F467308
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 594 | 310 | 593 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300005548|Ga0070665_100000045|Ga0070665_10000004549 |
| Length | 216 |
| Sequence | MPPKTDPIIEEKIAEETVVVDXXXXAAAVAPTEQRTDHRGGQGENKSDLLEKVVFINRCAKVVKGGRRFSFSALLVVGDRKGKVGVGFGKANEVTEAIRKATDAARKHLEPVSLRGNTIPHEVMGQFGGGRVFLRPASPGTGLIAGGGVRAVVEAAGIKDLLAKSLGSGNPANVVRATLQALKQLRQKEVIFQLRGKTVKPAAPAVAGESDPALAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2718217752 | Candidatus Xiphinematobacter sp. Idaho Grape | Isolate | Unclassified |
| 4 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 83 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 104 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 105 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 106 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 109 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 166 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 167 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 170 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 183 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 195 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 196 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 197 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 198 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 201 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 202 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 203 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 204 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 205 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 207 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 208 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 209 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 210 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 256 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 259 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 260 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 261 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 262 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 263 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 304 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 305 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 306 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 307 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 308 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 309 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 310 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.64 |
| Metatranscriptomes | 2.02 |
| Isolates | 0.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.04 |
| Nodule | 0 |
| Rhizoplane | 5.39 |
| Rhizosphere | 86.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_111370 | 2162886006 | Bacteria | 2236 |
| 2 | SwRhRL3b_contig_2227077 | 2162886006 | Unclassified | 1583 |
| 3 | SwRhRL2b_contig_128758 | 2162886007 | Bacteria | 2329 |
| 4 | JGI24743J22301_10000748 | 3300001991 | Bacteria | 4062 |
| 5 | JGI24743J22301_10010320 | 3300001991 | Bacteria | 1666 |
| 6 | JGI24744J21845_10011528 | 3300002077 | Bacteria | 1807 |
| 7 | JGI24033J26618_1000142 | 3300002155 | Bacteria | 9538 |
| 8 | JGI25406J46586_10000001 | 3300003203 | Bacteria | 251772 |
| 9 | JGI25406J46586_10000007 | 3300003203 | Bacteria | 112227 |
| 10 | rootH2_10050166 | 3300003320 | Bacteria | 16007 |
| 11 | rootL2_10030599 | 3300003322 | Bacteria | 2291 |
| 12 | rootL2_10139488 | 3300003322 | Bacteria | 1084 |
| 13 | rootH1_10007007 | 3300003316 | Bacteria | 7034 |
| 14 | rootH1_10007007 | 3300003323 | Bacteria | 6457 |
| 15 | Ga0055530_10029193 | 3300003791 | Bacteria | 1477 |
| 16 | Ga0065704_10115944 | 3300005289 | Bacteria | 1863 |
| 17 | Ga0065712_10088457 | 3300005290 | Bacteria | 2519 |
| 18 | Ga0065712_10145424 | 3300005290 | Bacteria | 1413 |
| 19 | Ga0065715_10001491 | 3300005293 | Bacteria | 7335 |
| 20 | Ga0065707_10102203 | 3300005295 | Bacteria | 2810 |
| 21 | Ga0070658_10018594 | 3300005327 | Bacteria | 5565 |
| 22 | Ga0070676_10079494 | 3300005328 | Bacteria | 1986 |
| 23 | Ga0070676_10305976 | 3300005328 | Bacteria | 1079 |
| 24 | Ga0070676_10428966 | 3300005328 | Bacteria | 925 |
| 25 | Ga0070683_100055457 | 3300005329 | Bacteria | 3678 |
| 26 | Ga0070670_100003742 | 3300005331 | Bacteria | 12666 |
| 27 | Ga0070670_100205578 | 3300005331 | Bacteria | 1711 |
| 28 | Ga0070670_100314402 | 3300005331 | Bacteria | 1371 |
| 29 | Ga0070670_100359756 | 3300005331 | Bacteria | 1280 |
| 30 | Ga0068869_100697020 | 3300005334 | Bacteria | 866 |
| 31 | Ga0070666_10001876 | 3300005335 | Bacteria | 12791 |
| 32 | Ga0070666_10002056 | 3300005335 | Bacteria | 12212 |
| 33 | Ga0070666_10037886 | 3300005335 | Bacteria | 3207 |
| 34 | Ga0068868_100215528 | 3300005338 | Bacteria | 1606 |
| 35 | Ga0068868_100221974 | 3300005338 | Bacteria | 1582 |
| 36 | Ga0070660_100151607 | 3300005339 | Bacteria | 1864 |
| 37 | Ga0070689_100100534 | 3300005340 | Bacteria | 2288 |
| 38 | Ga0070687_100411748 | 3300005343 | Bacteria | 889 |
| 39 | Ga0070661_100000386 | 3300005344 | Bacteria | 34590 |
| 40 | Ga0070661_100097194 | 3300005344 | Bacteria | 2186 |
| 41 | Ga0070661_100288697 | 3300005344 | Bacteria | 1274 |
| 42 | Ga0070668_100069825 | 3300005347 | Bacteria | 2734 |
| 43 | Ga0070668_100182452 | 3300005347 | Bacteria | 1715 |
| 44 | Ga0070668_100497705 | 3300005347 | Bacteria | 1055 |
| 45 | Ga0070669_100002011 | 3300005353 | Bacteria | 14710 |
| 46 | Ga0070669_100004431 | 3300005353 | Bacteria | 10120 |
| 47 | Ga0070669_100033015 | 3300005353 | Bacteria | 3741 |
| 48 | Ga0070669_100157939 | 3300005353 | Bacteria | 1760 |
| 49 | Ga0070669_100199988 | 3300005353 | Unclassified | 1572 |
| 50 | Ga0070675_100004678 | 3300005354 | Bacteria | 10447 |
| 51 | Ga0070675_100133137 | 3300005354 | Bacteria | 2120 |
| 52 | Ga0070675_100137843 | 3300005354 | Bacteria | 2083 |
| 53 | Ga0070675_100193153 | 3300005354 | Bacteria | 1765 |
| 54 | Ga0070671_100000283 | 3300005355 | Bacteria | 34469 |
| 55 | Ga0070671_100011134 | 3300005355 | Bacteria | 7224 |
| 56 | Ga0070671_100016515 | 3300005355 | Bacteria | 5967 |
| 57 | Ga0070674_100013872 | 3300005356 | Bacteria | 4993 |
| 58 | Ga0070674_100034793 | 3300005356 | Bacteria | 3368 |
| 59 | Ga0070674_100048927 | 3300005356 | Bacteria | 2904 |
| 60 | Ga0070674_100064027 | 3300005356 | Bacteria | 2575 |
| 61 | Ga0070674_100293714 | 3300005356 | Bacteria | 1293 |
| 62 | Ga0070673_100008141 | 3300005364 | Bacteria | 6955 |
| 63 | Ga0070673_100014325 | 3300005364 | Bacteria | 5516 |
| 64 | Ga0070673_100075213 | 3300005364 | Bacteria | 2724 |
| 65 | Ga0070688_100000733 | 3300005365 | Bacteria | 16191 |
| 66 | Ga0070667_100004665 | 3300005367 | Bacteria | 11504 |
| 67 | Ga0070667_100072064 | 3300005367 | Bacteria | 2943 |
| 68 | Ga0070667_100258686 | 3300005367 | Bacteria | 1558 |
| 69 | Ga0070667_100449308 | 3300005367 | Bacteria | 1178 |
| 70 | Ga0070709_10408304 | 3300005434 | Bacteria | 1015 |
| 71 | Ga0070709_10499439 | 3300005434 | Bacteria | 924 |
| 72 | Ga0070714_100337764 | 3300005435 | Bacteria | 1412 |
| 73 | Ga0070714_100879043 | 3300005435 | Bacteria | 870 |
| 74 | Ga0070713_100354871 | 3300005436 | Bacteria | 1361 |
| 75 | Ga0070710_10136557 | 3300005437 | Bacteria | 1500 |
| 76 | Ga0070710_10207762 | 3300005437 | Bacteria | 1240 |
| 77 | Ga0070710_10236095 | 3300005437 | Bacteria | 1169 |
| 78 | Ga0070701_10075691 | 3300005438 | Bacteria | 1810 |
| 79 | Ga0070711_100006116 | 3300005439 | Bacteria | 7237 |
| 80 | Ga0070711_100226319 | 3300005439 | Bacteria | 1456 |
| 81 | Ga0070708_100054749 | 3300005445 | Bacteria | 3545 |
| 82 | Ga0070708_100076149 | 3300005445 | Bacteria | 3030 |
| 83 | Ga0070708_100393362 | 3300005445 | Unclassified | 1307 |
| 84 | Ga0070708_100591210 | 3300005445 | Bacteria | 1046 |
| 85 | Ga0070708_100903773 | 3300005445 | Bacteria | 829 |
| 86 | Ga0070678_100001511 | 3300005456 | Bacteria | 12415 |
| 87 | Ga0070678_100013072 | 3300005456 | Bacteria | 5189 |
| 88 | Ga0070678_100033505 | 3300005456 | Unclassified | 3567 |
| 89 | Ga0070678_100043541 | 3300005456 | Bacteria | 3198 |
| 90 | Ga0070678_100053192 | 3300005456 | Bacteria | 2943 |
| 91 | Ga0070678_100223073 | 3300005456 | Bacteria | 1567 |
| 92 | Ga0070678_100444107 | 3300005456 | Bacteria | 1135 |
| 93 | Ga0070662_100008169 | 3300005457 | Bacteria | 6816 |
| 94 | Ga0070662_100471626 | 3300005457 | Bacteria | 1044 |
| 95 | Ga0068867_100000218 | 3300005459 | Bacteria | 37862 |
| 96 | Ga0068867_100007340 | 3300005459 | Bacteria | 7800 |
| 97 | Ga0068867_100044767 | 3300005459 | Bacteria | 3243 |
| 98 | Ga0068867_100235448 | 3300005459 | Bacteria | 1482 |
| 99 | Ga0070685_10099962 | 3300005466 | Bacteria | 1770 |
| 100 | Ga0070706_100006435 | 3300005467 | Bacteria | 11091 |
| 101 | Ga0070706_100146613 | 3300005467 | Bacteria | 2204 |
| 102 | Ga0070706_100416544 | 3300005467 | Bacteria | 1250 |
| 103 | Ga0070706_100624420 | 3300005467 | Unclassified | 1001 |
| 104 | Ga0070706_100729309 | 3300005467 | Bacteria | 919 |
| 105 | Ga0070707_100072311 | 3300005468 | Bacteria | 3323 |
| 106 | Ga0070707_100159765 | 3300005468 | Bacteria | 2196 |
| 107 | Ga0070707_100411612 | 3300005468 | Unclassified | 1312 |
| 108 | Ga0070698_100001910 | 3300005471 | Bacteria | 23223 |
| 109 | Ga0070698_100007384 | 3300005471 | Bacteria | 11891 |
| 110 | Ga0070699_100030476 | 3300005518 | Bacteria | 4657 |
| 111 | Ga0070699_100036501 | 3300005518 | Bacteria | 4251 |
| 112 | Ga0070699_100051877 | 3300005518 | Unclassified | 3551 |
| 113 | Ga0070699_100093749 | 3300005518 | Bacteria | 2627 |
| 114 | Ga0070699_100643205 | 3300005518 | Bacteria | 968 |
| 115 | Ga0070697_100004958 | 3300005536 | Bacteria | 10219 |
| 116 | Ga0070697_100005694 | 3300005536 | Bacteria | 9598 |
| 117 | Ga0070697_100025782 | 3300005536 | Bacteria | 4689 |
| 118 | Ga0070697_100031906 | 3300005536 | Bacteria | 4239 |
| 119 | Ga0070697_100141887 | 3300005536 | Bacteria | 2021 |
| 120 | Ga0070697_100611835 | 3300005536 | Unclassified | 958 |
| 121 | Ga0070672_100004247 | 3300005543 | Bacteria | 9368 |
| 122 | Ga0070672_100041736 | 3300005543 | Bacteria | 3529 |
| 123 | Ga0070672_100182796 | 3300005543 | Bacteria | 1748 |
| 124 | Ga0070672_100202353 | 3300005543 | Bacteria | 1661 |
| 125 | Ga0070695_100561239 | 3300005545 | Bacteria | 891 |
| 126 | Ga0070665_100000045 | 3300005548 | Bacteria | 275023 |
