F467274

General Info

Members Datasets Scaffolds Average Seq Length
593 333 1186 180

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0086350|Ga0501034_0086350_726_1328
Length 200
Sequence VGGAVRPVDPLIGSIQVSRSGGNGMAKRWYIVQAYSNFERKVAEDIKQKVAQKKLEELFDDVIVPTEKVVEMRRGRKVDAERKFFPGYVLVKMEMTDQAFHLIKNTPKVTGFLGSGDKPMPISEKEAMAILQQVQEGVEHPKPSVSFEVGEQVRVSDGPFASFNGVVEEVDEERSRLKVEVSIFGRPTPVELEYGQVEKV

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
80 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
141 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
190 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
191 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
192 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
193 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
194 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
195 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
196 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
224 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
231 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
244 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
264 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
268 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
276 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
277 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
278 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
279 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
313 2534681786 Brucella suis 92/29 Isolate Unclassified
314 2643221574 Brevundimonas sp. Root608 Isolate Unclassified
315 2643221580 Devosia sp. Root635 Isolate Unclassified
316 2643221591 Devosia sp. Root685 Isolate Unclassified
317 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
318 2643221629 Devosia sp. Root105 Isolate Unclassified
319 2643221662 Devosia sp. Root413D1 Isolate Unclassified
320 2643221663 Brevundimonas sp. Root1279 Isolate Unclassified
321 2643221674 Devosia sp. Root436 Isolate Unclassified
322 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
323 2751185800 Brucella pituitosa AA2 Isolate Unclassified
324 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
325 2854911287 Brucella lupini LUP21 Isolate Unclassified
326 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
327 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
328 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
329 2932401849 Devosia sp. 2618 Isolate Rhizosphere
330 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
331 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
332 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
333 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.67
Metatranscriptomes 10.79
Isolates 3.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.97
Nodule 0.17
Rhizoplane 1.18
Rhizosphere 79.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0086350 3300049571 Bacteria 3138
2 JGI24737J22298_10029916 3300001990 Bacteria 1706
3 JGI24737J22298_10091473 3300001990 Bacteria 902
4 JGI25165J46597_1001178 3300003214 Bacteria 16026
5 Ga0006562J51391_1003500 3300003578 Bacteria 4130
6 Ga0055526_1031555 3300003771 Bacteria 1515
7 Ga0055536_1004776 3300003781 Bacteria 6798
8 Ga0055531_10017052 3300003794 Bacteria 3090
9 Ga0055531_10032234 3300003794 Bacteria 1716
10 Ga0065707_10008628 3300005295 Bacteria 2523
11 Ga0070658_10017387 3300005327 Bacteria 5754
12 Ga0070658_10041171 3300005327 Bacteria 3727
13 Ga0070658_10077414 3300005327 Bacteria 2728
14 Ga0070658_10460850 3300005327 Bacteria 1096
15 Ga0070676_10502516 3300005328 Bacteria 861
16 Ga0070660_100167660 3300005339 Bacteria 1772
17 Ga0070660_100480779 3300005339 Bacteria 1032
18 Ga0070660_100957572 3300005339 Bacteria 723
19 Ga0070691_10011857 3300005341 Bacteria 3987
20 Ga0070661_100045249 3300005344 Bacteria 3217
21 Ga0070661_100056918 3300005344 Bacteria 2865
22 Ga0070661_100200235 3300005344 Bacteria 1525
23 Ga0070668_100021350 3300005347 Bacteria 4892
24 Ga0070668_100596944 3300005347 Bacteria 965
25 Ga0070668_101098586 3300005347 Bacteria 718
26 Ga0070669_100135037 3300005353 Bacteria 1897
27 Ga0070675_100099531 3300005354 Bacteria 2448
28 Ga0070671_100512535 3300005355 Bacteria 1032
29 Ga0070674_100049876 3300005356 Bacteria 2880
30 Ga0070673_100015008 3300005364 Bacteria 5421
31 Ga0070673_101590026 3300005364 Bacteria 617
32 Ga0070659_100115700 3300005366 Bacteria 2167
33 Ga0070667_100064208 3300005367 Bacteria 3115
34 Ga0070663_100189296 3300005455 Bacteria 1601
35 Ga0070663_100243034 3300005455 Bacteria 1422
36 Ga0070663_100321331 3300005455 Bacteria 1245
37 Ga0070678_100521948 3300005456 Bacteria 1051
38 Ga0070662_100296732 3300005457 Bacteria 1312
39 Ga0070681_10045736 3300005458 Bacteria 4378
40 Ga0068867_100221002 3300005459 Bacteria 1527
41 Ga0070706_100773966 3300005467 Bacteria 889
42 Ga0070707_100283004 3300005468 Bacteria 1611
43 Ga0070698_100205515 3300005471 Bacteria 1904
44 Ga0070679_100056140 3300005530 Bacteria 3923
45 Ga0070679_100637320 3300005530 Bacteria 1009
46 Ga0070684_100594042 3300005535 Bacteria 1029
47 Ga0068853_100124568 3300005539 Bacteria 2301
48 Ga0068853_100231270 3300005539 Bacteria 1691
49 Ga0068853_100353910 3300005539 Bacteria 1366
50 Ga0070665_100035135 3300005548 Bacteria 5039
51 Ga0070665_100371123 3300005548 Bacteria 1438
52 Ga0070665_100716483 3300005548 Bacteria 1014
53 Ga0068855_100016530 3300005563 Bacteria 8875
54 Ga0068855_100161316 3300005563 Bacteria 2544
55 Ga0068855_100207020 3300005563 Bacteria 2206
56 Ga0070664_100518560 3300005564 Bacteria 1100
57 Ga0068857_100298148 3300005577 Bacteria 1486
58 Ga0068857_100298253 3300005577 Bacteria 1485
59 Ga0068857_100756751 3300005577 Bacteria 926
60 Ga0068854_100013680 3300005578 Bacteria 5331
61 Ga0068854_100161487 3300005578 Bacteria 1736
62 Ga0068854_100321532 3300005578 Bacteria 1258
63 Ga0068856_100261567 3300005614 Bacteria 1746
64 Ga0068856_100556211 3300005614 Bacteria 1168
65 Ga0068856_100564899 3300005614 Bacteria 1159
66 Ga0068852_100014810 3300005616 Bacteria 6023
67 Ga0068852_100019933 3300005616 Bacteria 5322
68 Ga0068852_100031036 3300005616 Bacteria 4404
69 Ga0068852_100196644 3300005616 Bacteria 1906
70 Ga0068852_100607335 3300005616 Bacteria 1099
71 Ga0068852_100685816 3300005616 Bacteria 1034
72 Ga0068861_100271748 3300005719 Bacteria 1456
73 Ga0068861_100585815 3300005719 Bacteria 1022
