395898_0079141 Ga0395898_0079141_577_1137 186
554 3300038443 Ga0395901_0039538 Ga0395901_0039538_1628_2188 186
555 3300046474 Ga0495605_0063477 Ga0495605_0063477_660_1220 186
556 3300046491 Ga0495584_0022505 Ga0495584_0022505_1495_2055 186
557 3300046492 Ga0495585_0065325 Ga0495585_0065325_988_1548 186
558 3300046525 Ga0495663_0019332 Ga0495663_0019332_1341_1901 186
559 3300046528 Ga0495642_0022869 Ga0495642_0022869_1383_1943 186
560 3300046537 Ga0495598_0000901 Ga0495598_0000901_4511_5071 186
561 3300046558 Ga0495633_0056070 Ga0495633_0056070_199_759 186
562 3300046615 Ga0495656_0049027 Ga0495656_0049027_1095_1655 186
563 3300046665 Ga0495661_0193660 Ga0495661_0193660_156_716 186
564 3300046684 Ga0495669_0009247 Ga0495669_0009247_2801_3361 186
565 3300046691 Ga0495670_0082094 Ga0495670_0082094_601_1161 186
566 3300046694 Ga0495649_0204851 Ga0495649_0204851_342_902 186
567 3300047445 Ga0495677_0064905 Ga0495677_0064905_453_1013 186
568 3300048903 Ga0496100_0021201 Ga0496100_0021201_671_1231 186
569 3300048903 Ga0496100_0356210 Ga0496100_0356210_153_713 186
570 3300048904 Ga0496101_0031362 Ga0496101_0031362_2506_3066 186
571 3300048905 Ga0496102_0009851 Ga0496102_0009851_1533_2093 186
572 3300048905 Ga0496102_0251367 Ga0496102_0251367_728_1288 186
573 3300048906 Ga0496103_0011535 Ga0496103_0011535_2104_2664 186
574 3300048907 Ga0496104_0014963 Ga0496104_0014963_5375_5935 186
575 3300048909 Ga0496106_0002174 Ga0496106_0002174_1891_2451 186
576 3300048909 Ga0496106_0264949 Ga0496106_0264949_390_950 186
577 3300048909 Ga0496106_0292110 Ga0496106_0292110_193_753 186
578 3300048910 Ga0496107_0018540 Ga0496107_0018540_163_723 186
579 3300048910 Ga0496107_0286116 Ga0496107_0286116_567_1127 186
580 3300048911 Ga0496108_0042309 Ga0496108_0042309_1458_2018 186
581 3300048912 Ga0496109_0040844 Ga0496109_0040844_1215_1775 186
582 3300048912 Ga0496109_0287838 Ga0496109_0287838_277_837 186
583 3300048913 Ga0496110_0132415 Ga0496110_0132415_736_1296 186
584 3300048913 Ga0496110_0330391 Ga0496110_0330391_637_1197 186
585 3300048914 Ga0496111_0102523 Ga0496111_0102523_705_1265 186
586 3300048915 Ga0496112_0017121 Ga0496112_0017121_3619_4179 186
587 3300048915 Ga0496112_0046152 Ga0496112_0046152_692_1252 186
588 3300048915 Ga0496112_0050307 Ga0496112_0050307_1427_1987 186
589 3300048915 Ga0496112_0161160 Ga0496112_0161160_1433_1993 186
590 3300048916 Ga0496113_0188201 Ga0496113_0188201_541_1101 186
591 3300048916 Ga0496113_0476967 Ga0496113_0476967_52_612 186
592 3300048916 Ga0496113_0528149 Ga0496113_0528149_66_626 186
593 3300048917 Ga0496114_0172612 Ga0496114_0172612_306_866 186
594 3300048918 Ga0496115_0009615 Ga0496115_0009615_4388_4948 186

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00333

Ribosomal_S5

Ribosomal protein S5, N-terminal domain

49

113

0.97

PF03719

Ribosomal_S5_C

Ribosomal protein S5, C-terminal domain

125

195

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvo-assembly1.cif.gz_E cutibacterium acnes 30s ribosomal subunit with sarecycline bound, head domain only in the local refined map 0.9416 24 76
6spf-assembly1.cif.gz_e pseudomonas aeruginosa 70s ribosome from an aminoglycoside resistant clinical isolate 0.9299 26 158
7unu-assembly1.cif.gz_e pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9158 25 164
4v7h-assembly1.cif.gz_AE structure of the 80s rrna and proteins and p/e trna for eukaryotic ribosome based on cryo-em map of thermomyces lanuginosus ribosome at 8.9a resolution 0.9123 24 154
6zto-assembly1.cif.gz_AE e. coli 70s-rnap expressome complex in uncoupled state 1 0.8915 23 168
ID Description Score Start End Superfamily
af_A0A1D8PEV9_173_236_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9718 24 82 3.30.160.20
af_Q54CA5_1734_1797_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9555 25 82 3.30.160.20
3j81C02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.932 90 157 3.30.230.10
af_D3ZQW7_1_92_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.9244 24 76 3.30.160.20
3ms0E01 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.922 23 83 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A1G4AJ55-F1-model_v4 Small ribosomal subunit protein uS5 0.9129 25 168 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A7C4EL12-F1-model_v4 Small ribosomal subunit protein uS5 0.9122 23 167 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A1G1H0X9-F1-model_v4 Small ribosomal subunit protein uS5 0.9115 23 168 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A2M6X406-F1-model_v4 Small ribosomal subunit protein uS5 0.9089 23 167 GO:0003735
GO:0005737
GO:0006412
GO:0015935
GO:0019843
AF-A0A2E7GD17-F1-model_v4 deleted 0.9084 24 168

Feature Viewer

pLDDT pTM Quality
79.45 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map