| 127 | Ga0070665_100008787 | 3300005548 | Bacteria | 10223 |
| 128 | Ga0070665_100114878 | 3300005548 | Bacteria | 2694 |
| 129 | Ga0070665_100476535 | 3300005548 | Bacteria | 1259 |
| 130 | Ga0070665_100673722 | 3300005548 | Bacteria | 1047 |
| 131 | Ga0070665_100853228 | 3300005548 | Bacteria | 924 |
| 132 | Ga0070704_100083567 | 3300005549 | Bacteria | 2357 |
| 133 | Ga0068855_100597968 | 3300005563 | Bacteria | 1190 |
| 134 | Ga0068855_100851325 | 3300005563 | Bacteria | 966 |
| 135 | Ga0070664_100000199 | 3300005564 | Bacteria | 42634 |
| 136 | Ga0070664_100360619 | 3300005564 | Bacteria | 1324 |
| 137 | Ga0068857_100221076 | 3300005577 | Bacteria | 1730 |
| 138 | Ga0068856_100004352 | 3300005614 | Bacteria | 14113 |
| 139 | Ga0068856_100017528 | 3300005614 | Bacteria | 6939 |
| 140 | Ga0068859_101731931 | 3300005617 | Bacteria | 690 |
| 141 | Ga0068866_10121420 | 3300005718 | Bacteria | 1473 |
| 142 | Ga0068866_10623252 | 3300005718 | Bacteria | 731 |
| 143 | Ga0068861_100390918 | 3300005719 | Bacteria | 1232 |
| 144 | Ga0068863_100029029 | 3300005841 | Bacteria | 5284 |
| 145 | Ga0068863_100054836 | 3300005841 | Bacteria | 3776 |
| 146 | Ga0068858_100055768 | 3300005842 | Bacteria | 3653 |
| 147 | Ga0068858_100134565 | 3300005842 | Bacteria | 2319 |
| 148 | Ga0068858_100800210 | 3300005842 | Bacteria | 920 |
| 149 | Ga0068860_100001380 | 3300005843 | Bacteria | 26358 |
| 150 | Ga0068860_100672444 | 3300005843 | Bacteria | 1044 |
| 151 | Ga0081538_10015344 | 3300005981 | Bacteria | 5937 |
| 152 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 153 | Ga0070717_10037326 | 3300006028 | Bacteria | 3945 |
| 154 | Ga0070717_10195964 | 3300006028 | Bacteria | 1767 |
| 155 | Ga0075363_100004668 | 3300006048 | Bacteria | 6026 |
| 156 | Ga0075363_100128694 | 3300006048 | Bacteria | 1419 |
| 157 | Ga0070715_10015930 | 3300006163 | Bacteria | 2813 |
| 158 | Ga0070716_100031746 | 3300006173 | Bacteria | 2875 |
| 159 | Ga0070716_100086652 | 3300006173 | Bacteria | 1884 |
| 160 | Ga0070716_100677467 | 3300006173 | Bacteria | 785 |
| 161 | Ga0070712_100093977 | 3300006175 | Bacteria | 2202 |
| 162 | Ga0070712_100105455 | 3300006175 | Unclassified | 2093 |
| 163 | Ga0070712_100996564 | 3300006175 | Bacteria | 725 |
| 164 | Ga0075362_10004435 | 3300006177 | Bacteria | 5044 |
| 165 | Ga0075366_10047853 | 3300006195 | Bacteria | 2535 |
| 166 | Ga0097621_100024099 | 3300006237 | Bacteria | 4748 |
| 167 | Ga0097621_100605107 | 3300006237 | Bacteria | 1002 |
| 168 | Ga0097621_100827666 | 3300006237 | Bacteria | 859 |
| 169 | Ga0075370_10306692 | 3300006353 | Bacteria | 945 |
| 170 | Ga0068871_100005514 | 3300006358 | Bacteria | 8875 |
| 171 | Ga0068871_100012344 | 3300006358 | Bacteria | 6294 |
| 172 | Ga0068871_100084135 | 3300006358 | Bacteria | 2640 |
| 173 | Ga0075433_10286694 | 3300006852 | Unclassified | 1458 |
| 174 | Ga0075429_100583814 | 3300006880 | Bacteria | 979 |
| 175 | Ga0068865_100000462 | 3300006881 | Bacteria | 22708 |
| 176 | Ga0068865_100013318 | 3300006881 | Bacteria | 5196 |
| 177 | Ga0097620_101732031 | 3300006931 | Bacteria | 690 |
| 178 | Ga0075435_100470464 | 3300007076 | Bacteria | 1085 |
| 179 | Ga0099795_10326251 | 3300007788 | Unclassified | 681 |
| 180 | Ga0105240_10007047 | 3300009093 | Bacteria | 16398 |
| 181 | Ga0111539_10048674 | 3300009094 | Bacteria | 5060 |
| 182 | Ga0111539_10387272 | 3300009094 | Bacteria | 1628 |
| 183 | Ga0105245_10015121 | 3300009098 | Bacteria | 6722 |
| 184 | Ga0105245_10158539 | 3300009098 | Bacteria | 2146 |
| 185 | Ga0105245_10823160 | 3300009098 | Bacteria | 967 |
| 186 | Ga0105243_10000049 | 3300009148 | Bacteria | 145575 |
| 187 | Ga0105242_10451840 | 3300009176 | Bacteria | 1211 |
| 188 | Ga0105248_10312261 | 3300009177 | Bacteria | 1770 |
| 189 | Ga0105237_10009019 | 3300009545 | Bacteria | 10721 |
| 190 | Ga0105237_10044182 | 3300009545 | Bacteria | 4486 |
| 191 | Ga0105237_10385391 | 3300009545 | Bacteria | 1407 |
| 192 | Ga0099796_10040234 | 3300010159 | Bacteria | 1577 |
| 193 | Ga0105239_10048890 | 3300010375 | Bacteria | 4637 |
| 194 | Ga0157373_10004932 | 3300013100 | Bacteria | 10042 |
| 195 | Ga0157371_10058341 | 3300013102 | Bacteria | 2738 |
| 196 | Ga0157371_10247936 | 3300013102 | Bacteria | 1282 |
| 197 | Ga0157374_10000026 | 3300013296 | Bacteria | 238236 |
| 198 | Ga0157374_10001473 | 3300013296 | Bacteria | 19879 |
| 199 | Ga0157374_10017996 | 3300013296 | Bacteria | 6230 |
| 200 | Ga0157374_10055882 | 3300013296 | Bacteria | 3685 |
| 201 | Ga0157374_10121480 | 3300013296 | Bacteria | 2521 |
| 202 | Ga0157374_10127435 | 3300013296 | Bacteria | 2461 |
| 203 | Ga0157374_10498498 | 3300013296 | Bacteria | 1222 |
| 204 | Ga0157374_10569942 | 3300013296 | Bacteria | 1141 |
| 205 | Ga0157374_11100808 | 3300013296 | Bacteria | 815 |
| 206 | Ga0157374_11130585 | 3300013296 | Bacteria | 804 |
| 207 | Ga0157374_11937884 | 3300013296 | Bacteria | 615 |
| 208 | Ga0157378_10001234 | 3300013297 | Bacteria | 23136 |
| 209 | Ga0157378_10005509 | 3300013297 | Bacteria | 11097 |
| 210 | Ga0157378_10026553 | 3300013297 | Bacteria | 5104 |
| 211 | Ga0157378_10043528 | 3300013297 | Bacteria | 3987 |
| 212 | Ga0157378_10058061 | 3300013297 | Bacteria | 3451 |
| 213 | Ga0157378_10107467 | 3300013297 | Bacteria | 2553 |
| 214 | Ga0157378_10119918 | 3300013297 | Bacteria | 2423 |
| 215 | Ga0157378_10174062 | 3300013297 | Unclassified | 2021 |
| 216 | Ga0163162_10017445 | 3300013306 | Bacteria | 7024 |
| 217 | Ga0163162_10023520 | 3300013306 | Bacteria | 6081 |
| 218 | Ga0163162_10052794 | 3300013306 | Bacteria | 4083 |
| 219 | Ga0163162_10370423 | 3300013306 | Bacteria | 1565 |
| 220 | Ga0163162_10410273 | 3300013306 | Bacteria | 1487 |
| 221 | Ga0157372_10167743 | 3300013307 | Bacteria | 2539 |
| 222 | Ga0157372_10360562 | 3300013307 | Bacteria | 1694 |
| 223 | Ga0157372_10631782 | 3300013307 | Bacteria | 1247 |
| 224 | Ga0157372_11295485 | 3300013307 | Bacteria | 841 |
| 225 | Ga0157375_10001868 | 3300013308 | Bacteria | 18135 |
| 226 | Ga0157375_10044228 | 3300013308 | Bacteria | 4324 |
| 227 | Ga0157375_10082239 | 3300013308 | Bacteria | 3261 |
| 228 | Ga0157375_10144146 | 3300013308 | Bacteria | 2511 |
| 229 | Ga0157375_10198646 | 3300013308 | Bacteria | 2161 |
| 230 | Ga0157375_10668197 | 3300013308 | Bacteria | 1194 |
| 231 | Ga0157377_10033289 | 3300014745 | Bacteria | 2813 |
| 232 | Ga0157376_10000112 | 3300014969 | Bacteria | 58430 |
| 233 | Ga0157376_10031061 | 3300014969 | Bacteria | 4273 |
| 234 | Ga0157376_10102835 | 3300014969 | Bacteria | 2500 |
| 235 | Ga0157376_10390349 | 3300014969 | Bacteria | 1343 |
| 236 | Ga0157376_11254406 | 3300014969 | Bacteria | 770 |
| 237 | Ga0163161_10042654 | 3300017792 | Bacteria | 3264 |
| 238 | Ga0163161_10245059 | 3300017792 | Bacteria | 1395 |
| 239 | Ga0206355_1200566 | 3300020076 | Bacteria | 843 |
| 240 | Ga0213873_10016590 | 3300021358 | Bacteria | 1667 |
| 241 | Ga0213873_10030819 | 3300021358 | Bacteria | 1330 |
| 242 | Ga0213872_10010006 | 3300021361 | Bacteria | 4525 |
| 243 | Ga0213872_10158708 | 3300021361 | Bacteria | 985 |
| 244 | Ga0213874_10001478 | 3300021377 | Bacteria | 4877 |
| 245 | Ga0213876_10000361 | 3300021384 | Bacteria | 38897 |
| 246 | Ga0213876_10073114 | 3300021384 | Bacteria | 1810 |
| 247 | Ga0213876_10483064 | 3300021384 | Bacteria | 659 |
| 248 | Ga0213875_10079664 | 3300021388 | Bacteria | 1528 |
| 249 | Ga0213871_10012351 | 3300021441 | Bacteria | 1982 |
| 250 | Ga0209050_1000629 | 3300025298 | Bacteria | 54939 |
| 251 | Ga0207697_10000131 | 3300025315 | Bacteria | 36154 |
| 252 | Ga0207697_10002322 | 3300025315 | Bacteria | 9909 |
| 253 | Ga0207697_10031631 | 3300025315 | Bacteria | 2165 |
| 254 | Ga0207642_10062069 | 3300025899 | Bacteria | 1741 |
| 255 | Ga0207642_10063829 | 3300025899 | Bacteria | 1724 |
| 256 | Ga0207688_10001208 | 3300025901 | Bacteria | 13377 |
| 257 | Ga0207688_10042403 | 3300025901 | Bacteria | 2533 |
| 258 | Ga0207680_10104042 | 3300025903 | Bacteria | 1829 |
| 259 | Ga0207680_10150458 | 3300025903 | Bacteria | 1551 |
| 260 | Ga0207680_10205844 | 3300025903 | Bacteria | 1343 |
| 261 | Ga0207685_10139437 | 3300025905 | Unclassified | 1086 |
| 262 | Ga0207685_10171988 | 3300025905 | Bacteria | 997 |
| 263 | Ga0207699_10181274 | 3300025906 | Bacteria | 1416 |
| 264 | Ga0207645_10001641 | 3300025907 | Bacteria | 18232 |
| 265 | Ga0207645_10002762 | 3300025907 | Bacteria | 13659 |
| 266 | Ga0207705_10033535 | 3300025909 | Bacteria | 3669 |
| 267 | Ga0207684_10019695 | 3300025910 | Bacteria | 5771 |
| 268 | Ga0207684_10048446 | 3300025910 | Bacteria | 3604 |
| 269 | Ga0207684_10151385 | 3300025910 | Bacteria | 1996 |
| 270 | Ga0207684_10252293 | 3300025910 | Bacteria | 1522 |
| 271 | Ga0207695_10002221 | 3300025913 | Bacteria | 29193 |
| 272 | Ga0207695_10008540 | 3300025913 | Bacteria | 12801 |
| 273 | Ga0207671_10020842 | 3300025914 | Bacteria | 4985 |
| 274 | Ga0207671_10025222 | 3300025914 | Bacteria | 4465 |
| 275 | Ga0207693_10000889 | 3300025915 | Bacteria | 26818 |
| 276 | Ga0207693_10092069 | 3300025915 | Bacteria | 2376 |
| 277 | Ga0207693_10389591 | 3300025915 | Bacteria | 1090 |
| 278 | Ga0207663_10005429 | 3300025916 | Bacteria | 6420 |
| 279 | Ga0207663_10396750 | 3300025916 | Bacteria | 1054 |
| 280 | Ga0207662_10432993 | 3300025918 | Bacteria | 897 |
| 281 | Ga0207657_10066683 | 3300025919 | Bacteria | 3063 |
| 282 | Ga0207657_10073181 | 3300025919 | Bacteria | 2897 |
| 283 | Ga0207649_10007825 | 3300025920 | Bacteria | 5815 |
| 284 | Ga0207649_10150356 | 3300025920 | Bacteria | 1603 |
| 285 | Ga0207646_10005692 | 3300025922 | Bacteria | 13070 |
| 286 | Ga0207646_10084385 | 3300025922 | Bacteria | 2842 |
| 287 | Ga0207646_10137954 | 3300025922 | Bacteria | 2196 |
| 288 | Ga0207681_10014902 | 3300025923 | Bacteria | 4842 |
| 289 | Ga0207681_10072736 | 3300025923 | Bacteria | 2402 |
| 290 | Ga0207681_10175206 | 3300025923 | Unclassified | 1629 |
| 291 | Ga0207650_10006836 | 3300025925 | Bacteria | 7782 |
| 292 | Ga0207650_10018287 | 3300025925 | Bacteria | 4917 |
| 293 | Ga0207659_10020696 | 3300025926 | Bacteria | 4353 |
| 294 | Ga0207659_10045484 | 3300025926 | Bacteria | 3095 |
| 295 | Ga0207659_10179827 | 3300025926 | Bacteria | 1675 |
| 296 | Ga0207659_10419064 | 3300025926 | Bacteria | 1123 |
| 297 | Ga0207659_10469124 | 3300025926 | Bacteria | 1062 |
| 298 | Ga0207659_10682627 | 3300025926 | Bacteria | 879 |
| 299 | Ga0207687_10051760 | 3300025927 | Bacteria | 2863 |