74 Ga0068851_10130937 3300005834 Bacteria 1356
75 Ga0068863_100499207 3300005841 Bacteria 1198
76 Ga0068863_100566415 3300005841 Bacteria 1123
77 Ga0068858_100633646 3300005842 Bacteria 1038
78 Ga0068862_100038014 3300005844 Bacteria 4082
79 Ga0068862_100525435 3300005844 Bacteria 1127
80 Ga0068862_100673442 3300005844 Bacteria 1000
81 Ga0075363_100032369 3300006048 Bacteria 2715
82 Ga0075363_100153758 3300006048 Bacteria 1299
83 Ga0075363_100159528 3300006048 Bacteria 1276
84 Ga0075364_10041501 3300006051 Bacteria 2987
85 Ga0075362_10036652 3300006177 Bacteria 2146
86 Ga0075362_10124060 3300006177 Bacteria 1224
87 Ga0075362_10369604 3300006177 Bacteria 720
88 Ga0075367_10207723 3300006178 Bacteria 1224
89 Ga0075366_10019485 3300006195 Bacteria 3926
90 Ga0075366_10055078 3300006195 Bacteria 2362
91 Ga0097621_100206393 3300006237 Bacteria 1707
92 Ga0097621_100627304 3300006237 Bacteria 984
93 Ga0075370_10103997 3300006353 Bacteria 1645
94 Ga0075428_100162011 3300006844 Bacteria 2428
95 Ga0075433_10797560 3300006852 Bacteria 825
96 Ga0075434_100065894 3300006871 Bacteria 3607
97 Ga0075429_100390759 3300006880 Bacteria 1218
98 Ga0068865_100446886 3300006881 Bacteria 1068
99 Ga0105240_10039401 3300009093 Bacteria 6051
100 Ga0105240_10176263 3300009093 Bacteria 2527
101 Ga0105240_10297949 3300009093 Bacteria 1846
102 Ga0105240_10301988 3300009093 Bacteria 1831
103 Ga0105240_11430459 3300009093 Bacteria 726
104 Ga0114129_10930662 3300009147 Bacteria 1099
105 Ga0105243_10426046 3300009148 Bacteria 1239
106 Ga0105241_10049359 3300009174 Bacteria 3205
107 Ga0105241_10252956 3300009174 Bacteria 1494
108 Ga0105241_10669745 3300009174 Bacteria 944
109 Ga0105242_12211740 3300009176 Bacteria 595
110 Ga0105237_10036531 3300009545 Bacteria 4972
111 Ga0105237_10042299 3300009545 Bacteria 4595
112 Ga0105238_10050244 3300009551 Bacteria 4197
113 Ga0105238_10092832 3300009551 Bacteria 3006
114 Ga0105238_10110685 3300009551 Bacteria 2727
115 Ga0105238_10153410 3300009551 Bacteria 2278
116 Ga0105238_10303261 3300009551 Bacteria 1581
117 Ga0105239_10001871 3300010375 Bacteria 27550
118 Ga0105239_10287130 3300010375 Bacteria 1852
119 Ga0105239_10365486 3300010375 Bacteria 1630
120 Ga0105239_10564536 3300010375 Bacteria 1297
121 Ga0105239_11578846 3300010375 Bacteria 759
122 Ga0157373_10177775 3300013100 Bacteria 1498
123 Ga0157371_10045139 3300013102 Bacteria 3137
124 Ga0157371_10391427 3300013102 Bacteria 1016
125 Ga0157370_10011802 3300013104 Bacteria 9118
126 Ga0157370_10078661 3300013104 Bacteria 3105
127 Ga0157370_10166128 3300013104 Bacteria 2052
128 Ga0157370_10278139 3300013104 Bacteria 1547
129 Ga0157370_10683615 3300013104 Bacteria 937
130 Ga0157370_10727358 3300013104 Bacteria 905
131 Ga0157369_10015798 3300013105 Bacteria 8504
132 Ga0157369_10069561 3300013105 Bacteria 3781
133 Ga0157369_10145414 3300013105 Bacteria 2507
134 Ga0157369_10214492 3300013105 Bacteria 2016
135 Ga0157374_10062348 3300013296 Bacteria 3494
136 Ga0157374_10339675 3300013296 Bacteria 1491
137 Ga0157374_10482202 3300013296 Bacteria 1243
138 Ga0157374_11510612 3300013296 Bacteria 695
139 Ga0157378_10195211 3300013297 Bacteria 1912
140 Ga0157378_10220349 3300013297 Bacteria 1803
141 Ga0157378_10261139 3300013297 Bacteria 1662
142 Ga0163162_11979186 3300013306 Bacteria 668
143 Ga0157372_10186538 3300013307 Bacteria 2402
144 Ga0157375_10719851 3300013308 Bacteria 1151
145 Ga0163163_10221558 3300014325 Bacteria 1940
146 Ga0163163_10535051 3300014325 Bacteria 1234
147 Ga0163163_10628292 3300014325 Bacteria 1137
148 Ga0163163_10628730 3300014325 Bacteria 1137
149 Ga0157376_10329655 3300014969 Bacteria 1454
150 Ga0157376_10823102 3300014969 Bacteria 942
151 Ga0182007_10016613 3300015262 Bacteria 2712
152 Ga0183365_10002 3300015684 Bacteria 545891
153 Ga0206356_10005975 3300020070 Bacteria 1000
154 Ga0206355_1286819 3300020076 Bacteria 998
155 Ga0206350_11644842 3300020080 Bacteria 987
156 Ga0206354_10838826 3300020081 Bacteria 889
157 Ga0207427_103465 3300025231 Bacteria 3285
158 Ga0209026_1008620 3300025250 Bacteria 2106
159 Ga0209233_1000293 3300025261 Bacteria 63470
160 Ga0209675_1007439 3300025291 Bacteria 4194
161 Ga0209676_1000568 3300025292 Bacteria 55708
162 Ga0209564_1001858 3300025295 Bacteria 19142
163 Ga0209050_1016696 3300025298 Bacteria 2983
164 Ga0209051_1051975 3300025303 Bacteria 1358
165 Ga0209257_1000409 3300025304 Bacteria 83301
166 Ga0209257_1008579 3300025304 Bacteria 5757
167 Ga0207642_10268798 3300025899 Bacteria 975
168 Ga0207680_10407760 3300025903 Bacteria 961
169 Ga0207647_10144628 3300025904 Bacteria 1392
170 Ga0207647_10350067 3300025904 Bacteria 836
171 Ga0207705_10014607 3300025909 Bacteria 5651
172 Ga0207705_10019991 3300025909 Bacteria 4789
173 Ga0207705_10042944 3300025909 Bacteria 3246
174 Ga0207654_10173551 3300025911 Bacteria 1402
175 Ga0207654_10186551 3300025911 Bacteria 1356
176 Ga0207654_10198524 3300025911 Bacteria 1319
177 Ga0207654_10272905 3300025911 Bacteria 1141
178 Ga0207707_10129012 3300025912 Bacteria 2211
179 Ga0207695_10002347 3300025913 Bacteria 28115
180 Ga0207695_10039790 3300025913 Bacteria 5050
181 Ga0207695_10133597 3300025913 Bacteria 2437
182 Ga0207695_10170220 3300025913 Bacteria 2104
183 Ga0207695_10172095 3300025913 Bacteria 2091
184 Ga0207695_10215654 3300025913 Bacteria 1828
185 Ga0207695_11161795 3300025913 Bacteria 652
186 Ga0207671_10005841 3300025914 Bacteria 11184
187 Ga0207671_10337702 3300025914 Bacteria 1193
188 Ga0207671_10631931 3300025914 Bacteria 853
189 Ga0207660_10102435 3300025917 Bacteria 2140
190 Ga0207657_10009003 3300025919 Bacteria 10082
191 Ga0207657_10039932 3300025919 Bacteria 4163
192 Ga0207657_10073177 3300025919 Bacteria 2897
193 Ga0207657_10201488 3300025919 Bacteria 1601
194 Ga0207657_10667359 3300025919 Bacteria 809
195 Ga0207657_10962021 3300025919 Bacteria 656
196 Ga0207649_10113110 3300025920 Bacteria 1818
197 Ga0207649_10216965 3300025920 Bacteria 1360
198 Ga0207652_10098985 3300025921 Bacteria 2572
199 Ga0207652_10233045 3300025921 Bacteria 1659
200 Ga0207646_10125253 3300025922 Bacteria 2310
201 Ga0207681_10312307 3300025923 Bacteria 1247
202 Ga0207694_10013345 3300025924 Bacteria 6187
203 Ga0207694_10067712 3300025924 Bacteria 2787
204 Ga0207694_10088815 3300025924 Bacteria 2437
205 Ga0207694_10375311 3300025924 Bacteria 1180
206 Ga0207659_10194263 3300025926 Bacteria 1617