| 300 | Ga0207700_10318513 | 3300025928 | Bacteria | 1347 |
| 301 | Ga0207664_10120019 | 3300025929 | Bacteria | 2199 |
| 302 | Ga0207644_10035251 | 3300025931 | Bacteria | 3504 |
| 303 | Ga0207644_10049869 | 3300025931 | Bacteria | 2998 |
| 304 | Ga0207644_10237270 | 3300025931 | Bacteria | 1451 |
| 305 | Ga0207644_10266435 | 3300025931 | Bacteria | 1371 |
| 306 | Ga0207690_10023803 | 3300025932 | Bacteria | 3828 |
| 307 | Ga0207690_10086786 | 3300025932 | Unclassified | 2200 |
| 308 | Ga0207706_10027339 | 3300025933 | Bacteria | 5102 |
| 309 | Ga0207709_10000097 | 3300025935 | Bacteria | 136507 |
| 310 | Ga0207669_10002532 | 3300025937 | Bacteria | 7802 |
| 311 | Ga0207669_10073225 | 3300025937 | Bacteria | 2160 |
| 312 | Ga0207704_10040566 | 3300025938 | Bacteria | 2722 |
| 313 | Ga0207665_10025655 | 3300025939 | Bacteria | 3889 |
| 314 | Ga0207665_10140744 | 3300025939 | Bacteria | 1720 |
| 315 | Ga0207665_10180266 | 3300025939 | Bacteria | 1529 |
| 316 | Ga0207691_10000247 | 3300025940 | Bacteria | 53502 |
| 317 | Ga0207691_10016028 | 3300025940 | Bacteria | 7119 |
| 318 | Ga0207691_10228367 | 3300025940 | Bacteria | 1612 |
| 319 | Ga0207691_10235331 | 3300025940 | Bacteria | 1585 |
| 320 | Ga0207711_10232457 | 3300025941 | Bacteria | 1689 |
| 321 | Ga0207661_10077884 | 3300025944 | Bacteria | 2728 |
| 322 | Ga0207679_10000541 | 3300025945 | Bacteria | 25439 |
| 323 | Ga0207679_10279684 | 3300025945 | Bacteria | 1431 |
| 324 | Ga0207679_10374795 | 3300025945 | Bacteria | 1246 |
| 325 | Ga0207667_10766901 | 3300025949 | Bacteria | 963 |
| 326 | Ga0207651_10007253 | 3300025960 | Bacteria | 5894 |
| 327 | Ga0207651_10019560 | 3300025960 | Bacteria | 4061 |
| 328 | Ga0207651_10027669 | 3300025960 | Bacteria | 3565 |
| 329 | Ga0207651_10634914 | 3300025960 | Bacteria | 936 |
| 330 | Ga0207668_10035962 | 3300025972 | Bacteria | 3303 |
| 331 | Ga0207668_10057405 | 3300025972 | Bacteria | 2715 |
| 332 | Ga0207668_10156576 | 3300025972 | Bacteria | 1770 |
| 333 | Ga0207668_10203825 | 3300025972 | Bacteria | 1577 |
| 334 | Ga0207668_10629956 | 3300025972 | Bacteria | 937 |
| 335 | Ga0207668_10931305 | 3300025972 | Bacteria | 774 |
| 336 | Ga0207668_10957154 | 3300025972 | Bacteria | 764 |
| 337 | Ga0207658_10302012 | 3300025986 | Bacteria | 1379 |
| 338 | Ga0207677_10008042 | 3300026023 | Bacteria | 5871 |
| 339 | Ga0207677_10021108 | 3300026023 | Bacteria | 3973 |
| 340 | Ga0207677_10021545 | 3300026023 | Bacteria | 3940 |
| 341 | Ga0207677_10111866 | 3300026023 | Bacteria | 2035 |
| 342 | Ga0207677_10252081 | 3300026023 | Bacteria | 1434 |
| 343 | Ga0207703_10024292 | 3300026035 | Bacteria | 4768 |
| 344 | Ga0207703_10175845 | 3300026035 | Bacteria | 1886 |
| 345 | Ga0207639_10621551 | 3300026041 | Bacteria | 997 |
| 346 | Ga0207702_10003580 | 3300026078 | Bacteria | 14118 |
| 347 | Ga0207702_10038562 | 3300026078 | Bacteria | 4001 |
| 348 | Ga0207641_10005226 | 3300026088 | Bacteria | 11107 |
| 349 | Ga0207641_10452994 | 3300026088 | Bacteria | 1240 |
| 350 | Ga0207641_10626592 | 3300026088 | Bacteria | 1055 |
| 351 | Ga0207648_10000083 | 3300026089 | Bacteria | 89416 |
| 352 | Ga0207648_10237363 | 3300026089 | Bacteria | 1623 |
| 353 | Ga0207674_10107042 | 3300026116 | Bacteria | 2773 |
| 354 | Ga0207675_100323714 | 3300026118 | Bacteria | 1506 |
| 355 | Ga0207683_10006308 | 3300026121 | Bacteria | 10158 |
| 356 | Ga0207683_10006977 | 3300026121 | Bacteria | 9683 |
| 357 | Ga0207683_10008842 | 3300026121 | Bacteria | 8591 |
| 358 | Ga0207683_10015583 | 3300026121 | Bacteria | 6470 |
| 359 | Ga0207698_10222182 | 3300026142 | Bacteria | 1708 |
| 360 | Ga0207698_10283620 | 3300026142 | Bacteria | 1533 |
| 361 | Ga0207698_10923389 | 3300026142 | Bacteria | 881 |
| 362 | Ga0209974_10022093 | 3300027876 | Bacteria | 2107 |
| 363 | Ga0207428_10514354 | 3300027907 | Bacteria | 868 |
| 364 | Ga0268266_10000251 | 3300028379 | Bacteria | 91204 |
| 365 | Ga0268266_10097330 | 3300028379 | Bacteria | 2588 |
| 366 | Ga0268266_10238441 | 3300028379 | Bacteria | 1677 |
| 367 | Ga0268266_10325400 | 3300028379 | Bacteria | 1440 |
| 368 | Ga0268266_10501180 | 3300028379 | Bacteria | 1159 |
| 369 | Ga0268266_11148552 | 3300028379 | Bacteria | 751 |
| 370 | Ga0268265_10116094 | 3300028380 | Bacteria | 2196 |
| 371 | Ga0268264_10001807 | 3300028381 | Bacteria | 19555 |
| 372 | Ga0268264_10149965 | 3300028381 | Bacteria | 2089 |
| 373 | Ga0268264_10473591 | 3300028381 | Bacteria | 1217 |
| 374 | Ga0265318_10001452 | 3300028577 | Bacteria | 13930 |
| 375 | Ga0307511_10000117 | 3300030521 | Bacteria | 71587 |
| 376 | Ga0307512_10104901 | 3300030522 | Bacteria | 1894 |
| 377 | Ga0265328_10052198 | 3300031239 | Bacteria | 1501 |
| 378 | Ga0265320_10013095 | 3300031240 | Bacteria | 4785 |
| 379 | Ga0265327_10011153 | 3300031251 | Bacteria | 6230 |
| 380 | Ga0265316_10186665 | 3300031344 | Bacteria | 1542 |
| 381 | Ga0307408_100000009 | 3300031548 | Bacteria | 426576 |
| 382 | Ga0307408_100000021 | 3300031548 | Bacteria | 312158 |
| 383 | Ga0307408_100414755 | 3300031548 | Bacteria | 1159 |
| 384 | Ga0265313_10004186 | 3300031595 | Bacteria | 11195 |
| 385 | Ga0307413_10364847 | 3300031824 | Bacteria | 1119 |
| 386 | Ga0307410_10000097 | 3300031852 | Bacteria | 30229 |
| 387 | Ga0307407_10000468 | 3300031903 | Bacteria | 12384 |
| 388 | Ga0307409_100000037 | 3300031995 | Bacteria | 47029 |
| 389 | Ga0307416_100000018 | 3300032002 | Bacteria | 200227 |
| 390 | Ga0307411_10054437 | 3300032005 | Bacteria | 2627 |
| 391 | Ga0316593_10000659 | 3300032168 | Bacteria | 6648 |
| 392 | Ga0373944_0080838 | 3300035089 | Bacteria | 1073 |
| 393 | Ga0373945_0053651 | 3300035116 | Bacteria | 1489 |
| 394 | Ga0373945_0059303 | 3300035116 | Unclassified | 1425 |
| 395 | Ga0373945_0232692 | 3300035116 | Bacteria | 774 |
| 396 | Ga0373957_0405744 | 3300035120 | Bacteria | 587 |
| 397 | Ga0373943_0005531 | 3300035170 | Bacteria | 5673 |
| 398 | Ga0373943_0092490 | 3300035170 | Bacteria | 1568 |
| 399 | Ga0373946_0078616 | 3300035171 | Bacteria | 1440 |
| 400 | Ga0373946_0096119 | 3300035171 | Unclassified | 1321 |
| 401 | Ga0373955_0008379 | 3300035172 | Bacteria | 4800 |
| 402 | Ga0316574_0010564 | 3300035398 | Bacteria | 5224 |
| 403 | Ga0373931_0036970 | 3300035691 | Bacteria | 2548 |
| 404 | Ga0373935_0067275 | 3300035692 | Bacteria | 2303 |
| 405 | Ga0373927_0200535 | 3300035695 | Bacteria | 1310 |
| 406 | Ga0373927_0608304 | 3300035695 | Bacteria | 722 |
| 407 | Ga0373933_0052084 | 3300035724 | Bacteria | 2448 |
| 408 | Ga0373933_0108221 | 3300035724 | Bacteria | 1731 |
| 409 | Ga0373947_0015443 | 3300035725 | Bacteria | 4383 |
| 410 | Ga0373947_0159967 | 3300035725 | Unclassified | 1456 |
| 411 | Ga0373947_0173463 | 3300035725 | Bacteria | 1400 |
| 412 | Ga0373937_0282498 | 3300036401 | Bacteria | 1567 |
| 413 | Ga0373937_0331794 | 3300036401 | Unclassified | 1440 |
| 414 | Ga0373937_0824342 | 3300036401 | Unclassified | 876 |
| 415 | Ga0373925_0014401 | 3300037068 | Bacteria | 5718 |
| 416 | Ga0373925_0155902 | 3300037068 | Bacteria | 1796 |
| 417 | Ga0373925_0501751 | 3300037068 | Bacteria | 996 |
| 418 | Ga0395899_0000039 | 3300037312 | Bacteria | 269620 |
| 419 | Ga0395900_0002526 | 3300037418 | Bacteria | 20035 |
| 420 | Ga0395898_0000226 | 3300037466 | Bacteria | 144727 |
| 421 | Ga0395898_0079141 | 3300037466 | Bacteria | 3171 |
| 422 | Ga0436364_0070502 | 3300037853 | Bacteria | 2321 |
| 423 | Ga0436364_0339363 | 3300037853 | Bacteria | 2525 |
| 424 | Ga0436364_0785290 | 3300037853 | Bacteria | 2181 |
| 425 | Ga0395901_0039538 | 3300038443 | Bacteria | 4881 |
| 426 | Ga0436365_0798127 | 3300039437 | Bacteria | 1243 |
| 427 | Ga0436365_1314581 | 3300039437 | Bacteria | 1388 |
| 428 | Ga0436365_1383407 | 3300039437 | Bacteria | 77328 |
| 429 | Ga0436360_0051782 | 3300039438 | Bacteria | 1147 |
| 430 | Ga0436360_0111982 | 3300039438 | Bacteria | 10219 |
| 431 | Ga0436360_0751309 | 3300039438 | Bacteria | 1931 |
| 432 | Ga0436360_0817873 | 3300039438 | Bacteria | 4105 |
| 433 | Ga0436360_0823493 | 3300039438 | Unclassified | 2742 |
| 434 | Ga0436361_0088096 | 3300039447 | Bacteria | 12647 |
| 435 | Ga0436361_0096493 | 3300039447 | Unclassified | 782 |
| 436 | Ga0436361_0363848 | 3300039447 | Bacteria | 21994 |
| 437 | Ga0436361_0382718 | 3300039447 | Bacteria | 2021 |
| 438 | Ga0436361_0960224 | 3300039447 | Bacteria | 2589 |
| 439 | Ga0436361_1103431 | 3300039447 | Bacteria | 1468 |
| 440 | Ga0436363_0072645 | 3300039450 | Bacteria | 6996 |
| 441 | Ga0436362_0931802 | 3300039453 | Unclassified | 3056 |
| 442 | Ga0436362_1110217 | 3300039453 | Unclassified | 1534 |
| 443 | Ga0439453_0000086 | 3300041408 | Bacteria | 7091 |
| 444 | Ga0451807_0122896 | 3300041486 | Bacteria | 635 |
| 445 | Ga0451853_3388316 | 3300041512 | Bacteria | 732 |
| 446 | Ga0450888_001605 | 3300042126 | Bacteria | 2179 |
| 447 | Ga0450890_000001 | 3300042127 | Bacteria | 192635 |
| 448 | Ga0450891_002487 | 3300042129 | Bacteria | 1853 |
| 449 | Ga0450893_0005197 | 3300042532 | Bacteria | 2083 |
| 450 | Ga0451577_0186388 | 3300042876 | Bacteria | 1871 |
| 451 | Ga0453683_0004775 | 3300044673 | Bacteria | 9552 |
| 452 | Ga0466965_0058570 | 3300044683 | Bacteria | 1921 |
| 453 | Ga0453684_0000516 | 3300044712 | Bacteria | 147788 |
| 454 | Ga0453684_0109566 | 3300044712 | Bacteria | 3358 |
| 455 | Ga0466971_0000005 | 3300044719 | Bacteria | 137073 |
| 456 | Ga0466957_0069306 | 3300044842 | Bacteria | 2178 |
| 457 | Ga0451576_0024674 | 3300045051 | Bacteria | 6490 |
| 458 | Ga0451576_0027216 | 3300045051 | Bacteria | 6143 |
| 459 | Ga0466967_0088574 | 3300045976 | Bacteria | 2809 |
| 460 | Ga0495592_0102898 | 3300046454 | Bacteria | 2033 |
| 461 | Ga0495651_0162026 | 3300046462 | Bacteria | 1601 |
| 462 | Ga0495580_0109086 | 3300046472 | Bacteria | 1922 |
| 463 | Ga0495605_0063477 | 3300046474 | Bacteria | 1762 |
| 464 | Ga0495584_0022505 | 3300046491 | Bacteria | 3197 |
| 465 | Ga0495585_0065325 | 3300046492 | Bacteria | 1994 |
| 466 | Ga0495608_0095489 | 3300046511 | Bacteria | 1921 |
| 467 | Ga0495618_0068826 | 3300046514 | Bacteria | 2251 |
| 468 | Ga0495628_0040395 | 3300046516 | Bacteria | 3728 |
| 469 | Ga0495630_0017678 | 3300046517 | Bacteria | 5227 |
| 470 | Ga0495663_0019332 | 3300046525 | Bacteria | 1949 |
| 471 | Ga0495642_0022869 | 3300046528 | Bacteria | 2465 |
| 472 | Ga0495652_0018013 | 3300046529 | Bacteria | 6301 |
| 473 | Ga0495598_0000901 | 3300046537 | Bacteria | 5725 |
| 474 | Ga0495598_0043361 | 3300046537 | Unclassified | 1325 |
| 475 | Ga0495645_0063981 | 3300046543 | Bacteria | 2662 |
| 476 | Ga0495633_0056070 | 3300046558 | Unclassified | 1852 |
| 477 | Ga0495656_0049027 | 3300046615 | Bacteria | 1797 |
| 478 | Ga0495634_0048412 | 3300046642 | Bacteria | 2862 |
| 479 | Ga0495661_0193660 | 3300046665 | Unclassified | 1069 |
| 480 | Ga0495599_0142934 | 3300046678 | Bacteria | 1484 |
| 481 | Ga0495658_0011003 | 3300046683 | Bacteria | 4538 |
| 482 | Ga0495669_0009247 | 3300046684 | Bacteria | 4152 |
| 483 | Ga0495670_0082094 | 3300046691 | Bacteria | 1643 |
| 484 | Ga0495649_0204851 | 3300046694 | Bacteria | 1024 |
| 485 | Ga0495581_0106207 | 3300047315 | Bacteria | 1632 |
| 486 | Ga0495674_0415532 | 3300047319 | Bacteria | 1084 |
| 487 | Ga0495675_0002584 | 3300047444 | Bacteria | 10850 |
| 488 | Ga0495677_0064905 | 3300047445 | Unclassified | 1357 |
| 489 | Ga0495684_0164535 | 3300047471 | Unclassified | 1653 |
| 490 | Ga0495602_0309980 | 3300048088 | Bacteria | 1152 |
| 491 | Ga0496100_0021201 | 3300048903 | Bacteria | 3910 |
| 492 | Ga0496100_0356210 | 3300048903 | Bacteria | 1106 |
| 493 | Ga0496101_0031362 | 3300048904 | Bacteria | 3735 |
| 494 | Ga0496102_0009851 | 3300048905 | Bacteria | 8216 |
| 495 | Ga0496102_0251367 | 3300048905 | Unclassified | 1667 |
| 496 | Ga0496103_0011535 | 3300048906 | Bacteria | 5238 |
| 497 | Ga0496104_0014963 | 3300048907 | Bacteria | 7017 |
| 498 | Ga0496104_0356276 | 3300048907 | Bacteria | 1376 |
| 499 | Ga0496106_0002174 | 3300048909 | Bacteria | 14655 |
| 500 | Ga0496106_0264949 | 3300048909 | Bacteria | 1375 |
| 501 | Ga0496106_0292110 | 3300048909 | Bacteria | 1307 |
| 502 | Ga0496107_0018540 | 3300048910 | Bacteria | 4901 |
| 503 | Ga0496107_0286116 | 3300048910 | Bacteria | 1227 |
| 504 | Ga0496108_0042309 | 3300048911 | Bacteria | 3803 |
| 505 | Ga0496109_0040844 | 3300048912 | Bacteria | 4202 |
| 506 | Ga0496109_0241538 | 3300048912 | Unclassified | 1700 |
| 507 | Ga0496109_0287838 | 3300048912 | Bacteria | 1549 |
| 508 | Ga0496109_0327535 | 3300048912 | Unclassified | 1446 |
| 509 | Ga0496110_0132415 | 3300048913 | Bacteria | 2252 |
| 510 | Ga0496110_0330391 | 3300048913 | Bacteria | 1389 |
| 511 | Ga0496111_0102523 | 3300048914 | Bacteria | 2104 |
| 512 | Ga0496112_0017121 | 3300048915 | Bacteria | 6804 |
| 513 | Ga0496112_0046152 | 3300048915 | Bacteria | 4272 |
| 514 | Ga0496112_0050307 | 3300048915 | Bacteria | 4086 |
| 515 | Ga0496112_0161160 | 3300048915 | Bacteria | 2210 |
| 516 | Ga0496112_0273283 | 3300048915 | Unclassified | 1638 |
| 517 | Ga0496113_0188201 | 3300048916 | Bacteria | 1638 |
| 518 | Ga0496113_0476967 | 3300048916 | Unclassified | 1002 |
| 519 | Ga0496113_0528149 | 3300048916 | Bacteria | 947 |
| 520 | Ga0496114_0172612 | 3300048917 | Bacteria | 1885 |
| 521 | Ga0496115_0009615 | 3300048918 | Bacteria | 7191 |
| 522 | Ga0496121_0548309 | 3300048924 | Bacteria | 724 |
| 523 | Ga0496124_0198492 | 3300048927 | Bacteria | 1528 |
| 524 | Ga0496125_0000110 | 3300048928 | Bacteria | 192693 |
| 525 | Ga0501308_002090 | 3300049128 | Bacteria | 1710 |
| 526 | Ga0501310_000737 | 3300049130 | Bacteria | 2892 |
| 527 | Ga0501304_000153 | 3300049160 | Bacteria | 2865 |
| 528 | Ga0501305_000001 | 3300049161 | Bacteria | 19709 |
| 529 | Ga0501305_015896 | 3300049161 | Bacteria | 1067 |
| 530 | Ga0501307_000001 | 3300049162 | Bacteria | 10981 |
| 531 | Ga0501312_000001 | 3300049528 | Bacteria | 18666 |
| 532 | Ga0501316_006032 | 3300049532 | Bacteria | 1277 |
| 533 | Ga0501317_004444 | 3300049533 | Bacteria | 1459 |
| 534 | Ga0501320_001877 | 3300049536 | Bacteria | 1608 |
| 535 | Ga0501031_0000635 | 3300049568 | Bacteria | 20764 |
| 536 | Ga0501032_0000390 | 3300049569 | Bacteria | 36137 |
| 537 | Ga0501032_0046887 | 3300049569 | Bacteria | 2920 |
| 538 | Ga0501032_0244194 | 3300049569 | Bacteria | 1166 |
| 539 | Ga0501033_0000003 | 3300049570 | Bacteria | 586973 |
| 540 | Ga0501033_0000015 | 3300049570 | Bacteria | 218502 |
| 541 | Ga0501033_0006719 | 3300049570 | Bacteria | 8988 |
| 542 | Ga0501036_0013849 | 3300049572 | Bacteria | 6707 |
| 543 | Ga0501037_0000295 | 3300049573 | Bacteria | 42165 |
| 544 | Ga0501037_0011831 | 3300049573 | Bacteria | 6427 |
| 545 | Ga0501038_0000480 | 3300049574 | Bacteria | 35161 |
| 546 | Ga0501038_0073690 | 3300049574 | Bacteria | 2890 |
| 547 | Ga0501038_0456810 | 3300049574 | Bacteria | 981 |
| 548 | Ga0501039_0022279 | 3300049575 | Bacteria | 4863 |
| 549 | Ga0501039_0284451 | 3300049575 | Bacteria | 1300 |
| 550 | Ga0501041_0177330 | 3300049577 | Bacteria | 1334 |
| 551 | Ga0501043_0069626 | 3300049579 | Bacteria | 2763 |
| 552 | Ga0501043_0289131 | 3300049579 | Bacteria | 1255 |
| 553 | Ga0501046_0005999 | 3300049580 | Bacteria | 10806 |
| 554 | Ga0501047_0009121 | 3300049581 | Bacteria | 9369 |
| 555 | Ga0501047_0042858 | 3300049581 | Bacteria | 4372 |
| 556 | Ga0501047_0086476 | 3300049581 | Bacteria | 3012 |
| 557 | Ga0501048_0015870 | 3300049582 | Bacteria | 5558 |
| 558 | Ga0501070_0002360 | 3300049586 | Bacteria | 16550 |
| 559 | Ga0501070_0033242 | 3300049586 | Bacteria | 4316 |
| 560 | Ga0501070_0142209 | 3300049586 | Bacteria | 1981 |
| 561 | Ga0501071_0074202 | 3300049587 | Bacteria | 2483 |
| 562 | Ga0501080_0023861 | 3300049742 | Bacteria | 5668 |
| 563 | Ga0501080_0345987 | 3300049742 | Bacteria | 1343 |
| 564 | Ga0501083_0059867 | 3300049744 | Bacteria | 2546 |
| 565 | Ga0501035_0000004 | 3300049822 | Bacteria | 403650 |
| 566 | Ga0501035_0040870 | 3300049822 | Bacteria | 4189 |
| 567 | Ga0501044_0000740 | 3300049823 | Bacteria | 39382 |
| 568 | Ga0501045_0827532 | 3300049824 | Bacteria | 681 |
| 569 | nmdc:mga03683_281_c1 | 3300050489 | Bacteria | 15224 |
| 570 | nmdc:mga03683_93017_c1 | 3300050489 | Bacteria | 1317 |
| 571 | nmdc:mga03n38_195087_c1 | 3300050490 | Bacteria | 1045 |
| 572 | nmdc:mga03n38_86065_c1 | 3300050490 | Bacteria | 1487 |
| 573 | nmdc:mga0k408_12560_c1 | 3300050493 | Bacteria | 4632 |
| 574 | nmdc:mga0k408_1699_c1 | 3300050493 | Bacteria | 11859 |
| 575 | nmdc:mga08y16_168750_c1 | 3300050511 | Bacteria | 2273 |
| 576 | nmdc:mga08y16_94064_c1 | 3300050511 | Bacteria | 3122 |
| 577 | nmdc:mga0rr50_168592_c1 | 3300050513 | Bacteria | 1782 |
| 578 | nmdc:mga08x19_555035_c1 | 3300050514 | Unclassified | 813 |
| 579 | nmdc:mga08x19_81630_c1 | 3300050514 | Bacteria | 2123 |
| 580 | Ga0495601_0267157 | 3300053077 | Bacteria | 1116 |
| 581 | Ga0495619_0109404 | 3300053085 | Bacteria | 1887 |
| 582 | Ga0500555_000015 | 3300053103 | Bacteria | 230204 |
| 583 | Ga0500555_000055 | 3300053103 | Bacteria | 58298 |
| 584 | Ga0500556_0000420 | 3300053104 | Bacteria | 30531 |
| 585 | Ga0500556_0002977 | 3300053104 | Bacteria | 5115 |
| 586 | Ga0500642_0004954 | 3300053130 | Bacteria | 4237 |
| 587 | Ga0500642_0123785 | 3300053130 | Bacteria | 1210 |
| 588 | Ga0500658_0073733 | 3300053134 | Bacteria | 1446 |
| 589 | Ga0500559_0000861 | 3300053136 | Bacteria | 19493 |
| 590 | Ga0500616_0006731 | 3300053153 | Bacteria | 7458 |
| 591 | Ga0500616_0006989 | 3300053153 | Bacteria | 7263 |
| 592 | Ga0500645_012211 | 3300053730 | Bacteria | 2780 |
| 593 | Ga0466962_0000007 | 3300061719 | Bacteria | 157857 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049162 | Ga0501307_000001 | Ga0501307_000001_9519_10127 | 162 |
| 2 | 3300049533 | Ga0501317_004444 | Ga0501317_004444_25_636 | 162 |
| 3 | 3300028577 | Ga0265318_10001452 | Ga0265318_1000145213 | 163 |
| 4 | 3300031240 | Ga0265320_10013095 | Ga0265320_100130954 | 163 |
| 5 | 3300049161 | Ga0501305_015896 | Ga0501305_015896_278_886 | 163 |
| 6 | 3300049570 | Ga0501033_0006719 | Ga0501033_0006719_2289_2906 | 163 |
| 7 | 3300049573 | Ga0501037_0011831 | Ga0501037_0011831_49_666 | 163 |
| 8 | 3300049574 | Ga0501038_0456810 | Ga0501038_0456810_303_920 | 163 |
| 9 | 3300049579 | Ga0501043_0289131 | Ga0501043_0289131_200_817 | 163 |
| 10 | 3300049580 | Ga0501046_0005999 | Ga0501046_0005999_3409_4026 | 163 |
| 11 | 3300049581 | Ga0501047_0042858 | Ga0501047_0042858_388_1005 | 163 |
| 12 | 3300049581 | Ga0501047_0086476 | Ga0501047_0086476_954_1571 | 163 |
| 13 | 3300049582 | Ga0501048_0015870 | Ga0501048_0015870_3816_4433 | 163 |
| 14 | 3300049586 | Ga0501070_0033242 | Ga0501070_0033242_2696_3313 | 163 |
| 15 | 3300049822 | Ga0501035_0040870 | Ga0501035_0040870_151_768 | 163 |
| 16 | 3300049128 | Ga0501308_002090 | Ga0501308_002090_822_1475 | 164 |
| 17 | 3300049160 | Ga0501304_000153 | Ga0501304_000153_112_765 | 164 |
| 18 | 3300049161 | Ga0501305_000001 | Ga0501305_000001_6853_7506 | 164 |
| 19 | 3300049528 | Ga0501312_000001 | Ga0501312_000001_12197_12850 | 164 |
| 20 | 3300005459 | Ga0068867_100007340 | Ga0068867_1000073403 | 165 |
| 21 | 3300006237 | Ga0097621_100605107 | Ga0097621_1006051072 | 165 |
| 22 | 3300006358 | Ga0068871_100005514 | Ga0068871_1000055147 | 165 |
| 23 | 3300006881 | Ga0068865_100000462 | Ga0068865_1000004623 | 165 |
| 24 | 3300030521 | Ga0307511_10000117 | Ga0307511_1000011742 | 165 |
| 25 | 3300049130 | Ga0501310_000737 | Ga0501310_000737_2148_2804 | 167 |
| 26 | 3300049536 | Ga0501320_001877 | Ga0501320_001877_822_1478 | 167 |
| 27 | 3300009093 | Ga0105240_10007047 | Ga0105240_100070478 | 169 |
| 28 | 3300025913 | Ga0207695_10008540 | Ga0207695_100085407 | 169 |
| 29 | 3300031595 | Ga0265313_10004186 | Ga0265313_1000418612 | 169 |
| 30 | 3300045051 | Ga0451576_0027216 | Ga0451576_0027216_230_877 | 169 |
| 31 | 3300013100 | Ga0157373_10004932 | Ga0157373_100049327 | 170 |
| 32 | 3300003320 | rootH2_10050166 | rootH2_1005016613 | 171 |
| 33 | 3300003322 | rootL2_10139488 | rootL2_101394882 | 171 |
| 34 | 3300005614 | Ga0068856_100004352 | Ga0068856_10000435224 | 171 |
| 35 | 3300013307 | Ga0157372_10631782 | Ga0157372_106317821 | 171 |
| 36 | 3300026078 | Ga0207702_10003580 | Ga0207702_1000358022 | 171 |
| 37 | 3300026142 | Ga0207698_10923389 | Ga0207698_109233891 | 171 |
| 38 | 3300031548 | Ga0307408_100000009 | Ga0307408_10000000984 | 171 |
| 39 | 3300031824 | Ga0307413_10364847 | Ga0307413_103648472 | 171 |
| 40 | 3300031852 | Ga0307410_10000097 | Ga0307410_1000009729 | 171 |
| 41 | 3300031995 | Ga0307409_100000037 | Ga0307409_1000000373 | 171 |
| 42 | 3300032002 | Ga0307416_100000018 | Ga0307416_100000018121 | 171 |
| 43 | 3300032005 | Ga0307411_10054437 | Ga0307411_100544373 | 171 |
| 44 | 3300041486 | Ga0451807_0122896 | Ga0451807_0122896_10_537 | 171 |
| 45 | 3300049574 | Ga0501038_0000480 | Ga0501038_0000480_3628_4212 | 171 |
| 46 | 3300049586 | Ga0501070_0142209 | Ga0501070_0142209_50_652 | 171 |