207 Ga0207687_10475150 3300025927 Bacteria 1040
208 Ga0207644_10354202 3300025931 Bacteria 1192
209 Ga0207706_10058547 3300025933 Bacteria 3394
210 Ga0207706_10306323 3300025933 Bacteria 1384
211 Ga0207709_10377901 3300025935 Bacteria 1077
212 Ga0207704_10170643 3300025938 Bacteria 1560
213 Ga0207691_10990864 3300025940 Bacteria 701
214 Ga0207689_10238851 3300025942 Bacteria 1502
215 Ga0207661_10380218 3300025944 Bacteria 1278
216 Ga0207667_10000877 3300025949 Bacteria 38435
217 Ga0207667_10047577 3300025949 Bacteria 4539
218 Ga0207667_10088375 3300025949 Bacteria 3205
219 Ga0207667_10358009 3300025949 Bacteria 1488
220 Ga0207651_10106272 3300025960 Bacteria 2095
221 Ga0207712_10158067 3300025961 Bacteria 1758
222 Ga0207668_10340869 3300025972 Bacteria 1250
223 Ga0207668_10718429 3300025972 Bacteria 879
224 Ga0207640_10058682 3300025981 Bacteria 2536
225 Ga0207658_10476683 3300025986 Bacteria 1108
226 Ga0207639_10026524 3300026041 Bacteria 4211
227 Ga0207639_10058875 3300026041 Bacteria 2957
228 Ga0207639_10178462 3300026041 Bacteria 1805
229 Ga0207639_10200245 3300026041 Bacteria 1712
230 Ga0207639_10895592 3300026041 Bacteria 829
231 Ga0207678_10098005 3300026067 Bacteria 2505
232 Ga0207678_10210936 3300026067 Bacteria 1661
233 Ga0207678_10260388 3300026067 Bacteria 1486
234 Ga0207678_10460391 3300026067 Bacteria 1106
235 Ga0207702_10023908 3300026078 Bacteria 5069
236 Ga0207702_10198970 3300026078 Bacteria 1856
237 Ga0207702_10565401 3300026078 Bacteria 1113
238 Ga0207641_10543028 3300026088 Bacteria 1133
239 Ga0207641_11119000 3300026088 Bacteria 786
240 Ga0207648_10217674 3300026089 Bacteria 1697
241 Ga0207648_10299591 3300026089 Bacteria 1442
242 Ga0207648_10357381 3300026089 Bacteria 1317
243 Ga0207648_10845726 3300026089 Bacteria 853
244 Ga0207676_10347186 3300026095 Bacteria 1371
245 Ga0207674_10057512 3300026116 Bacteria 3942
246 Ga0207674_10133008 3300026116 Bacteria 2450
247 Ga0207674_10417767 3300026116 Bacteria 1296
248 Ga0207674_10621237 3300026116 Bacteria 1044
249 Ga0207675_100264971 3300026118 Bacteria 1666
250 Ga0207683_10043859 3300026121 Bacteria 3909
251 Ga0207683_11014296 3300026121 Bacteria 770
252 Ga0207698_10016172 3300026142 Bacteria 5021
253 Ga0207698_10035856 3300026142 Bacteria 3633
254 Ga0207698_10047659 3300026142 Bacteria 3248
255 Ga0207698_10394137 3300026142 Bacteria 1321
256 Ga0207698_10441553 3300026142 Bacteria 1254
257 Ga0209973_1014726 3300027252 Bacteria 979
258 Ga0209981_1003112 3300027378 Bacteria 2143
259 Ga0210000_1021184 3300027462 Bacteria 993
260 Ga0209999_1001433 3300027543 Bacteria 4090
261 Ga0209983_1008868 3300027665 Bacteria 2054
262 Ga0209813_10090951 3300027866 Bacteria 1024
263 Ga0268266_10008349 3300028379 Bacteria 9217
264 Ga0268266_10316468 3300028379 Bacteria 1459
265 Ga0268265_10023575 3300028380 Bacteria 4340
266 Ga0268264_10559536 3300028381 Bacteria 1123
267 Ga0265319_1019867 3300028563 Bacteria 2500
268 Ga0265319_1088226 3300028563 Bacteria 980
269 Ga0265318_10028411 3300028577 Bacteria 2187
270 Ga0307517_10017315 3300028786 Bacteria 9404
271 Ga0307517_10153850 3300028786 Bacteria 1568
272 Ga0307515_10389197 3300028794 Bacteria 1024
273 Ga0307515_10583476 3300028794 Bacteria 728
274 Ga0265338_10005488 3300028800 Bacteria 16533
275 Ga0265338_10072606 3300028800 Bacteria 2937
276 Ga0265338_10175726 3300028800 Bacteria 1637
277 Ga0265338_10360529 3300028800 Bacteria 1043
278 Ga0265338_10533449 3300028800 Bacteria 823
279 Ga0265760_10059085 3300031090 Bacteria 1163
280 Ga0265330_10037458 3300031235 Bacteria 2159
281 Ga0265330_10069359 3300031235 Bacteria 1526
282 Ga0265328_10043192 3300031239 Bacteria 1658
283 Ga0265328_10116568 3300031239 Bacteria 994
284 Ga0265320_10031544 3300031240 Bacteria 2721
285 Ga0265325_10005965 3300031241 Bacteria 7461
286 Ga0265325_10163790 3300031241 Bacteria 1044
287 Ga0265329_10023539 3300031242 Bacteria 2051
288 Ga0265340_10027855 3300031247 Bacteria 2846
289 Ga0265340_10054518 3300031247 Bacteria 1928
290 Ga0265339_10003829 3300031249 Bacteria 10455
291 Ga0265339_10072571 3300031249 Bacteria 1831
292 Ga0265327_10002372 3300031251 Bacteria 20065
293 Ga0265327_10082224 3300031251 Bacteria 1588
294 Ga0265327_10133561 3300031251 Bacteria 1165
295 Ga0307513_10119626 3300031456 Bacteria 2605
296 Ga0307513_10209279 3300031456 Bacteria 1783
297 Ga0265313_10005744 3300031595 Bacteria 9030
298 Ga0265313_10010610 3300031595 Bacteria 5803
299 Ga0307508_10747184 3300031616 Bacteria 591
300 Ga0316575_10174733 3300031665 Bacteria 891
301 Ga0265314_10026660 3300031711 Bacteria 4338
302 Ga0265314_10122183 3300031711 Bacteria 1637
303 Ga0265342_10012909 3300031712 Bacteria 5633
304 Ga0265342_10175308 3300031712 Bacteria 1177
305 Ga0265342_10188784 3300031712 Bacteria 1125
306 Ga0307405_10233495 3300031731 Bacteria 1357
307 Ga0316577_10015566 3300031733 Bacteria 4185
308 Ga0307413_10234703 3300031824 Bacteria 1349
309 Ga0307406_10020179 3300031901 Bacteria 3920
310 Ga0307406_10220598 3300031901 Bacteria 1409
311 Ga0307407_10350768 3300031903 Bacteria 1045
312 Ga0307412_10501461 3300031911 Bacteria 1011
313 Ga0307412_10615991 3300031911 Bacteria 921
314 Ga0307409_100160211 3300031995 Bacteria 1967
315 Ga0307409_100183418 3300031995 Bacteria 1855
316 Ga0307414_10158521 3300032004 Bacteria 1794
317 Ga0307414_10251061 3300032004 Bacteria 1470
318 Ga0307414_10279709 3300032004 Bacteria 1401
319 Ga0307414_10362365 3300032004 Bacteria 1248
320 Ga0307414_10503944 3300032004 Bacteria 1071
321 Ga0307414_10536895 3300032004 Bacteria 1040
322 Ga0307414_11017494 3300032004 Bacteria 763
323 Ga0307411_10025036 3300032005 Bacteria 3568
324 Ga0307411_10362977 3300032005 Bacteria 1185
325 Ga0307415_100496592 3300032126 Bacteria 1066
326 Ga0307415_100730290 3300032126 Bacteria 897
327 Ga0316593_10003346 3300032168 Bacteria 3964
328 Ga0316593_10049940 3300032168 Bacteria 1410
329 Ga0316593_10136180 3300032168 Bacteria 888
330 Ga0316596_1014420 3300033541 Bacteria 1959
331 Ga0373928_0006334 3300035084 Bacteria 2277
332 Ga0373944_0011684 3300035089 Bacteria 2409
333 Ga0373945_0319129 3300035116 Bacteria 668
334 Ga0373946_0021471 3300035171 Bacteria 2504
335 Ga0373942_0011773 3300035207 Bacteria 2079
336 Ga0316584_0276083 3300036712 Bacteria 1222
337 Ga0373925_0011853 3300037068 Bacteria 6309
338 Ga0395899_0124663 3300037312 Bacteria 1843
339 Ga0395899_0135084 3300037312 Bacteria 1758