| 47 | 3300005518 | Ga0070699_100093749 | Ga0070699_1000937493 | 172 |
| 48 | 3300014969 | Ga0157376_11254406 | Ga0157376_112544061 | 172 |
| 49 | 3300020076 | Ga0206355_1200566 | Ga0206355_12005662 | 172 |
| 50 | 3300026088 | Ga0207641_10452994 | Ga0207641_104529942 | 172 |
| 51 | 3300031239 | Ga0265328_10052198 | Ga0265328_100521982 | 172 |
| 52 | 3300031548 | Ga0307408_100414755 | Ga0307408_1004147552 | 172 |
| 53 | 3300032168 | Ga0316593_10000659 | Ga0316593_1000065910 | 172 |
| 54 | 3300044712 | Ga0453684_0000516 | Ga0453684_0000516_23305_23880 | 172 |
| 55 | 3300005445 | Ga0070708_100076149 | Ga0070708_1000761496 | 173 |
| 56 | 3300005471 | Ga0070698_100001910 | Ga0070698_10000191021 | 173 |
| 57 | 3300005518 | Ga0070699_100030476 | Ga0070699_1000304766 | 173 |
| 58 | 3300005536 | Ga0070697_100004958 | Ga0070697_1000049585 | 173 |
| 59 | 3300005563 | Ga0068855_100597968 | Ga0068855_1005979683 | 173 |
| 60 | 3300005842 | Ga0068858_100800210 | Ga0068858_1008002102 | 173 |
| 61 | 3300006028 | Ga0070717_10195964 | Ga0070717_101959644 | 173 |
| 62 | 3300006048 | Ga0075363_100004668 | Ga0075363_1000046684 | 173 |
| 63 | 3300006177 | Ga0075362_10004435 | Ga0075362_100044352 | 173 |
| 64 | 3300009545 | Ga0105237_10009019 | Ga0105237_1000901912 | 173 |
| 65 | 3300013296 | Ga0157374_10569942 | Ga0157374_105699422 | 173 |
| 66 | 3300021358 | Ga0213873_10016590 | Ga0213873_100165903 | 173 |
| 67 | 3300021361 | Ga0213872_10010006 | Ga0213872_100100063 | 173 |
| 68 | 3300021361 | Ga0213872_10158708 | Ga0213872_101587082 | 173 |
| 69 | 3300021377 | Ga0213874_10001478 | Ga0213874_100014783 | 173 |
| 70 | 3300021384 | Ga0213876_10000361 | Ga0213876_100003618 | 173 |
| 71 | 3300021441 | Ga0213871_10012351 | Ga0213871_100123512 | 173 |
| 72 | 3300025903 | Ga0207680_10150458 | Ga0207680_101504583 | 173 |
| 73 | 3300025910 | Ga0207684_10151385 | Ga0207684_101513853 | 173 |
| 74 | 3300025914 | Ga0207671_10020842 | Ga0207671_100208422 | 173 |
| 75 | 3300025919 | Ga0207657_10066683 | Ga0207657_100666833 | 173 |
| 76 | 3300025922 | Ga0207646_10084385 | Ga0207646_100843851 | 173 |
| 77 | 3300037853 | Ga0436364_0070502 | Ga0436364_0070502_1230_1754 | 173 |
| 78 | 3300039437 | Ga0436365_1383407 | Ga0436365_1383407_24673_25197 | 173 |
| 79 | 3300039438 | Ga0436360_0111982 | Ga0436360_0111982_3062_3586 | 173 |
| 80 | 3300039438 | Ga0436360_0751309 | Ga0436360_0751309_1166_1690 | 173 |
| 81 | 3300039438 | Ga0436360_0817873 | Ga0436360_0817873_240_764 | 173 |
| 82 | 3300039438 | Ga0436360_0823493 | Ga0436360_0823493_1427_1951 | 173 |
| 83 | 3300039447 | Ga0436361_0088096 | Ga0436361_0088096_5727_6251 | 173 |
| 84 | 3300039447 | Ga0436361_0096493 | Ga0436361_0096493_15_539 | 173 |
| 85 | 3300039447 | Ga0436361_0960224 | Ga0436361_0960224_153_677 | 173 |
| 86 | 3300039447 | Ga0436361_1103431 | Ga0436361_1103431_154_678 | 173 |
| 87 | 3300039450 | Ga0436363_0072645 | Ga0436363_0072645_4831_5355 | 173 |
| 88 | 3300039453 | Ga0436362_1110217 | Ga0436362_1110217_733_1257 | 173 |
| 89 | 3300041512 | Ga0451853_3388316 | Ga0451853_3388316_196_720 | 173 |
| 90 | 3300044673 | Ga0453683_0004775 | Ga0453683_0004775_1965_2603 | 173 |
| 91 | 3300044712 | Ga0453684_0109566 | Ga0453684_0109566_1111_1749 | 173 |
| 92 | 3300045051 | Ga0451576_0024674 | Ga0451576_0024674_2117_2755 | 173 |
| 93 | 3300048924 | Ga0496121_0548309 | Ga0496121_0548309_62_613 | 173 |
| 94 | 3300049569 | Ga0501032_0000390 | Ga0501032_0000390_3584_4174 | 173 |
| 95 | 3300049570 | Ga0501033_0000003 | Ga0501033_0000003_165942_166532 | 173 |
| 96 | 3300049744 | Ga0501083_0059867 | Ga0501083_0059867_398_1063 | 173 |
| 97 | 3300050489 | nmdc:mga03683_281_c1 | nmdc:mga03683_281_c1_7440_7964 | 173 |
| 98 | 3300050490 | nmdc:mga03n38_86065_c1 | nmdc:mga03n38_86065_c1_217_741 | 173 |
| 99 | 3300050493 | nmdc:mga0k408_12560_c1 | nmdc:mga0k408_12560_c1_1114_1638 | 173 |
| 100 | 3300050493 | nmdc:mga0k408_1699_c1 | nmdc:mga0k408_1699_c1_1787_2311 | 173 |
| 101 | 3300053103 | Ga0500555_000055 | Ga0500555_000055_51743_52267 | 173 |
| 102 | 3300053104 | Ga0500556_0000420 | Ga0500556_0000420_2415_2939 | 173 |
| 103 | 3300053130 | Ga0500642_0004954 | Ga0500642_0004954_770_1294 | 173 |
| 104 | 3300053130 | Ga0500642_0123785 | Ga0500642_0123785_560_1141 | 173 |
| 105 | 3300053134 | Ga0500658_0073733 | Ga0500658_0073733_736_1260 | 173 |
| 106 | 3300002155 | JGI24033J26618_1000142 | JGI24033J26618_100014211 | 174 |
| 107 | 3300003322 | rootL2_10030599 | rootL2_100305993 | 174 |
| 108 | 3300005344 | Ga0070661_100000386 | Ga0070661_10000038633 | 174 |
| 109 | 3300005356 | Ga0070674_100034793 | Ga0070674_1000347933 | 174 |
| 110 | 3300005456 | Ga0070678_100013072 | Ga0070678_1000130724 | 174 |
| 111 | 3300006237 | Ga0097621_100827666 | Ga0097621_1008276662 | 174 |
| 112 | 3300006358 | Ga0068871_100012344 | Ga0068871_1000123446 | 174 |
| 113 | 3300013296 | Ga0157374_10000026 | Ga0157374_10000026122 | 174 |
| 114 | 3300013296 | Ga0157374_10017996 | Ga0157374_100179967 | 174 |
| 115 | 3300013297 | Ga0157378_10001234 | Ga0157378_1000123419 | 174 |
| 116 | 3300013308 | Ga0157375_10198646 | Ga0157375_101986463 | 174 |
| 117 | 3300014969 | Ga0157376_10000112 | Ga0157376_1000011242 | 174 |
| 118 | 3300021358 | Ga0213873_10030819 | Ga0213873_100308192 | 174 |
| 119 | 3300021388 | Ga0213875_10079664 | Ga0213875_100796643 | 174 |
| 120 | 3300025920 | Ga0207649_10007825 | Ga0207649_100078252 | 174 |
| 121 | 3300025932 | Ga0207690_10023803 | Ga0207690_100238038 | 174 |
| 122 | 3300026121 | Ga0207683_10006308 | Ga0207683_100063089 | 174 |
| 123 | 3300031548 | Ga0307408_100000021 | Ga0307408_100000021141 | 174 |
| 124 | 3300031903 | Ga0307407_10000468 | Ga0307407_100004688 | 174 |
| 125 | 3300037853 | Ga0436364_0339363 | Ga0436364_0339363_178_705 | 174 |
| 126 | 3300037853 | Ga0436364_0785290 | Ga0436364_0785290_359_886 | 174 |
| 127 | 3300039438 | Ga0436360_0051782 | Ga0436360_0051782_28_555 | 174 |
| 128 | 3300039447 | Ga0436361_0363848 | Ga0436361_0363848_12958_13485 | 174 |
| 129 | 3300039447 | Ga0436361_0382718 | Ga0436361_0382718_456_983 | 174 |
| 130 | 3300039453 | Ga0436362_0931802 | Ga0436362_0931802_2185_2712 | 174 |
| 131 | 3300041408 | Ga0439453_0000086 | Ga0439453_0000086_1835_2533 | 174 |
| 132 | 3300042126 | Ga0450888_001605 | Ga0450888_001605_774_1472 | 174 |
| 133 | 3300042127 | Ga0450890_000001 | Ga0450890_000001_72431_73129 | 174 |
| 134 | 3300042129 | Ga0450891_002487 | Ga0450891_002487_86_784 | 174 |
| 135 | 3300042532 | Ga0450893_0005197 | Ga0450893_0005197_1004_1702 | 174 |
| 136 | 3300049575 | Ga0501039_0284451 | Ga0501039_0284451_550_1224 | 174 |
| 137 | 3300049577 | Ga0501041_0177330 | Ga0501041_0177330_435_1109 | 174 |
| 138 | 3300002077 | JGI24744J21845_10011528 | JGI24744J21845_100115282 | 175 |
| 139 | 3300005327 | Ga0070658_10018594 | Ga0070658_100185942 | 175 |
| 140 | 3300005564 | Ga0070664_100360619 | Ga0070664_1003606193 | 175 |
| 141 | 3300005842 | Ga0068858_100055768 | Ga0068858_1000557683 | 175 |
| 142 | 3300025909 | Ga0207705_10033535 | Ga0207705_100335352 | 175 |
| 143 | 3300025945 | Ga0207679_10374795 | Ga0207679_103747952 | 175 |
| 144 | 3300026035 | Ga0207703_10024292 | Ga0207703_100242924 | 175 |
| 145 | 3300037312 | Ga0395899_0000039 | Ga0395899_0000039_170547_171146 | 175 |
| 146 | 3300048927 | Ga0496124_0198492 | Ga0496124_0198492_442_987 | 175 |
| 147 | 3300048928 | Ga0496125_0000110 | Ga0496125_0000110_36027_36572 | 175 |
| 148 | 3300053136 | Ga0500559_0000861 | Ga0500559_0000861_6768_7424 | 175 |
| 149 | 3300053153 | Ga0500616_0006731 | Ga0500616_0006731_5223_5759 | 175 |
| 150 | 3300005331 | Ga0070670_100205578 | Ga0070670_1002055781 | 176 |
| 151 | 3300005331 | Ga0070670_100359756 | Ga0070670_1003597563 | 176 |
| 152 | 3300005344 | Ga0070661_100288697 | Ga0070661_1002886973 | 176 |
| 153 | 3300005456 | Ga0070678_100223073 | Ga0070678_1002230733 | 176 |
| 154 | 3300005548 | Ga0070665_100673722 | Ga0070665_1006737222 | 176 |
| 155 | 3300006353 | Ga0075370_10306692 | Ga0075370_103066921 | 176 |
| 156 | 3300009545 | Ga0105237_10044182 | Ga0105237_100441824 | 176 |
| 157 | 3300021384 | Ga0213876_10073114 | Ga0213876_100731143 | 176 |
| 158 | 3300025914 | Ga0207671_10025222 | Ga0207671_100252223 | 176 |
| 159 | 3300025926 | Ga0207659_10419064 | Ga0207659_104190642 | 176 |
| 160 | 3300025931 | Ga0207644_10237270 | Ga0207644_102372702 | 176 |
| 161 | 3300037466 | Ga0395898_0000226 | Ga0395898_0000226_97130_97729 | 176 |
| 162 | 3300039437 | Ga0436365_0798127 | Ga0436365_0798127_307_942 | 176 |
| 163 | 3300039437 | Ga0436365_1314581 | Ga0436365_1314581_349_984 | 176 |
| 164 | 3300003203 | JGI25406J46586_10000001 | JGI25406J46586_10000001201 | 177 |
| 165 | 3300003203 | JGI25406J46586_10000007 | JGI25406J46586_1000000773 | 177 |
| 166 | 3300003323 | rootH1_10007007 | rootH1_100070072 | 177 |
| 167 | 3300005617 | Ga0068859_101731931 | Ga0068859_1017319311 | 177 |
| 168 | 3300005985 | Ga0081539_10000014 | Ga0081539_10000014307 | 177 |
| 169 | 3300006931 | Ga0097620_101732031 | Ga0097620_1017320311 | 177 |
| 170 | 3300025972 | Ga0207668_10957154 | Ga0207668_109571542 | 177 |
| 171 | 3300028379 | Ga0268266_11148552 | Ga0268266_111485522 | 177 |
| 172 | 3300030522 | Ga0307512_10104901 | Ga0307512_101049013 | 177 |
| 173 | 3300035724 | Ga0373933_0108221 | Ga0373933_0108221_725_1267 | 177 |
| 174 | 3300036401 | Ga0373937_0331794 | Ga0373937_0331794_222_773 | 177 |
| 175 | 3300044683 | Ga0466965_0058570 | Ga0466965_0058570_1004_1597 | 177 |
| 176 | 3300044719 | Ga0466971_0000005 | Ga0466971_0000005_56592_57185 | 177 |
| 177 | 3300044842 | Ga0466957_0069306 | Ga0466957_0069306_207_800 | 177 |
| 178 | 3300045976 | Ga0466967_0088574 | Ga0466967_0088574_1259_1852 | 177 |
| 179 | 3300053104 | Ga0500556_0002977 | Ga0500556_0002977_252_791 | 177 |
| 180 | 3300053730 | Ga0500645_012211 | Ga0500645_012211_532_1281 | 177 |
| 181 | 3300061719 | Ga0466962_0000007 | Ga0466962_0000007_143365_143958 | 177 |
| 182 | iso_pu_bacteria | 2786546548 | 2787506692 | 177 |
| 183 | 3300005328 | Ga0070676_10305976 | Ga0070676_103059762 | 178 |
| 184 | 3300005334 | Ga0068869_100697020 | Ga0068869_1006970201 | 178 |
| 185 | 3300005344 | Ga0070661_100097194 | Ga0070661_1000971944 | 178 |
| 186 | 3300005459 | Ga0068867_100000218 | Ga0068867_10000021821 | 178 |
| 187 | 3300005548 | Ga0070665_100000045 | Ga0070665_10000004549 | 178 |
| 188 | 3300005564 | Ga0070664_100000199 | Ga0070664_10000019950 | 178 |
| 189 | 3300005577 | Ga0068857_100221076 | Ga0068857_1002210763 | 178 |
| 190 | 3300005841 | Ga0068863_100054836 | Ga0068863_1000548363 | 178 |
| 191 | 3300009098 | Ga0105245_10015121 | Ga0105245_1001512110 | 178 |
| 192 | 3300009148 | Ga0105243_10000049 | Ga0105243_10000049134 | 178 |
| 193 | 3300013102 | Ga0157371_10247936 | Ga0157371_102479362 | 178 |
| 194 | 3300014745 | Ga0157377_10033289 | Ga0157377_100332893 | 178 |
| 195 | 3300025927 | Ga0207687_10051760 | Ga0207687_100517602 | 178 |
| 196 | 3300025935 | Ga0207709_10000097 | Ga0207709_1000009720 | 178 |
| 197 | 3300025945 | Ga0207679_10000541 | Ga0207679_1000054124 | 178 |
| 198 | 3300026023 | Ga0207677_10252081 | Ga0207677_102520812 | 178 |
| 199 | 3300026089 | Ga0207648_10000083 | Ga0207648_1000008371 | 178 |
| 200 | 3300026116 | Ga0207674_10107042 | Ga0207674_101070422 | 178 |
| 201 | 3300028379 | Ga0268266_10000251 | Ga0268266_1000025148 | 178 |
| 202 | 3300031344 | Ga0265316_10186665 | Ga0265316_101866652 | 178 |
| 203 | iso_pu_bacteria | 2718217752 | 2718716241 | 178 |
| 204 | 3300005548 | Ga0070665_100476535 | Ga0070665_1004765351 | 179 |
| 205 | 3300005841 | Ga0068863_100029029 | Ga0068863_1000290293 | 179 |
| 206 | 3300005843 | Ga0068860_100001380 | Ga0068860_10000138022 | 179 |
| 207 | 3300005981 | Ga0081538_10015344 | Ga0081538_100153443 | 179 |
| 208 | 3300009094 | Ga0111539_10048674 | Ga0111539_100486743 | 179 |
| 209 | 3300009177 | Ga0105248_10312261 | Ga0105248_103122613 | 179 |
| 210 | 3300010375 | Ga0105239_10048890 | Ga0105239_100488904 | 179 |
| 211 | 3300025913 | Ga0207695_10002221 | Ga0207695_1000222128 | 179 |
| 212 | 3300025941 | Ga0207711_10232457 | Ga0207711_102324573 | 179 |
| 213 | 3300026088 | Ga0207641_10005226 | Ga0207641_1000522619 | 179 |
| 214 | 3300027907 | Ga0207428_10514354 | Ga0207428_105143542 | 179 |
| 215 | 3300028379 | Ga0268266_10501180 | Ga0268266_105011802 | 179 |
| 216 | 3300028381 | Ga0268264_10001807 | Ga0268264_1000180713 | 179 |
| 217 | 3300031251 | Ga0265327_10011153 | Ga0265327_100111532 | 179 |
| 218 | 3300049532 | Ga0501316_006032 | Ga0501316_006032_376_927 | 179 |
| 219 | 3300049569 | Ga0501032_0244194 | Ga0501032_0244194_293_886 | 179 |
| 220 | 3300049742 | Ga0501080_0023861 | Ga0501080_0023861_3533_4078 | 179 |
| 221 | 3300050511 | nmdc:mga08y16_94064_c1 | nmdc:mga08y16_94064_c1_2279_2833 | 179 |
| 222 | 3300053103 | Ga0500555_000015 | Ga0500555_000015_118091_118825 | 179 |
| 223 | 3300053153 | Ga0500616_0006989 | Ga0500616_0006989_593_1327 | 179 |
| 224 | 3300005435 | Ga0070714_100337764 | Ga0070714_1003377642 | 180 |
| 225 | 3300005445 | Ga0070708_100054749 | Ga0070708_1000547495 | 180 |
| 226 | 3300005445 | Ga0070708_100393362 | Ga0070708_1003933622 | 180 |
| 227 | 3300005445 | Ga0070708_100591210 | Ga0070708_1005912102 | 180 |
| 228 | 3300005467 | Ga0070706_100416544 | Ga0070706_1004165443 | 180 |
| 229 | 3300005467 | Ga0070706_100624420 | Ga0070706_1006244201 | 180 |
| 230 | 3300005467 | Ga0070706_100729309 | Ga0070706_1007293092 | 180 |
| 231 | 3300005468 | Ga0070707_100072311 | Ga0070707_1000723118 | 180 |
| 232 | 3300005468 | Ga0070707_100411612 | Ga0070707_1004116122 | 180 |
| 233 | 3300005518 | Ga0070699_100051877 | Ga0070699_1000518771 | 180 |
| 234 | 3300005518 | Ga0070699_100643205 | Ga0070699_1006432051 | 180 |
| 235 | 3300005536 | Ga0070697_100025782 | Ga0070697_1000257825 | 180 |
| 236 | 3300005536 | Ga0070697_100031906 | Ga0070697_1000319063 | 180 |
| 237 | 3300006173 | Ga0070716_100677467 | Ga0070716_1006774671 | 180 |
| 238 | 3300009545 | Ga0105237_10385391 | Ga0105237_103853913 | 180 |
| 239 | 3300013296 | Ga0157374_11937884 | Ga0157374_119378841 | 180 |
| 240 | 3300013297 | Ga0157378_10005509 | Ga0157378_100055098 | 180 |
| 241 | 3300021384 | Ga0213876_10483064 | Ga0213876_104830642 | 180 |
| 242 | 3300025910 | Ga0207684_10252293 | Ga0207684_102522933 | 180 |
| 243 | 3300025915 | Ga0207693_10389591 | Ga0207693_103895912 | 180 |
| 244 | 3300025922 | Ga0207646_10137954 | Ga0207646_101379543 | 180 |
| 245 | 3300025929 | Ga0207664_10120019 | Ga0207664_101200194 | 180 |
| 246 | 3300037068 | Ga0373925_0501751 | Ga0373925_0501751_252_812 | 180 |
| 247 | 3300048912 | Ga0496109_0327535 | Ga0496109_0327535_731_1288 | 180 |
| 248 | 3300050514 | nmdc:mga08x19_81630_c1 | nmdc:mga08x19_81630_c1_515_1081 | 180 |
| 249 | 3300005295 | Ga0065707_10102203 | Ga0065707_101022031 | 181 |
| 250 | 3300005445 | Ga0070708_100903773 | Ga0070708_1009037731 | 181 |
| 251 | 3300005457 | Ga0070662_100471626 | Ga0070662_1004716262 | 181 |
| 252 | 3300005467 | Ga0070706_100006435 | Ga0070706_10000643516 | 181 |
| 253 | 3300005467 | Ga0070706_100146613 | Ga0070706_1001466132 | 181 |
| 254 | 3300005468 | Ga0070707_100159765 | Ga0070707_1001597653 | 181 |
| 255 | 3300005471 | Ga0070698_100007384 | Ga0070698_1000073848 | 181 |
| 256 | 3300005518 | Ga0070699_100036501 | Ga0070699_1000365019 | 181 |
| 257 | 3300005536 | Ga0070697_100005694 | Ga0070697_10000569410 | 181 |
| 258 | 3300005536 | Ga0070697_100611835 | Ga0070697_1006118352 | 181 |
| 259 | 3300005718 | Ga0068866_10623252 | Ga0068866_106232521 | 181 |
| 260 | 3300006028 | Ga0070717_10037326 | Ga0070717_100373268 | 181 |
| 261 | 3300006173 | Ga0070716_100031746 | Ga0070716_1000317464 | 181 |
| 262 | 3300006852 | Ga0075433_10286694 | Ga0075433_102866942 | 181 |
| 263 | 3300007076 | Ga0075435_100470464 | Ga0075435_1004704642 | 181 |
| 264 | 3300009098 | Ga0105245_10158539 | Ga0105245_101585393 | 181 |
| 265 | 3300013296 | Ga0157374_10121480 | Ga0157374_101214803 | 181 |
| 266 | 3300013297 | Ga0157378_10043528 | Ga0157378_100435283 | 181 |
| 267 | 3300013306 | Ga0163162_10052794 | Ga0163162_100527948 | 181 |
| 268 | 3300013307 | Ga0157372_10167743 | Ga0157372_101677431 | 181 |
| 269 | 3300025910 | Ga0207684_10019695 | Ga0207684_100196955 | 181 |
| 270 | 3300025910 | Ga0207684_10048446 | Ga0207684_100484463 | 181 |
| 271 | 3300025922 | Ga0207646_10005692 | Ga0207646_100056927 | 181 |
| 272 | 3300025932 | Ga0207690_10086786 | Ga0207690_100867863 | 181 |
| 273 | 3300025939 | Ga0207665_10140744 | Ga0207665_101407441 | 181 |
| 274 | 3300025972 | Ga0207668_10203825 | Ga0207668_102038253 | 181 |
| 275 | 3300026023 | Ga0207677_10111866 | Ga0207677_101118664 | 181 |
| 276 | 3300035725 | Ga0373947_0159967 | Ga0373947_0159967_755_1324 | 181 |
| 277 | 3300035725 | Ga0373947_0173463 | Ga0373947_0173463_155_724 | 181 |
| 278 | 3300037068 | Ga0373925_0155902 | Ga0373925_0155902_651_1220 | 181 |
| 279 | 3300046472 | Ga0495580_0109086 | Ga0495580_0109086_93_662 | 181 |
| 280 | 3300050513 | nmdc:mga0rr50_168592_c1 | nmdc:mga0rr50_168592_c1_320_886 | 181 |
| 281 | 3300050514 | nmdc:mga08x19_555035_c1 | nmdc:mga08x19_555035_c1_229_801 | 181 |
| 282 | 3300006048 | Ga0075363_100128694 | Ga0075363_1001286943 | 182 |
| 283 | 3300006195 | Ga0075366_10047853 | Ga0075366_100478532 | 182 |
| 284 | 3300042876 | Ga0451577_0186388 | Ga0451577_0186388_812_1375 | 182 |
| 285 | 3300050489 | nmdc:mga03683_93017_c1 | nmdc:mga03683_93017_c1_182_748 | 182 |
| 286 | 3300050490 | nmdc:mga03n38_195087_c1 | nmdc:mga03n38_195087_c1_97_663 | 182 |
| 287 | 3300001991 | JGI24743J22301_10010320 | JGI24743J22301_100103204 | 183 |
| 288 | 3300005290 | Ga0065712_10088457 | Ga0065712_100884574 | 183 |
| 289 | 3300005290 | Ga0065712_10145424 | Ga0065712_101454242 | 183 |
| 290 | 3300005328 | Ga0070676_10428966 | Ga0070676_104289661 | 183 |
| 291 | 3300005329 | Ga0070683_100055457 | Ga0070683_1000554575 | 183 |
| 292 | 3300005331 | Ga0070670_100003742 | Ga0070670_10000374211 | 183 |
| 293 | 3300005335 | Ga0070666_10001876 | Ga0070666_1000187612 | 183 |
| 294 | 3300005338 | Ga0068868_100215528 | Ga0068868_1002155282 | 183 |
| 295 | 3300005340 | Ga0070689_100100534 | Ga0070689_1001005341 | 183 |
| 296 | 3300005343 | Ga0070687_100411748 | Ga0070687_1004117482 | 183 |
| 297 | 3300005353 | Ga0070669_100002011 | Ga0070669_1000020119 | 183 |
| 298 | 3300005354 | Ga0070675_100004678 | Ga0070675_1000046786 | 183 |
| 299 | 3300005354 | Ga0070675_100133137 | Ga0070675_1001331374 | 183 |
| 300 | 3300005355 | Ga0070671_100000283 | Ga0070671_10000028329 | 183 |
| 301 | 3300005356 | Ga0070674_100013872 | Ga0070674_1000138725 | 183 |
| 302 | 3300005364 | Ga0070673_100008141 | Ga0070673_1000081413 | 183 |
| 303 | 3300005364 | Ga0070673_100075213 | Ga0070673_1000752135 | 183 |
| 304 | 3300005365 | Ga0070688_100000733 | Ga0070688_1000007332 | 183 |
| 305 | 3300005367 | Ga0070667_100004665 | Ga0070667_10000466518 | 183 |
| 306 | 3300005367 | Ga0070667_100258686 | Ga0070667_1002586862 | 183 |
| 307 | 3300005456 | Ga0070678_100001511 | Ga0070678_10000151113 | 183 |
| 308 | 3300005456 | Ga0070678_100444107 | Ga0070678_1004441072 | 183 |
| 309 | 3300005459 | Ga0068867_100044767 | Ga0068867_1000447672 | 183 |
| 310 | 3300005466 | Ga0070685_10099962 | Ga0070685_100999623 | 183 |
| 311 | 3300005543 | Ga0070672_100202353 | Ga0070672_1002023532 | 183 |
| 312 | 3300005843 | Ga0068860_100672444 | Ga0068860_1006724442 | 183 |
| 313 | 3300006175 | Ga0070712_100996564 | Ga0070712_1009965641 | 183 |
| 314 | 3300006358 | Ga0068871_100084135 | Ga0068871_1000841355 | 183 |
| 315 | 3300013296 | Ga0157374_10001473 | Ga0157374_100014735 | 183 |
| 316 | 3300013297 | Ga0157378_10119918 | Ga0157378_101199183 | 183 |
| 317 | 3300013306 | Ga0163162_10370423 | Ga0163162_103704233 | 183 |
| 318 | 3300013308 | Ga0157375_10001868 | Ga0157375_100018685 | 183 |
| 319 | 3300014969 | Ga0157376_10390349 | Ga0157376_103903492 | 183 |
| 320 | 3300025899 | Ga0207642_10062069 | Ga0207642_100620693 | 183 |
| 321 | 3300025901 | Ga0207688_10001208 | Ga0207688_100012087 | 183 |
| 322 | 3300025918 | Ga0207662_10432993 | Ga0207662_104329932 | 183 |
| 323 | 3300025923 | Ga0207681_10014902 | Ga0207681_100149024 | 183 |
| 324 | 3300025925 | Ga0207650_10018287 | Ga0207650_100182878 | 183 |
| 325 | 3300025926 | Ga0207659_10045484 | Ga0207659_100454842 | 183 |
| 326 | 3300025926 | Ga0207659_10179827 | Ga0207659_101798273 | 183 |
| 327 | 3300025931 | Ga0207644_10035251 | Ga0207644_100352515 | 183 |
| 328 | 3300025937 | Ga0207669_10002532 | Ga0207669_1000253210 | 183 |
| 329 | 3300025940 | Ga0207691_10228367 | Ga0207691_102283673 | 183 |
| 330 | 3300025960 | Ga0207651_10007253 | Ga0207651_1000725310 | 183 |
| 331 | 3300025960 | Ga0207651_10027669 | Ga0207651_100276697 | 183 |
| 332 | 3300025972 | Ga0207668_10156576 | Ga0207668_101565763 | 183 |
| 333 | 3300026023 | Ga0207677_10021108 | Ga0207677_100211084 | 183 |
| 334 | 3300026041 | Ga0207639_10621551 | Ga0207639_106215512 | 183 |
| 335 | 3300026088 | Ga0207641_10626592 | Ga0207641_106265922 | 183 |