340 Ga0395899_0225003 3300037312 Bacteria 1298
341 Ga0395900_0001326 3300037418 Bacteria 29962
342 Ga0395900_0434395 3300037418 Bacteria 1271
343 Ga0395898_0048963 3300037466 Bacteria 4143
344 Ga0395898_0074152 3300037466 Bacteria 3287
345 Ga0395905_0000858 3300037471 Bacteria 39725
346 Ga0395901_0006588 3300038443 Bacteria 11733
347 Ga0395901_0133546 3300038443 Bacteria 2608
348 Ga0395901_0267197 3300038443 Bacteria 1780
349 Ga0395901_0380795 3300038443 Bacteria 1452
350 Ga0400487_44160 3300039110 Bacteria 3629
351 Ga0436365_0759160 3300039437 Bacteria 802
352 Ga0436365_1043054 3300039437 Bacteria 883
353 Ga0436360_0228618 3300039438 Bacteria 675
354 Ga0436360_1227143 3300039438 Bacteria 773
355 Ga0436361_0283636 3300039447 Bacteria 1186
356 Ga0436361_0743740 3300039447 Bacteria 979
357 Ga0439465_0167991 3300041413 Bacteria 789
358 Ga0451797_0660248 3300041453 Bacteria 1214
359 Ga0451835_0029965 3300041492 Bacteria 602
360 Ga0451845_0932815 3300041501 Bacteria 806
361 Ga0439441_132058 3300042001 Bacteria 579
362 Ga0439432_178502 3300042006 Bacteria 619
363 Ga0439462_0047104 3300042015 Bacteria 1156
364 Ga0439459_0012158 3300042438 Bacteria 1528
365 Ga0466972_0179438 3300044658 Bacteria 993
366 Ga0466961_0172245 3300044693 Bacteria 1346
367 Ga0466963_0419411 3300044694 Bacteria 944
368 Ga0466971_0545625 3300044719 Bacteria 575
369 Ga0466959_0017451 3300045049 Bacteria 5262
370 Ga0466967_0526237 3300045976 Bacteria 1162
371 Ga0495620_0147397 3300046515 Bacteria 918
372 Ga0495644_0037224 3300046523 Bacteria 1836
373 Ga0495642_0100535 3300046528 Bacteria 1230
374 Ga0495598_0000485 3300046537 Bacteria 7290
375 Ga0495597_0296479 3300046542 Bacteria 628
376 Ga0495633_0003352 3300046558 Bacteria 10748
377 Ga0495668_0077225 3300046616 Bacteria 1828
378 Ga0495668_0079185 3300046616 Bacteria 1804
379 Ga0495611_0021759 3300046648 Bacteria 2771
380 Ga0495625_0016914 3300046660 Bacteria 5723
381 Ga0495625_0143909 3300046660 Bacteria 1607
382 Ga0495669_0035371 3300046684 Bacteria 2205
383 Ga0495649_0006906 3300046694 Bacteria 7022
384 Ga0495649_0137210 3300046694 Bacteria 1289
385 Ga0495636_0001365 3300047318 Bacteria 9237
386 Ga0495636_0180044 3300047318 Bacteria 959
387 Ga0495672_0132747 3300047320 Bacteria 1308
388 Ga0495686_0014923 3300047472 Bacteria 5328
389 Ga0495686_0051823 3300047472 Bacteria 2574
390 Ga0496104_0416016 3300048907 Bacteria 1257
391 Ga0496109_0159407 3300048912 Bacteria 2114
392 Ga0496110_0217866 3300048913 Bacteria 1736
393 Ga0496111_0041973 3300048914 Bacteria 3284
394 Ga0496113_0402749 3300048916 Bacteria 1099
395 Ga0496114_0993790 3300048917 Bacteria 722
396 Ga0496116_0026200 3300048919 Bacteria 4270
397 Ga0496119_0046912 3300048922 Bacteria 2692
398 Ga0496120_0051339 3300048923 Bacteria 2356
399 Ga0496121_0035615 3300048924 Bacteria 4456
400 Ga0496121_0360158 3300048924 Bacteria 966
401 Ga0496121_0540723 3300048924 Bacteria 731
402 Ga0496122_0021882 3300048925 Bacteria 5703
403 Ga0496122_0074305 3300048925 Bacteria 2405
404 Ga0496123_0001897 3300048926 Bacteria 27276
405 Ga0496124_0132957 3300048927 Bacteria 1974
406 Ga0496125_0000332 3300048928 Bacteria 90664
407 Ga0496125_0013173 3300048928 Bacteria 8147
408 Ga0496125_0214014 3300048928 Bacteria 1248
409 Ga0496126_0178063 3300048929 Bacteria 1808
410 Ga0496126_0189404 3300048929 Bacteria 1743
411 Ga0496126_0434148 3300048929 Bacteria 1060
412 Ga0501319_002929 3300049535 Bacteria 1112
413 Ga0501031_0031373 3300049568 Bacteria 3466
414 Ga0501031_0418698 3300049568 Bacteria 866
415 Ga0501032_0000353 3300049569 Bacteria 38266
416 Ga0501033_0074646 3300049570 Bacteria 2489
417 Ga0501033_0108928 3300049570 Bacteria 2017
418 Ga0501033_0170158 3300049570 Bacteria 1565
419 Ga0501034_0002037 3300049571 Bacteria 25398
420 Ga0501034_0019877 3300049571 Bacteria 6861
421 Ga0501034_0136346 3300049571 Bacteria 2435
422 Ga0501034_0142332 3300049571 Bacteria 2377
423 Ga0501034_0264458 3300049571 Bacteria 1662
424 Ga0501034_0283362 3300049571 Bacteria 1596
425 Ga0501034_0666762 3300049571 Bacteria 941
426 Ga0501036_0004376 3300049572 Bacteria 11401
427 Ga0501036_0364857 3300049572 Bacteria 1206
428 Ga0501036_0829203 3300049572 Bacteria 761
429 Ga0501037_0009761 3300049573 Bacteria 7048
430 Ga0501037_0415367 3300049573 Bacteria 921
431 Ga0501037_0502170 3300049573 Bacteria 823
432 Ga0501038_0077633 3300049574 Bacteria 2803
433 Ga0501038_0875457 3300049574 Bacteria 664
434 Ga0501039_0412867 3300049575 Bacteria 1060
435 Ga0501043_0093303 3300049579 Bacteria 2366
436 Ga0501043_0172198 3300049579 Bacteria 1689
437 Ga0501046_0090258 3300049580 Bacteria 2358
438 Ga0501047_0022580 3300049581 Bacteria 6041
439 Ga0501047_0101080 3300049581 Bacteria 2763
440 Ga0501047_0198157 3300049581 Bacteria 1870
441 Ga0501067_0005732 3300049583 Bacteria 6893
442 Ga0501067_0063219 3300049583 Bacteria 2049
443 Ga0501070_0005291 3300049586 Bacteria 11012
444 Ga0501070_0070868 3300049586 Bacteria 2886
445 Ga0501070_0109892 3300049586 Bacteria 2278
446 Ga0501070_0850910 3300049586 Bacteria 714
447 Ga0501071_1020826 3300049587 Bacteria 639
448 Ga0501072_0002118 3300049588 Bacteria 14789
449 Ga0501072_0050290 3300049588 Bacteria 3282
450 Ga0501073_0014097 3300049589 Bacteria 5807
451 Ga0501073_0100511 3300049589 Bacteria 2008
452 Ga0501073_0232330 3300049589 Bacteria 1274
453 Ga0501074_0002236 3300049590 Bacteria 13434
454 Ga0501074_0127774 3300049590 Bacteria 1819
455 Ga0501079_0259232 3300049741 Bacteria 1359
456 Ga0501080_0006112 3300049742 Bacteria 10794
457 Ga0501080_0043318 3300049742 Bacteria 4191
458 Ga0501080_0357176 3300049742 Bacteria 1319
459 Ga0501083_0012769 3300049744 Bacteria 5874
460 Ga0501035_0090514 3300049822 Bacteria 2693
461 Ga0501035_0114657 3300049822 Bacteria 2359
462 Ga0501035_0137247 3300049822 Bacteria 2128
463 Ga0501035_0549079 3300049822 Bacteria 946
464 Ga0501044_0025232 3300049823 Bacteria 6302
465 Ga0501044_0064786 3300049823 Bacteria 3729
466 Ga0501044_0167797 3300049823 Bacteria 2168
467 Ga0501044_0406359 3300049823 Bacteria 1273
468 Ga0501044_0495597 3300049823 Bacteria 1123
469 Ga0501045_0469858 3300049824 Bacteria 935
470 nmdc:mga03683_77093_c1 3300050489 Bacteria 1434
471 nmdc:mga03n38_117316_c1 3300050490 Bacteria 1304
472 nmdc:mga00v17_187001_c1 3300050491 Bacteria 1337
473 nmdc:mga00v17_713256_c1 3300050491 Bacteria 642
474 nmdc:mga00v17_72435_c1 3300050491 Bacteria 2138
475 nmdc:mga0k408_199884_c1 3300050493 Bacteria 1193
476 nmdc:mga0k408_263869_c1 3300050493 Bacteria 1028
477 nmdc:mga0k408_294588_c1 3300050493 Bacteria 968
478 nmdc:mga0k408_349461_c1 3300050493 Bacteria 881
479 nmdc:mga0k408_94914_c1 3300050493 Bacteria 1754
480 nmdc:mga06z11_174188_c1 3300050494 Bacteria 1237
481 nmdc:mga06z11_56646_c1 3300050494 Bacteria 2028
482 nmdc:mga04h51_25967_c1 3300050495 Bacteria 1807
483 nmdc:mga07m45_410316_c1 3300050496 Bacteria 786
484 nmdc:mga07m45_43800_c1 3300050496 Bacteria 2510
485 nmdc:mga0a205_603859_c1 3300050515 Bacteria 950
486 nmdc:mga0sz30_47315_c1 3300050516 Bacteria 1396
487 Ga0500643_000723 3300053087 Bacteria 21742
488 Ga0500643_008293 3300053087 Bacteria 4091
489 Ga0500644_0001107 3300053088 Bacteria 7942
490 Ga0500566_0387973 3300053094 Bacteria 629
491 Ga0500641_0011889 3300053096 Bacteria 3167
492 Ga0500555_004874 3300053103 Bacteria 3808
493 Ga0500556_0005007 3300053104 Bacteria 3748
494 Ga0500556_0009636 3300053104 Bacteria 2812
495 Ga0500556_0069962 3300053104 Bacteria 1309
496 Ga0500556_0086223 3300053104 Bacteria 1194
497 Ga0500562_000681 3300053108 Bacteria 8259
498 Ga0500562_090903 3300053108 Bacteria 828
499 Ga0500608_000939 3300053122 Bacteria 10440
500 Ga0500559_0046691 3300053136 Bacteria 1900
501 Ga0500559_0110960 3300053136 Bacteria 1271
502 Ga0500559_0124663 3300053136 Bacteria 1200
503 Ga0500559_0331992 3300053136 Bacteria 712
504 Ga0500568_0030281 3300053139 Bacteria 2242
505 Ga0500604_0000349 3300053151 Bacteria 12752
506 Ga0500616_0056403 3300053153 Bacteria 2051
507 Ga0500616_0082672 3300053153 Bacteria 1610
508 Ga0500622_0008596 3300053156 Bacteria 5701
509 Ga0500622_0150322 3300053156 Bacteria 1101
510 Ga0500624_003122 3300053157 Bacteria 2184
511 Ga0500627_0207561 3300053158 Bacteria 877
512 Ga0500634_0000076 3300053161 Bacteria 38266
513 Ga0500645_003194 3300053730 Bacteria 6809
514 Ga0500645_011120 3300053730 Bacteria 2950
515 Ga0500645_116944 3300053730 Bacteria 745
516 Ga0501084_0820264 3300054114 Bacteria 783
517 Ga0587084_060894 3300059477 Bacteria 692
518 Ga0587084_098001 3300059477 Bacteria 591
519 Ga0587066_016517 3300059490 Bacteria 1164
520 Ga0587070_017442 3300059491 Bacteria 1164
521 Ga0587070_032366 3300059491 Bacteria 955
522 Ga0587070_128421 3300059491 Bacteria 614
523 Ga0587077_009922 3300059493 Bacteria 1459
524 Ga0587077_018511 3300059493 Bacteria 1200
525 Ga0587077_050643 3300059493 Bacteria 868
526 Ga0587077_056346 3300059493 Bacteria 838
527 Ga0587077_056411 3300059493 Bacteria 838
528 Ga0587080_013869 3300059503 Bacteria 1240
529 Ga0587082_019313 3300059504 Bacteria 1093
530 Ga0587082_030216 3300059504 Bacteria 940
531 Ga0587085_024532 3300059506 Bacteria 946
532 Ga0587086_011556 3300059507 Bacteria 1085
533 Ga0587086_019450 3300059507 Bacteria 914
534 Ga0587088_070995 3300059508 Bacteria 726
535 Ga0587091_006642 3300059511 Bacteria 1634
536 Ga0587092_057966 3300059512 Bacteria 718
537 Ga0587106_009910 3300059605 Bacteria 1222
538 Ga0587106_019344 3300059605 Bacteria 993
539 Ga0587101_010360 3300059623 Bacteria 1169
540 Ga0587101_020262 3300059623 Bacteria 950
541 Ga0587109_015552 3300059624 Bacteria 1293
542 Ga0587109_040342 3300059624 Bacteria 923
543 Ga0587127_003572 3300059629 Bacteria 994
544 Ga0587128_015576 3300059630 Bacteria 1104
545 Ga0587128_105633 3300059630 Bacteria 596
546 Ga0587062_003520 3300059639 Bacteria 1590
547 Ga0587062_010141 3300059639 Bacteria 1163
548 Ga0587067_019647 3300059640 Bacteria 1147
549 Ga0587068_012481 3300059641 Bacteria 1297
550 Ga0587069_006174 3300059642 Bacteria 1430
551 Ga0587072_004181 3300059643 Bacteria 2079
552 Ga0587072_027718 3300059643 Bacteria 1041
553 Ga0587075_016471 3300059644 Bacteria 1051
554 Ga0587075_073567 3300059644 Bacteria 639
555 Ga0587075_073891 3300059644 Bacteria 638
556 Ga0587076_026837 3300059645 Bacteria 994
557 Ga0587076_038489 3300059645 Bacteria 883
558 Ga0587076_114693 3300059645 Bacteria 617
559 Ga0587078_007400 3300059646 Bacteria 1213
560 Ga0587100_007304 3300059648 Bacteria 870
561 Ga0587107_007979 3300059652 Bacteria 1209
562 Ga0587107_022463 3300059652 Bacteria 893
563 Ga0587124_002826 3300059660 Bacteria 1253
564 Ga0587124_006690 3300059660 Bacteria 955
565 Ga0587071_038084 3300060344 Bacteria 954
566 Ga0587111_0004584 3300060346 Bacteria 2069
567 Ga0587111_0005023 3300060346 Bacteria 2013
568 Ga0587111_0014909 3300060346 Bacteria 1412
569 Ga0587111_0045636 3300060346 Bacteria 950
570 Ga0501082_0012036 3300060353 Bacteria 7435
571 Ga0466962_0100180 3300061719 Bacteria 1391
572 Ga0530510_0650489 3300061734 Bacteria 803
573 2535484961 2534681786 Bacteria 3308809
574 2643883449 2643221574 Bacteria 2789653
575 2643911564 2643221580 Bacteria 3816678
576 2643963637 2643221591 Bacteria 4397626
577 2644000523 2643221598 Bacteria 4578346
578 2644165919 2643221629 Bacteria 5850260
579 2644347071 2643221662 Bacteria 5851492
580 2644353969 2643221663 Bacteria 3425771
581 2644410358 2643221674 Bacteria 3919126
582 2739791481 2739367756 Bacteria 4553612
583 2753359590 2751185800 Bacteria 5467370
584 2758641852 2758568016 Bacteria 5645291
585 2854912181 2854911287 Bacteria 5582813
586 2894776363 2894772417 Bacteria 5305674
587 2915652217 2915650412 Bacteria 4288180
588 2928975369 2928972540 Bacteria 3058286
589 2932403048 2932401849 Bacteria 4262978
590 2941486899 2941485952 Bacteria 3591484
591 2977241642 2977240413 Bacteria 3191065
592 8019683019 8019678201 Bacteria 8863603
593 8045865520 8045864390 Bacteria 5043873
594 Ga0501034_0086350
595 JGI24737J22298_10029916
596 JGI24737J22298_10091473
597 JGI25165J46597_1001178
598 Ga0006562J51391_1003500
599 Ga0055526_1031555
600 Ga0055536_1004776
601 Ga0055531_10017052
602 Ga0055531_10032234
603 Ga0065707_10008628
604 Ga0070658_10017387
605 Ga0070658_10041171
606 Ga0070658_10077414
607 Ga0070658_10460850
608 Ga0070676_10502516
609 Ga0070660_100167660
610 Ga0070660_100480779
611 Ga0070660_100957572
612 Ga0070691_10011857
613 Ga0070661_100045249
614 Ga0070661_100056918
615 Ga0070661_100200235
616 Ga0070668_100021350
617 Ga0070668_100596944
618 Ga0070668_101098586
619 Ga0070669_100135037
620 Ga0070675_100099531
621 Ga0070671_100512535
622 Ga0070674_100049876
623 Ga0070673_100015008
624 Ga0070673_101590026
625 Ga0070659_100115700
626 Ga0070667_100064208
627 Ga0070663_100189296
628 Ga0070663_100243034
629 Ga0070663_100321331
630 Ga0070678_100521948
631 Ga0070662_100296732
632 Ga0070681_10045736
633 Ga0068867_100221002
634 Ga0070706_100773966
635 Ga0070707_100283004
636 Ga0070698_100205515
637 Ga0070679_100056140
638 Ga0070679_100637320
639 Ga0070684_100594042
640 Ga0068853_100124568
641 Ga0068853_100231270
642 Ga0068853_100353910
643 Ga0070665_100035135
644 Ga0070665_100371123
645 Ga0070665_100716483
646 Ga0068855_100016530
647 Ga0068855_100161316
648 Ga0068855_100207020
649 Ga0070664_100518560
650 Ga0068857_100298148
651 Ga0068857_100298253
652 Ga0068857_100756751
653 Ga0068854_100013680
654 Ga0068854_100161487
655 Ga0068854_100321532
656 Ga0068856_100261567
657 Ga0068856_100556211
658 Ga0068856_100564899
659 Ga0068852_100014810
660 Ga0068852_100019933
661 Ga0068852_100031036
662 Ga0068852_100196644
663 Ga0068852_100607335
664 Ga0068852_100685816
665 Ga0068861_100271748
666 Ga0068861_100585815
667 Ga0068851_10130937
668 Ga0068863_100499207
669 Ga0068863_100566415
670 Ga0068858_100633646
671 Ga0068862_100038014
672 Ga0068862_100525435
673 Ga0068862_100673442
674 Ga0075363_100032369
675 Ga0075363_100153758
676 Ga0075363_100159528
677 Ga0075364_10041501
678 Ga0075362_10036652
679 Ga0075362_10124060
680 Ga0075362_10369604
681 Ga0075367_10207723
682 Ga0075366_10019485
683 Ga0075366_10055078
684 Ga0097621_100206393
685 Ga0097621_100627304
686 Ga0075370_10103997
687 Ga0075428_100162011
688 Ga0075433_10797560
689 Ga0075434_100065894
690 Ga0075429_100390759
691 Ga0068865_100446886
692 Ga0105240_10039401
693 Ga0105240_10176263
694 Ga0105240_10297949
695 Ga0105240_10301988
696 Ga0105240_11430459
697 Ga0114129_10930662
698 Ga0105243_10426046
699 Ga0105241_10049359
700 Ga0105241_10252956
701 Ga0105241_10669745
702 Ga0105242_12211740
703 Ga0105237_10036531
704 Ga0105237_10042299
705 Ga0105238_10050244
706 Ga0105238_10092832
707 Ga0105238_10110685
708 Ga0105238_10153410
709 Ga0105238_10303261
710 Ga0105239_10001871
711 Ga0105239_10287130
712 Ga0105239_10365486
713 Ga0105239_10564536
714 Ga0105239_11578846
715 Ga0157373_10177775
716 Ga0157371_10045139
717 Ga0157371_10391427
718 Ga0157370_10011802
719 Ga0157370_10078661
720 Ga0157370_10166128
721 Ga0157370_10278139
722 Ga0157370_10683615
723 Ga0157370_10727358
724 Ga0157369_10015798
725 Ga0157369_10069561
726 Ga0157369_10145414
727 Ga0157369_10214492
728 Ga0157374_10062348
729 Ga0157374_10339675
730 Ga0157374_10482202
731 Ga0157374_11510612
732 Ga0157378_10195211
733 Ga0157378_10220349
734 Ga0157378_10261139
735 Ga0163162_11979186
736 Ga0157372_10186538
737 Ga0157375_10719851
738 Ga0163163_10221558
739 Ga0163163_10535051
740 Ga0163163_10628292
741 Ga0163163_10628730
742 Ga0157376_10329655
743 Ga0157376_10823102
744 Ga0182007_10016613
745 Ga0183365_10002
746 Ga0206356_10005975
747 Ga0206355_1286819
748 Ga0206350_11644842
749 Ga0206354_10838826
750 Ga0207427_103465
751 Ga0209026_1008620
752 Ga0209233_1000293
753 Ga0209675_1007439
754 Ga0209676_1000568
755 Ga0209564_1001858
756 Ga0209050_1016696
757 Ga0209051_1051975
758 Ga0209257_1000409
759 Ga0209257_1008579
760 Ga0207642_10268798
761 Ga0207680_10407760
762 Ga0207647_10144628
763 Ga0207647_10350067
764 Ga0207705_10014607
765 Ga0207705_10019991
766 Ga0207705_10042944
767 Ga0207654_10173551
768 Ga0207654_10186551
769 Ga0207654_10198524
770 Ga0207654_10272905
771 Ga0207707_10129012
772 Ga0207695_10002347
773 Ga0207695_10039790
774 Ga0207695_10133597
775 Ga0207695_10170220
776 Ga0207695_10172095
777 Ga0207695_10215654
778 Ga0207695_11161795
779 Ga0207671_10005841
780 Ga0207671_10337702
781 Ga0207671_10631931
782 Ga0207660_10102435
783 Ga0207657_10009003
784 Ga0207657_10039932
785 Ga0207657_10073177
786 Ga0207657_10201488
787 Ga0207657_10667359
788 Ga0207657_10962021
789 Ga0207649_10113110
790 Ga0207649_10216965
791 Ga0207652_10098985
792 Ga0207652_10233045
793 Ga0207646_10125253
794 Ga0207681_10312307
795 Ga0207694_10013345
796 Ga0207694_10067712
797 Ga0207694_10088815
798 Ga0207694_10375311
799 Ga0207659_10194263
800 Ga0207687_10475150
801 Ga0207644_10354202
802 Ga0207706_10058547
803 Ga0207706_10306323
804 Ga0207709_10377901
805 Ga0207704_10170643
806 Ga0207691_10990864
807 Ga0207689_10238851
808 Ga0207661_10380218
809 Ga0207667_10000877
810 Ga0207667_10047577
811 Ga0207667_10088375
812 Ga0207667_10358009
813 Ga0207651_10106272
814 Ga0207712_10158067
815 Ga0207668_10340869
816 Ga0207668_10718429
817 Ga0207640_10058682
818 Ga0207658_10476683
819 Ga0207639_10026524
820 Ga0207639_10058875
821 Ga0207639_10178462
822 Ga0207639_10200245
823 Ga0207639_10895592
824 Ga0207678_10098005
825 Ga0207678_10210936
826 Ga0207678_10260388
827 Ga0207678_10460391
828 Ga0207702_10023908
829 Ga0207702_10198970
830 Ga0207702_10565401
831 Ga0207641_10543028
832 Ga0207641_11119000
833 Ga0207648_10217674
834 Ga0207648_10299591
835 Ga0207648_10357381
836 Ga0207648_10845726
837 Ga0207676_10347186
838 Ga0207674_10057512
839 Ga0207674_10133008
840 Ga0207674_10417767
841 Ga0207674_10621237
842 Ga0207675_100264971
843 Ga0207683_10043859
844 Ga0207683_11014296
845 Ga0207698_10016172
846 Ga0207698_10035856
847 Ga0207698_10047659
848 Ga0207698_10394137
849 Ga0207698_10441553
850 Ga0209973_1014726
851 Ga0209981_1003112
852 Ga0210000_1021184
853 Ga0209999_1001433
854 Ga0209983_1008868
855 Ga0209813_10090951
856 Ga0268266_10008349
857 Ga0268266_10316468
858 Ga0268265_10023575
859 Ga0268264_10559536
860 Ga0265319_1019867
861 Ga0265319_1088226
862 Ga0265318_10028411
863 Ga0307517_10017315
864 Ga0307517_10153850
865 Ga0307515_10389197
866 Ga0307515_10583476
867 Ga0265338_10005488
868 Ga0265338_10072606
869 Ga0265338_10175726
870 Ga0265338_10360529
871 Ga0265338_10533449
872 Ga0265760_10059085
873 Ga0265330_10037458
874 Ga0265330_10069359
875 Ga0265328_10043192
876 Ga0265328_10116568
877 Ga0265320_10031544
878 Ga0265325_10005965
879 Ga0265325_10163790
880 Ga0265329_10023539
881 Ga0265340_10027855
882 Ga0265340_10054518
883 Ga0265339_10003829
884 Ga0265339_10072571
885 Ga0265327_10002372
886 Ga0265327_10082224
887 Ga0265327_10133561
888 Ga0307513_10119626
889 Ga0307513_10209279
890 Ga0265313_10005744
891 Ga0265313_10010610
892 Ga0307508_10747184
893 Ga0316575_10174733
894 Ga0265314_10026660
895 Ga0265314_10122183
896 Ga0265342_10012909
897 Ga0265342_10175308
898 Ga0265342_10188784
899 Ga0307405_10233495
900 Ga0316577_10015566
901 Ga0307413_10234703
902 Ga0307406_10020179
903 Ga0307406_10220598
904 Ga0307407_10350768
905 Ga0307412_10501461
906 Ga0307412_10615991
907 Ga0307409_100160211
908 Ga0307409_100183418
909 Ga0307414_10158521
910 Ga0307414_10251061
911 Ga0307414_10279709
912 Ga0307414_10362365
913 Ga0307414_10503944
914 Ga0307414_10536895
915 Ga0307414_11017494
916 Ga0307411_10025036
917 Ga0307411_10362977
918 Ga0307415_100496592
919 Ga0307415_100730290
920 Ga0316593_10003346
921 Ga0316593_10049940
922 Ga0316593_10136180
923 Ga0316596_1014420
924 Ga0373928_0006334
925 Ga0373944_0011684
926 Ga0373945_0319129
927 Ga0373946_0021471
928 Ga0373942_0011773
929 Ga0316584_0276083
930 Ga0373925_0011853
931 Ga0395899_0124663
932 Ga0395899_0135084
933 Ga0395899_0225003
934 Ga0395900_0001326
935 Ga0395900_0434395
936 Ga0395898_0048963
937 Ga0395898_0074152
938 Ga0395905_0000858
939 Ga0395901_0006588
940 Ga0395901_0133546
941 Ga0395901_0267197
942 Ga0395901_0380795
943 Ga0400487_44160
944 Ga0436365_0759160
945 Ga0436365_1043054
946 Ga0436360_0228618
947 Ga0436360_1227143
948 Ga0436361_0283636
949 Ga0436361_0743740
950 Ga0439465_0167991
951 Ga0451797_0660248
952 Ga0451835_0029965
953 Ga0451845_0932815
954 Ga0439441_132058
955 Ga0439432_178502
956 Ga0439462_0047104
957 Ga0439459_0012158
958 Ga0466972_0179438
959 Ga0466961_0172245
960 Ga0466963_0419411
961 Ga0466971_0545625
962 Ga0466959_0017451
963 Ga0466967_0526237
964 Ga0495620_0147397
965 Ga0495644_0037224
966 Ga0495642_0100535
967 Ga0495598_0000485
968 Ga0495597_0296479
969 Ga0495633_0003352
970 Ga0495668_0077225
971 Ga0495668_0079185
972 Ga0495611_0021759
973 Ga0495625_0016914
974 Ga0495625_0143909
975 Ga0495669_0035371
976 Ga0495649_0006906
977 Ga0495649_0137210
978 Ga0495636_0001365
979 Ga0495636_0180044
980 Ga0495672_0132747
981 Ga0495686_0014923
982 Ga0495686_0051823
983 Ga0496104_0416016
984 Ga0496109_0159407
985 Ga0496110_0217866
986 Ga0496111_0041973
987 Ga0496113_0402749
988 Ga0496114_0993790
989 Ga0496116_0026200
990 Ga0496119_0046912
991 Ga0496120_0051339
992 Ga0496121_0035615
993 Ga0496121_0360158
994 Ga0496121_0540723
995 Ga0496122_0021882
996 Ga0496122_0074305
997 Ga0496123_0001897
998 Ga0496124_0132957
999 Ga0496125_0000332
1000 Ga0496125_0013173
1001 Ga0496125_0214014
1002 Ga0496126_0178063
1003 Ga0496126_0189404
1004 Ga0496126_0434148
1005 Ga0501319_002929
1006 Ga0501031_0031373
1007 Ga0501031_0418698
1008 Ga0501032_0000353
1009 Ga0501033_0074646
1010 Ga0501033_0108928
1011 Ga0501033_0170158
1012 Ga0501034_0002037
1013 Ga0501034_0019877
1014 Ga0501034_0136346
1015 Ga0501034_0142332
1016 Ga0501034_0264458
1017 Ga0501034_0283362
1018 Ga0501034_0666762
1019 Ga0501036_0004376
1020 Ga0501036_0364857
1021 Ga0501036_0829203
1022 Ga0501037_0009761
1023 Ga0501037_0415367
1024 Ga0501037_0502170
1025 Ga0501038_0077633
1026 Ga0501038_0875457
1027 Ga0501039_0412867
1028 Ga0501043_0093303
1029 Ga0501043_0172198
1030 Ga0501046_0090258
1031 Ga0501047_0022580
1032 Ga0501047_0101080
1033 Ga0501047_0198157
1034 Ga0501067_0005732
1035 Ga0501067_0063219
1036 Ga0501070_0005291
1037 Ga0501070_0070868
1038 Ga0501070_0109892
1039 Ga0501070_0850910
1040 Ga0501071_1020826
1041 Ga0501072_0002118
1042 Ga0501072_0050290
1043 Ga0501073_0014097
1044 Ga0501073_0100511
1045 Ga0501073_0232330
1046 Ga0501074_0002236
1047 Ga0501074_0127774
1048 Ga0501079_0259232
1049 Ga0501080_0006112
1050 Ga0501080_0043318
1051 Ga0501080_0357176
1052 Ga0501083_0012769
1053 Ga0501035_0090514
1054 Ga0501035_0114657
1055 Ga0501035_0137247
1056 Ga0501035_0549079
1057 Ga0501044_0025232
1058 Ga0501044_0064786
1059 Ga0501044_0167797
1060 Ga0501044_0406359
1061 Ga0501044_0495597
1062 Ga0501045_0469858
1063 nmdc:mga03683_77093_c1
1064 nmdc:mga03n38_117316_c1
1065 nmdc:mga00v17_187001_c1
1066 nmdc:mga00v17_713256_c1
1067 nmdc:mga00v17_72435_c1
1068 nmdc:mga0k408_199884_c1
1069 nmdc:mga0k408_263869_c1
1070 nmdc:mga0k408_294588_c1
1071 nmdc:mga0k408_349461_c1
1072 nmdc:mga0k408_94914_c1
1073 nmdc:mga06z11_174188_c1
1074 nmdc:mga06z11_56646_c1
1075 nmdc:mga04h51_25967_c1
1076 nmdc:mga07m45_410316_c1
1077 nmdc:mga07m45_43800_c1
1078 nmdc:mga0a205_603859_c1
1079 nmdc:mga0sz30_47315_c1
1080 Ga0500643_000723
1081 Ga0500643_008293
1082 Ga0500644_0001107
1083 Ga0500566_0387973
1084 Ga0500641_0011889
1085 Ga0500555_004874
1086 Ga0500556_0005007
1087 Ga0500556_0009636
1088 Ga0500556_0069962
1089 Ga0500556_0086223
1090 Ga0500562_000681
1091 Ga0500562_090903
1092 Ga0500608_000939
1093 Ga0500559_0046691
1094 Ga0500559_0110960
1095 Ga0500559_0124663
1096 Ga0500559_0331992
1097 Ga0500568_0030281
1098 Ga0500604_0000349
1099 Ga0500616_0056403
1100 Ga0500616_0082672
1101 Ga0500622_0008596
1102 Ga0500622_0150322
1103 Ga0500624_003122
1104 Ga0500627_0207561
1105 Ga0500634_0000076
1106 Ga0500645_003194
1107 Ga0500645_011120
1108 Ga0500645_116944
1109 Ga0501084_0820264
1110 Ga0587084_060894
1111 Ga0587084_098001
1112 Ga0587066_016517
1113 Ga0587070_017442
1114 Ga0587070_032366
1115 Ga0587070_128421
1116 Ga0587077_009922
1117 Ga0587077_018511
1118 Ga0587077_050643
1119 Ga0587077_056346
1120 Ga0587077_056411
1121 Ga0587080_013869
1122 Ga0587082_019313
1123 Ga0587082_030216
1124 Ga0587085_024532
1125 Ga0587086_011556
1126 Ga0587086_019450
1127 Ga0587088_070995
1128 Ga0587091_006642
1129 Ga0587092_057966
1130 Ga0587106_009910
1131 Ga0587106_019344
1132 Ga0587101_010360
1133 Ga0587101_020262
1134 Ga0587109_015552
1135 Ga0587109_040342
1136 Ga0587127_003572
1137 Ga0587128_015576
1138 Ga0587128_105633
1139 Ga0587062_003520
1140 Ga0587062_010141
1141 Ga0587067_019647
1142 Ga0587068_012481
1143 Ga0587069_006174
1144 Ga0587072_004181
1145 Ga0587072_027718
1146 Ga0587075_016471
1147 Ga0587075_073567
1148 Ga0587075_073891
1149 Ga0587076_026837
1150 Ga0587076_038489
1151 Ga0587076_114693
1152 Ga0587078_007400
1153 Ga0587100_007304
1154 Ga0587107_007979
1155 Ga0587107_022463
1156 Ga0587124_002826
1157 Ga0587124_006690
1158 Ga0587071_038084
1159 Ga0587111_0004584
1160 Ga0587111_0005023
1161 Ga0587111_0014909
1162 Ga0587111_0045636
1163 Ga0501082_0012036
1164 Ga0466962_0100180
1165 Ga0530510_0650489
1166 2535484961
1167 2643883449
1168 2643911564
1169 2643963637
1170 2644000523
1171 2644165919
1172 2644347071
1173 2644353969
1174 2644410358
1175 2739791481
1176 2753359590
1177 2758641852
1178 2854912181
1179 2894776363
1180 2915652217
1181 2928975369
1182 2932403048
1183 2941486899
1184 2977241642
1185 8019683019
1186 8045865520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02357

NusG

Transcription termination factor nusG

27

131

0.94

PF00467

KOW

KOW motif

149

184

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kvq-assembly1.cif.gz_G solution structure of nuse:nusg-ctd complex 0.9541 123 176
8exy-assembly1.cif.gz_G m. tuberculosis rnap paused complex with b. subtilis nusg and gmpcpp 0.9191 4 108
5xfq-assembly1.cif.gz_B ternary complex of phf1, a dna duplex and a histone peptide 0.9099 123 175
2e70-assembly1.cif.gz_A solution structure of the fifth kow motif of human transcription elongation factor spt5 0.9077 125 176
5xfp-assembly3.cif.gz_E binary complex of phf1 and a double stranded dna 0.9077 123 175
ID Description Score Start End Superfamily
af_Q10BA7_272_328_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9721 122 176 2.30.30.30
2xhcA03 Mainly Beta;Roll;SH3 type barrels.; 0.9605 121 176 2.30.30.30
2kvqG00 Mainly Beta;Roll;SH3 type barrels.; 0.9541 123 176 2.30.30.30
af_P9WIU9_43_152_3.30.70.940 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;NusG, N-terminal domain 0.9518 2 107 3.30.70.940
2xhcA03 Mainly Beta;Roll;SH3 type barrels.; 0.9444 121 176 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A3R7WK22-F1-model_v4 deleted 0.9939 123 176
AF-A0A4Q6CKU3-F1-model_v4 Transcription termination/antitermination protein NusG 0.9915 120 176 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A3R7WK22-F1-model_v4 deleted 0.976 123 176
AF-A0A4Q6CKU3-F1-model_v4 Transcription termination/antitermination protein NusG 0.9745 120 176 GO:0005829
GO:0006353
GO:0031564
GO:0032784
AF-A0A432IT60-F1-model_v4 deleted 0.9688 3 73

Map