| 336 | 3300026142 | Ga0207698_10222182 | Ga0207698_102221822 | 183 |
| 337 | 3300026142 | Ga0207698_10283620 | Ga0207698_102836201 | 183 |
| 338 | 3300028379 | Ga0268266_10097330 | Ga0268266_100973303 | 183 |
| 339 | 3300028381 | Ga0268264_10149965 | Ga0268264_101499655 | 183 |
| 340 | 3300028381 | Ga0268264_10473591 | Ga0268264_104735913 | 183 |
| 341 | 3300035120 | Ga0373957_0405744 | Ga0373957_0405744_10_573 | 183 |
| 342 | 3300035171 | Ga0373946_0096119 | Ga0373946_0096119_505_1068 | 183 |
| 343 | 3300046683 | Ga0495658_0011003 | Ga0495658_0011003_1219_1782 | 183 |
| 344 | 3300047315 | Ga0495581_0106207 | Ga0495581_0106207_970_1533 | 183 |
| 345 | 3300003791 | Ga0055530_10029193 | Ga0055530_100291932 | 184 |
| 346 | 3300005331 | Ga0070670_100314402 | Ga0070670_1003144022 | 184 |
| 347 | 3300005335 | Ga0070666_10002056 | Ga0070666_1000205612 | 184 |
| 348 | 3300005347 | Ga0070668_100497705 | Ga0070668_1004977051 | 184 |
| 349 | 3300005353 | Ga0070669_100033015 | Ga0070669_1000330153 | 184 |
| 350 | 3300005353 | Ga0070669_100157939 | Ga0070669_1001579393 | 184 |
| 351 | 3300005355 | Ga0070671_100011134 | Ga0070671_1000111345 | 184 |
| 352 | 3300005356 | Ga0070674_100048927 | Ga0070674_1000489273 | 184 |
| 353 | 3300005364 | Ga0070673_100014325 | Ga0070673_1000143255 | 184 |
| 354 | 3300005456 | Ga0070678_100043541 | Ga0070678_1000435414 | 184 |
| 355 | 3300005543 | Ga0070672_100004247 | Ga0070672_1000042478 | 184 |
| 356 | 3300005548 | Ga0070665_100008787 | Ga0070665_1000087874 | 184 |
| 357 | 3300005563 | Ga0068855_100851325 | Ga0068855_1008513251 | 184 |
| 358 | 3300005842 | Ga0068858_100134565 | Ga0068858_1001345652 | 184 |
| 359 | 3300006237 | Ga0097621_100024099 | Ga0097621_1000240993 | 184 |
| 360 | 3300006880 | Ga0075429_100583814 | Ga0075429_1005838142 | 184 |
| 361 | 3300009094 | Ga0111539_10387272 | Ga0111539_103872722 | 184 |
| 362 | 3300013296 | Ga0157374_10127435 | Ga0157374_101274354 | 184 |
| 363 | 3300013296 | Ga0157374_11100808 | Ga0157374_111008082 | 184 |
| 364 | 3300013297 | Ga0157378_10026553 | Ga0157378_100265533 | 184 |
| 365 | 3300013297 | Ga0157378_10174062 | Ga0157378_101740621 | 184 |
| 366 | 3300013306 | Ga0163162_10410273 | Ga0163162_104102733 | 184 |
| 367 | 3300013308 | Ga0157375_10082239 | Ga0157375_100822392 | 184 |
| 368 | 3300014969 | Ga0157376_10031061 | Ga0157376_100310614 | 184 |
| 369 | 3300025298 | Ga0209050_1000629 | Ga0209050_100062932 | 184 |
| 370 | 3300025315 | Ga0207697_10002322 | Ga0207697_100023228 | 184 |
| 371 | 3300025903 | Ga0207680_10104042 | Ga0207680_101040422 | 184 |
| 372 | 3300025907 | Ga0207645_10002762 | Ga0207645_100027623 | 184 |
| 373 | 3300025920 | Ga0207649_10150356 | Ga0207649_101503563 | 184 |
| 374 | 3300025926 | Ga0207659_10469124 | Ga0207659_104691241 | 184 |
| 375 | 3300025926 | Ga0207659_10682627 | Ga0207659_106826272 | 184 |
| 376 | 3300025931 | Ga0207644_10266435 | Ga0207644_102664352 | 184 |
| 377 | 3300025940 | Ga0207691_10016028 | Ga0207691_100160288 | 184 |
| 378 | 3300025944 | Ga0207661_10077884 | Ga0207661_100778842 | 184 |
| 379 | 3300025945 | Ga0207679_10279684 | Ga0207679_102796843 | 184 |
| 380 | 3300025949 | Ga0207667_10766901 | Ga0207667_107669011 | 184 |
| 381 | 3300025960 | Ga0207651_10019560 | Ga0207651_100195603 | 184 |
| 382 | 3300025972 | Ga0207668_10057405 | Ga0207668_100574053 | 184 |
| 383 | 3300025972 | Ga0207668_10931305 | Ga0207668_109313052 | 184 |
| 384 | 3300026023 | Ga0207677_10008042 | Ga0207677_100080424 | 184 |
| 385 | 3300026035 | Ga0207703_10175845 | Ga0207703_101758452 | 184 |
| 386 | 3300026121 | Ga0207683_10015583 | Ga0207683_100155833 | 184 |
| 387 | 3300027876 | Ga0209974_10022093 | Ga0209974_100220933 | 184 |
| 388 | 3300028379 | Ga0268266_10238441 | Ga0268266_102384412 | 184 |
| 389 | 3300028380 | Ga0268265_10116094 | Ga0268265_101160943 | 184 |
| 390 | 3300035116 | Ga0373945_0059303 | Ga0373945_0059303_27_596 | 184 |
| 391 | 3300035172 | Ga0373955_0008379 | Ga0373955_0008379_2910_3479 | 184 |
| 392 | 3300035398 | Ga0316574_0010564 | Ga0316574_0010564_4273_4842 | 184 |
| 393 | 3300035724 | Ga0373933_0052084 | Ga0373933_0052084_1702_2271 | 184 |
| 394 | 3300036401 | Ga0373937_0282498 | Ga0373937_0282498_302_871 | 184 |
| 395 | 3300036401 | Ga0373937_0824342 | Ga0373937_0824342_219_788 | 184 |
| 396 | 3300046454 | Ga0495592_0102898 | Ga0495592_0102898_1255_1824 | 184 |
| 397 | 3300046462 | Ga0495651_0162026 | Ga0495651_0162026_285_854 | 184 |
| 398 | 3300046511 | Ga0495608_0095489 | Ga0495608_0095489_1203_1772 | 184 |
| 399 | 3300046514 | Ga0495618_0068826 | Ga0495618_0068826_1404_1973 | 184 |
| 400 | 3300046516 | Ga0495628_0040395 | Ga0495628_0040395_2385_2954 | 184 |
| 401 | 3300046517 | Ga0495630_0017678 | Ga0495630_0017678_692_1261 | 184 |
| 402 | 3300046529 | Ga0495652_0018013 | Ga0495652_0018013_1170_1739 | 184 |
| 403 | 3300046537 | Ga0495598_0043361 | Ga0495598_0043361_524_1093 | 184 |
| 404 | 3300046543 | Ga0495645_0063981 | Ga0495645_0063981_1112_1681 | 184 |
| 405 | 3300046642 | Ga0495634_0048412 | Ga0495634_0048412_1317_1886 | 184 |
| 406 | 3300046678 | Ga0495599_0142934 | Ga0495599_0142934_340_909 | 184 |
| 407 | 3300047319 | Ga0495674_0415532 | Ga0495674_0415532_285_854 | 184 |
| 408 | 3300047444 | Ga0495675_0002584 | Ga0495675_0002584_5712_6281 | 184 |
| 409 | 3300047471 | Ga0495684_0164535 | Ga0495684_0164535_950_1519 | 184 |
| 410 | 3300048088 | Ga0495602_0309980 | Ga0495602_0309980_216_785 | 184 |
| 411 | 3300048907 | Ga0496104_0356276 | Ga0496104_0356276_367_936 | 184 |
| 412 | 3300048912 | Ga0496109_0241538 | Ga0496109_0241538_720_1292 | 184 |
| 413 | 3300048915 | Ga0496112_0273283 | Ga0496112_0273283_84_656 | 184 |
| 414 | 3300050511 | nmdc:mga08y16_168750_c1 | nmdc:mga08y16_168750_c1_699_1268 | 184 |
| 415 | 3300053077 | Ga0495601_0267157 | Ga0495601_0267157_266_835 | 184 |
| 416 | 3300053085 | Ga0495619_0109404 | Ga0495619_0109404_755_1324 | 184 |
| 417 | 3300001991 | JGI24743J22301_10000748 | JGI24743J22301_100007483 | 185 |
| 418 | 3300025315 | Ga0207697_10031631 | Ga0207697_100316313 | 185 |
| 419 | 3300025901 | Ga0207688_10042403 | Ga0207688_100424032 | 185 |
| 420 | 3300049568 | Ga0501031_0000635 | Ga0501031_0000635_4728_5321 | 185 |
| 421 | 3300049569 | Ga0501032_0046887 | Ga0501032_0046887_49_642 | 185 |
| 422 | 3300049570 | Ga0501033_0000015 | Ga0501033_0000015_60658_61251 | 185 |
| 423 | 3300049572 | Ga0501036_0013849 | Ga0501036_0013849_2004_2597 | 185 |
| 424 | 3300049573 | Ga0501037_0000295 | Ga0501037_0000295_31859_32452 | 185 |
| 425 | 3300049574 | Ga0501038_0073690 | Ga0501038_0073690_1720_2313 | 185 |
| 426 | 3300049575 | Ga0501039_0022279 | Ga0501039_0022279_1469_2062 | 185 |
| 427 | 3300049579 | Ga0501043_0069626 | Ga0501043_0069626_1071_1664 | 185 |
| 428 | 3300049581 | Ga0501047_0009121 | Ga0501047_0009121_8313_8906 | 185 |
| 429 | 3300049586 | Ga0501070_0002360 | Ga0501070_0002360_14773_15366 | 185 |
| 430 | 3300049587 | Ga0501071_0074202 | Ga0501071_0074202_443_1036 | 185 |
| 431 | 3300049742 | Ga0501080_0345987 | Ga0501080_0345987_502_1095 | 185 |
| 432 | 3300049822 | Ga0501035_0000004 | Ga0501035_0000004_14785_15378 | 185 |
| 433 | 3300049823 | Ga0501044_0000740 | Ga0501044_0000740_5929_6522 | 185 |
| 434 | 3300049824 | Ga0501045_0827532 | Ga0501045_0827532_73_666 | 185 |
| 435 | 2162886006 | SwRhRL3b_contig_111370 | SwRhRL3b_0945.00000070 | 186 |
| 436 | 2162886006 | SwRhRL3b_contig_2227077 | SwRhRL3b_0661.00001900 | 186 |
| 437 | 2162886007 | SwRhRL2b_contig_128758 | SwRhRL2b_0493.00002170 | 186 |
| 438 | 3300005289 | Ga0065704_10115944 | Ga0065704_101159442 | 186 |
| 439 | 3300005293 | Ga0065715_10001491 | Ga0065715_1000149110 | 186 |
| 440 | 3300005328 | Ga0070676_10079494 | Ga0070676_100794944 | 186 |
| 441 | 3300005335 | Ga0070666_10037886 | Ga0070666_100378863 | 186 |
| 442 | 3300005338 | Ga0068868_100221974 | Ga0068868_1002219742 | 186 |
| 443 | 3300005339 | Ga0070660_100151607 | Ga0070660_1001516072 | 186 |
| 444 | 3300005347 | Ga0070668_100069825 | Ga0070668_1000698255 | 186 |
| 445 | 3300005347 | Ga0070668_100182452 | Ga0070668_1001824524 | 186 |
| 446 | 3300005353 | Ga0070669_100004431 | Ga0070669_1000044314 | 186 |
| 447 | 3300005353 | Ga0070669_100199988 | Ga0070669_1001999882 | 186 |
| 448 | 3300005354 | Ga0070675_100137843 | Ga0070675_1001378433 | 186 |
| 449 | 3300005354 | Ga0070675_100193153 | Ga0070675_1001931533 | 186 |
| 450 | 3300005355 | Ga0070671_100016515 | Ga0070671_1000165152 | 186 |
| 451 | 3300005356 | Ga0070674_100064027 | Ga0070674_1000640272 | 186 |
| 452 | 3300005356 | Ga0070674_100293714 | Ga0070674_1002937142 | 186 |
| 453 | 3300005367 | Ga0070667_100072064 | Ga0070667_1000720643 | 186 |
| 454 | 3300005367 | Ga0070667_100449308 | Ga0070667_1004493081 | 186 |
| 455 | 3300005434 | Ga0070709_10408304 | Ga0070709_104083042 | 186 |
| 456 | 3300005434 | Ga0070709_10499439 | Ga0070709_104994392 | 186 |
| 457 | 3300005435 | Ga0070714_100879043 | Ga0070714_1008790431 | 186 |
| 458 | 3300005436 | Ga0070713_100354871 | Ga0070713_1003548712 | 186 |
| 459 | 3300005437 | Ga0070710_10136557 | Ga0070710_101365572 | 186 |
| 460 | 3300005437 | Ga0070710_10207762 | Ga0070710_102077622 | 186 |
| 461 | 3300005437 | Ga0070710_10236095 | Ga0070710_102360952 | 186 |
| 462 | 3300005438 | Ga0070701_10075691 | Ga0070701_100756913 | 186 |
| 463 | 3300005439 | Ga0070711_100006116 | Ga0070711_1000061165 | 186 |
| 464 | 3300005439 | Ga0070711_100226319 | Ga0070711_1002263192 | 186 |
| 465 | 3300005456 | Ga0070678_100033505 | Ga0070678_1000335052 | 186 |
| 466 | 3300005456 | Ga0070678_100053192 | Ga0070678_1000531924 | 186 |
| 467 | 3300005457 | Ga0070662_100008169 | Ga0070662_1000081692 | 186 |
| 468 | 3300005459 | Ga0068867_100235448 | Ga0068867_1002354483 | 186 |
| 469 | 3300005536 | Ga0070697_100141887 | Ga0070697_1001418875 | 186 |
| 470 | 3300005543 | Ga0070672_100041736 | Ga0070672_1000417365 | 186 |
| 471 | 3300005543 | Ga0070672_100182796 | Ga0070672_1001827962 | 186 |
| 472 | 3300005545 | Ga0070695_100561239 | Ga0070695_1005612392 | 186 |
| 473 | 3300005548 | Ga0070665_100114878 | Ga0070665_1001148786 | 186 |
| 474 | 3300005548 | Ga0070665_100853228 | Ga0070665_1008532282 | 186 |
| 475 | 3300005549 | Ga0070704_100083567 | Ga0070704_1000835674 | 186 |
| 476 | 3300005614 | Ga0068856_100017528 | Ga0068856_1000175287 | 186 |
| 477 | 3300005718 | Ga0068866_10121420 | Ga0068866_101214203 | 186 |
| 478 | 3300005719 | Ga0068861_100390918 | Ga0068861_1003909182 | 186 |
| 479 | 3300006163 | Ga0070715_10015930 | Ga0070715_100159306 | 186 |
| 480 | 3300006173 | Ga0070716_100086652 | Ga0070716_1000866522 | 186 |
| 481 | 3300006175 | Ga0070712_100093977 | Ga0070712_1000939772 | 186 |
| 482 | 3300006175 | Ga0070712_100105455 | Ga0070712_1001054553 | 186 |
| 483 | 3300006881 | Ga0068865_100013318 | Ga0068865_1000133183 | 186 |
| 484 | 3300007788 | Ga0099795_10326251 | Ga0099795_103262511 | 186 |
| 485 | 3300009098 | Ga0105245_10823160 | Ga0105245_108231602 | 186 |
| 486 | 3300009176 | Ga0105242_10451840 | Ga0105242_104518403 | 186 |
| 487 | 3300010159 | Ga0099796_10040234 | Ga0099796_100402342 | 186 |
| 488 | 3300013102 | Ga0157371_10058341 | Ga0157371_100583412 | 186 |
| 489 | 3300013296 | Ga0157374_10055882 | Ga0157374_100558823 | 186 |
| 490 | 3300013296 | Ga0157374_10498498 | Ga0157374_104984982 | 186 |
| 491 | 3300013296 | Ga0157374_11130585 | Ga0157374_111305852 | 186 |
| 492 | 3300013297 | Ga0157378_10058061 | Ga0157378_100580612 | 186 |
| 493 | 3300013297 | Ga0157378_10107467 | Ga0157378_101074673 | 186 |
| 494 | 3300013306 | Ga0163162_10017445 | Ga0163162_1001744513 | 186 |
| 495 | 3300013306 | Ga0163162_10023520 | Ga0163162_100235205 | 186 |
| 496 | 3300013307 | Ga0157372_10360562 | Ga0157372_103605623 | 186 |
| 497 | 3300013307 | Ga0157372_11295485 | Ga0157372_112954852 | 186 |
| 498 | 3300013308 | Ga0157375_10044228 | Ga0157375_100442285 | 186 |
| 499 | 3300013308 | Ga0157375_10144146 | Ga0157375_101441461 | 186 |
| 500 | 3300013308 | Ga0157375_10668197 | Ga0157375_106681972 | 186 |
| 501 | 3300014969 | Ga0157376_10102835 | Ga0157376_101028353 | 186 |
| 502 | 3300017792 | Ga0163161_10042654 | Ga0163161_100426543 | 186 |
| 503 | 3300017792 | Ga0163161_10245059 | Ga0163161_102450592 | 186 |
| 504 | 3300025315 | Ga0207697_10000131 | Ga0207697_1000013124 | 186 |
| 505 | 3300025899 | Ga0207642_10063829 | Ga0207642_100638293 | 186 |
| 506 | 3300025903 | Ga0207680_10205844 | Ga0207680_102058442 | 186 |
| 507 | 3300025905 | Ga0207685_10139437 | Ga0207685_101394372 | 186 |
| 508 | 3300025905 | Ga0207685_10171988 | Ga0207685_101719882 | 186 |
| 509 | 3300025906 | Ga0207699_10181274 | Ga0207699_101812743 | 186 |
| 510 | 3300025907 | Ga0207645_10001641 | Ga0207645_1000164120 | 186 |
| 511 | 3300025915 | Ga0207693_10000889 | Ga0207693_1000088933 | 186 |
| 512 | 3300025915 | Ga0207693_10092069 | Ga0207693_100920693 | 186 |
| 513 | 3300025916 | Ga0207663_10005429 | Ga0207663_100054299 | 186 |
| 514 | 3300025916 | Ga0207663_10396750 | Ga0207663_103967502 | 186 |
| 515 | 3300025919 | Ga0207657_10073181 | Ga0207657_100731816 | 186 |
| 516 | 3300025923 | Ga0207681_10072736 | Ga0207681_100727363 | 186 |
| 517 | 3300025923 | Ga0207681_10175206 | Ga0207681_101752063 | 186 |
| 518 | 3300025925 | Ga0207650_10006836 | Ga0207650_100068363 | 186 |
| 519 | 3300025926 | Ga0207659_10020696 | Ga0207659_100206965 | 186 |
| 520 | 3300025928 | Ga0207700_10318513 | Ga0207700_103185132 | 186 |
| 521 | 3300025931 | Ga0207644_10049869 | Ga0207644_100498696 | 186 |
| 522 | 3300025933 | Ga0207706_10027339 | Ga0207706_100273397 | 186 |
| 523 | 3300025937 | Ga0207669_10073225 | Ga0207669_100732252 | 186 |
| 524 | 3300025938 | Ga0207704_10040566 | Ga0207704_100405661 | 186 |
| 525 | 3300025939 | Ga0207665_10025655 | Ga0207665_100256553 | 186 |
| 526 | 3300025939 | Ga0207665_10180266 | Ga0207665_101802662 | 186 |
| 527 | 3300025940 | Ga0207691_10000247 | Ga0207691_100002476 | 186 |
| 528 | 3300025940 | Ga0207691_10235331 | Ga0207691_102353312 | 186 |
| 529 | 3300025960 | Ga0207651_10634914 | Ga0207651_106349142 | 186 |
| 530 | 3300025972 | Ga0207668_10035962 | Ga0207668_100359623 | 186 |
| 531 | 3300025972 | Ga0207668_10629956 | Ga0207668_106299562 | 186 |
| 532 | 3300025986 | Ga0207658_10302012 | Ga0207658_103020123 | 186 |
| 533 | 3300026023 | Ga0207677_10021545 | Ga0207677_100215452 | 186 |
| 534 | 3300026078 | Ga0207702_10038562 | Ga0207702_100385625 | 186 |
| 535 | 3300026089 | Ga0207648_10237363 | Ga0207648_102373633 | 186 |
| 536 | 3300026118 | Ga0207675_100323714 | Ga0207675_1003237143 | 186 |
| 537 | 3300026121 | Ga0207683_10006977 | Ga0207683_1000697712 | 186 |
| 538 | 3300026121 | Ga0207683_10008842 | Ga0207683_1000884215 | 186 |
| 539 | 3300028379 | Ga0268266_10325400 | Ga0268266_103254003 | 186 |
| 540 | 3300035089 | Ga0373944_0080838 | Ga0373944_0080838_23_583 | 186 |
| 541 | 3300035116 | Ga0373945_0053651 | Ga0373945_0053651_156_716 | 186 |
| 542 | 3300035116 | Ga0373945_0232692 | Ga0373945_0232692_192_752 | 186 |
| 543 | 3300035170 | Ga0373943_0005531 | Ga0373943_0005531_3292_3852 | 186 |
| 544 | 3300035170 | Ga0373943_0092490 | Ga0373943_0092490_542_1102 | 186 |
| 545 | 3300035171 | Ga0373946_0078616 | Ga0373946_0078616_672_1232 | 186 |
| 546 | 3300035691 | Ga0373931_0036970 | Ga0373931_0036970_601_1161 | 186 |
| 547 | 3300035692 | Ga0373935_0067275 | Ga0373935_0067275_1305_1865 | 186 |
| 548 | 3300035695 | Ga0373927_0200535 | Ga0373927_0200535_237_797 | 186 |
| 549 | 3300035695 | Ga0373927_0608304 | Ga0373927_0608304_110_670 | 186 |
| 550 | 3300035725 | Ga0373947_0015443 | Ga0373947_0015443_2881_3441 | 186 |
| 551 | 3300037068 | Ga0373925_0014401 | Ga0373925_0014401_2842_3402 | 186 |
| 552 | 3300037418 | Ga0395900_0002526 | Ga0395900_0002526_3032_3592 | 186 |
| 553 | 3300037466 | Ga0395898_0079141 | Ga0395898_0079141_577_1137 | 186 |
| 554 | 3300038443 | Ga0395901_0039538 | Ga0395901_0039538_1628_2188 | 186 |
| 555 | 3300046474 | Ga0495605_0063477 | Ga0495605_0063477_660_1220 | 186 |
| 556 | 3300046491 | Ga0495584_0022505 | Ga0495584_0022505_1495_2055 | 186 |
| 557 | 3300046492 | Ga0495585_0065325 | Ga0495585_0065325_988_1548 | 186 |
| 558 | 3300046525 | Ga0495663_0019332 | Ga0495663_0019332_1341_1901 | 186 |
| 559 | 3300046528 | Ga0495642_0022869 | Ga0495642_0022869_1383_1943 | 186 |
| 560 | 3300046537 | Ga0495598_0000901 | Ga0495598_0000901_4511_5071 | 186 |
| 561 | 3300046558 | Ga0495633_0056070 | Ga0495633_0056070_199_759 | 186 |
| 562 | 3300046615 | Ga0495656_0049027 | Ga0495656_0049027_1095_1655 | 186 |
| 563 | 3300046665 | Ga0495661_0193660 | Ga0495661_0193660_156_716 | 186 |
| 564 | 3300046684 | Ga0495669_0009247 | Ga0495669_0009247_2801_3361 | 186 |
| 565 | 3300046691 | Ga0495670_0082094 | Ga0495670_0082094_601_1161 | 186 |
| 566 | 3300046694 | Ga0495649_0204851 | Ga0495649_0204851_342_902 | 186 |
| 567 | 3300047445 | Ga0495677_0064905 | Ga0495677_0064905_453_1013 | 186 |
| 568 | 3300048903 | Ga0496100_0021201 | Ga0496100_0021201_671_1231 | 186 |
| 569 | 3300048903 | Ga0496100_0356210 | Ga0496100_0356210_153_713 | 186 |
| 570 | 3300048904 | Ga0496101_0031362 | Ga0496101_0031362_2506_3066 | 186 |
| 571 | 3300048905 | Ga0496102_0009851 | Ga0496102_0009851_1533_2093 | 186 |
| 572 | 3300048905 | Ga0496102_0251367 | Ga0496102_0251367_728_1288 | 186 |
| 573 | 3300048906 | Ga0496103_0011535 | Ga0496103_0011535_2104_2664 | 186 |
| 574 | 3300048907 | Ga0496104_0014963 | Ga0496104_0014963_5375_5935 | 186 |
| 575 | 3300048909 | Ga0496106_0002174 | Ga0496106_0002174_1891_2451 | 186 |
| 576 | 3300048909 | Ga0496106_0264949 | Ga0496106_0264949_390_950 | 186 |
| 577 | 3300048909 | Ga0496106_0292110 | Ga0496106_0292110_193_753 | 186 |
| 578 | 3300048910 | Ga0496107_0018540 | Ga0496107_0018540_163_723 | 186 |
| 579 | 3300048910 | Ga0496107_0286116 | Ga0496107_0286116_567_1127 | 186 |
| 580 | 3300048911 | Ga0496108_0042309 | Ga0496108_0042309_1458_2018 | 186 |
| 581 | 3300048912 | Ga0496109_0040844 | Ga0496109_0040844_1215_1775 | 186 |
| 582 | 3300048912 | Ga0496109_0287838 | Ga0496109_0287838_277_837 | 186 |
| 583 | 3300048913 | Ga0496110_0132415 | Ga0496110_0132415_736_1296 | 186 |
| 584 | 3300048913 | Ga0496110_0330391 | Ga0496110_0330391_637_1197 | 186 |
| 585 | 3300048914 | Ga0496111_0102523 | Ga0496111_0102523_705_1265 | 186 |
| 586 | 3300048915 | Ga0496112_0017121 | Ga0496112_0017121_3619_4179 | 186 |
| 587 | 3300048915 | Ga0496112_0046152 | Ga0496112_0046152_692_1252 | 186 |
| 588 | 3300048915 | Ga0496112_0050307 | Ga0496112_0050307_1427_1987 | 186 |
| 589 | 3300048915 | Ga0496112_0161160 | Ga0496112_0161160_1433_1993 | 186 |
| 590 | 3300048916 | Ga0496113_0188201 | Ga0496113_0188201_541_1101 | 186 |
| 591 | 3300048916 | Ga0496113_0476967 | Ga0496113_0476967_52_612 | 186 |
| 592 | 3300048916 | Ga0496113_0528149 | Ga0496113_0528149_66_626 | 186 |
| 593 | 3300048917 | Ga0496114_0172612 | Ga0496114_0172612_306_866 | 186 |
| 594 | 3300048918 | Ga0496115_0009615 | Ga0496115_0009615_4388_4948 | 186 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cvo-assembly1.cif.gz_E | cutibacterium acnes 30s ribosomal subunit with sarecycline bound, head domain only in the local refined map | 0.9416 | 24 | 76 |
| 6spf-assembly1.cif.gz_e | pseudomonas aeruginosa 70s ribosome from an aminoglycoside resistant clinical isolate | 0.9299 | 26 | 158 |
| 7unu-assembly1.cif.gz_e | pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) | 0.9158 | 25 | 164 |
| 4v7h-assembly1.cif.gz_AE | structure of the 80s rrna and proteins and p/e trna for eukaryotic ribosome based on cryo-em map of thermomyces lanuginosus ribosome at 8.9a resolution | 0.9123 | 24 | 154 |
| 6zto-assembly1.cif.gz_AE | e. coli 70s-rnap expressome complex in uncoupled state 1 | 0.8915 | 23 | 168 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PEV9_173_236_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9718 | 24 | 82 | 3.30.160.20 |
| af_Q54CA5_1734_1797_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9555 | 25 | 82 | 3.30.160.20 |
| 3j81C02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; | 0.932 | 90 | 157 | 3.30.230.10 |
| af_D3ZQW7_1_92_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.9244 | 24 | 76 | 3.30.160.20 |
| 3ms0E01 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.922 | 23 | 83 | 3.30.160.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G4AJ55-F1-model_v4 | Small ribosomal subunit protein uS5 | 0.9129 | 25 | 168 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A7C4EL12-F1-model_v4 | Small ribosomal subunit protein uS5 | 0.9122 | 23 | 167 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A1G1H0X9-F1-model_v4 | Small ribosomal subunit protein uS5 | 0.9115 | 23 | 168 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2M6X406-F1-model_v4 | Small ribosomal subunit protein uS5 | 0.9089 | 23 | 167 |
GO:0003735
GO:0005737 GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2E7GD17-F1-model_v4 | deleted | 0.9084 | 24 | 168 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar