F467111
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 592 | 308 | 1184 | 225 |
Family's Representative Sequence
| Representative Sequence | 3300005366|Ga0070659_100011336|Ga0070659_1000113363 |
| Length | 265 |
| Sequence | MSLAALISEETQGSKFVVTHESRIPAFNSRMAGHPGFQQPHGWSSRPLTIRRLGRQPYEATWRAMSAFTDSRGADTPDELWLLEHDPVFTLGQAGKMEHVLAPGDIPVIPVDRGGQVTYHGPGQIVGYPLIDLRRAGVGVRELVRRIEQALIDTLAHWNVTAVRREGAPGVYVGEAKIAALGLRVRRGCSFHGLAFNVAMDLEPFQRINPCGYKGLAVTQLVDLADSPQLADVEDVLVEEFCRQFRFVAEPAAPVLPELPARVAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 25 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 85 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 86 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 92 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 156 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 157 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 158 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 159 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 160 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 166 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 172 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 173 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 174 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 175 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 176 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 177 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 178 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 179 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 180 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 181 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 182 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 185 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 186 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 187 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 188 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 191 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 192 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 196 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 197 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 235 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 236 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 237 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 240 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 241 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 272 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 273 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 274 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 276 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 277 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 278 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 281 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 282 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 283 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 284 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 285 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 286 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 287 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 288 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 289 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 290 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 291 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 292 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 293 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 294 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 295 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 296 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 297 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 298 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 299 | 2919688452 | Pararheinheimera soli 4138 | Isolate | Unclassified |
| 300 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 301 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 302 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 303 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 304 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 305 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 306 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 307 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 308 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.92 |
| Metatranscriptomes | 1.35 |
| Isolates | 4.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.57 |
| Nodule | 0 |
| Rhizoplane | 2.7 |
| Rhizosphere | 66.39 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070659_100011336 | 3300005366 | Bacteria | 6591 |
| 2 | JGI24739J22299_10000877 | 3300001989 | Bacteria | 11124 |
| 3 | JGI24739J22299_10009549 | 3300001989 | Bacteria | 3611 |
| 4 | JGI24737J22298_10009825 | 3300001990 | Bacteria | 3170 |
| 5 | JGI24737J22298_10060286 | 3300001990 | Bacteria | 1143 |
| 6 | JGI24735J21928_10000330 | 3300002067 | Bacteria | 16497 |
| 7 | JGI24735J21928_10006866 | 3300002067 | Bacteria | 3727 |
| 8 | JGI25156J39149_1002101 | 3300002705 | Bacteria | 7538 |
| 9 | JGI25156J39149_1005166 | 3300002705 | Bacteria | 3831 |
| 10 | JGI25162J39368_1001076 | 3300002737 | Bacteria | 16652 |
| 11 | JGI25162J39368_1001198 | 3300002737 | Bacteria | 15189 |
| 12 | JGI25162J39368_1001629 | 3300002737 | Bacteria | 11191 |
| 13 | JGI25162J39368_1005057 | 3300002737 | Bacteria | 2757 |
| 14 | JGI25162J39368_1005129 | 3300002737 | Bacteria | 2699 |
| 15 | JGI25157J39369_1000967 | 3300002741 | Bacteria | 13425 |
| 16 | JGI25157J39369_1001225 | 3300002741 | Bacteria | 10664 |
| 17 | JGI25157J39369_1001443 | 3300002741 | Bacteria | 8930 |
| 18 | JGI25157J39369_1001525 | 3300002741 | Bacteria | 8403 |
| 19 | JGI25163J39215_1000307 | 3300002771 | Bacteria | 16531 |
| 20 | JGI25164J39214_1000055 | 3300002772 | Bacteria | 119135 |
| 21 | JGI25164J39214_1000333 | 3300002772 | Bacteria | 30196 |
| 22 | JGI25164J39214_1002561 | 3300002772 | Bacteria | 2699 |
| 23 | JGI25152J39213_1000103 | 3300002773 | Bacteria | 59472 |
| 24 | JGI25152J39213_1022601 | 3300002773 | Bacteria | 1084 |
| 25 | JGI25150J39212_1000183 | 3300002774 | Bacteria | 35389 |
| 26 | JGI25151J46595_10000271 | 3300003187 | Bacteria | 59472 |
| 27 | JGI25165J46597_1000161 | 3300003214 | Bacteria | 107058 |
| 28 | JGI25165J46597_1000213 | 3300003214 | Bacteria | 82308 |
| 29 | JGI25165J46597_1004821 | 3300003214 | Bacteria | 2757 |
| 30 | JGI25165J46597_1004918 | 3300003214 | Bacteria | 2699 |
| 31 | JGI25153J46596_10000190 | 3300003215 | Bacteria | 59472 |
| 32 | JGI25153J46596_10013250 | 3300003215 | Bacteria | 3498 |
| 33 | rootH2_10010505 | 3300003320 | Bacteria | 6442 |
| 34 | Ga0006562J51391_1039069 | 3300003578 | Bacteria | 8681 |
| 35 | Ga0006562J51391_1039071 | 3300003578 | Bacteria | 5140 |
| 36 | Ga0006562J51391_1129535 | 3300003578 | Bacteria | 7285 |
| 37 | Ga0006562J51391_1129537 | 3300003578 | Bacteria | 5590 |
| 38 | Ga0055538_1006065 | 3300003751 | Bacteria | 1198 |
| 39 | Ga0055527_1003885 | 3300003760 | Bacteria | 2137 |
| 40 | Ga0055527_1009028 | 3300003760 | Bacteria | 1179 |
| 41 | Ga0055527_1011792 | 3300003760 | Bacteria | 995 |
| 42 | Ga0055535_1001153 | 3300003761 | Bacteria | 15611 |
| 43 | Ga0055535_1001171 | 3300003761 | Bacteria | 15320 |
| 44 | Ga0055535_1001789 | 3300003761 | Bacteria | 9444 |
| 45 | Ga0055535_1004503 | 3300003761 | Bacteria | 3365 |
| 46 | Ga0055535_1021973 | 3300003761 | Bacteria | 767 |
| 47 | Ga0055542_1001079 | 3300003762 | Bacteria | 16652 |
| 48 | Ga0055542_1001167 | 3300003762 | Bacteria | 15189 |
| 49 | Ga0055542_1001346 | 3300003762 | Bacteria | 12683 |
| 50 | Ga0055542_1001386 | 3300003762 | Bacteria | 12280 |
| 51 | Ga0055529_1000196 | 3300003763 | Bacteria | 82308 |
| 52 | Ga0055529_1000768 | 3300003763 | Bacteria | 20210 |
| 53 | Ga0055529_1005457 | 3300003763 | Bacteria | 1840 |
| 54 | Ga0065165_1002248 | 3300005262 | Bacteria | 17114 |
| 55 | Ga0070658_10007622 | 3300005327 | Bacteria | 8729 |
| 56 | Ga0070658_10061938 | 3300005327 | Bacteria | 3049 |
| 57 | Ga0070658_10249206 | 3300005327 | Bacteria | 1507 |
| 58 | Ga0070658_10316617 | 3300005327 | Bacteria | 1332 |
| 59 | Ga0070658_10404009 | 3300005327 | Bacteria | 1173 |
| 60 | Ga0068869_100027267 | 3300005334 | Bacteria | 3981 |
| 61 | Ga0070666_10000022 | 3300005335 | Bacteria | 166910 |
| 62 | Ga0070680_100035663 | 3300005336 | Bacteria | 4016 |
| 63 | Ga0070680_100353029 | 3300005336 | Bacteria | 1250 |
| 64 | Ga0070682_100000806 | 3300005337 | Bacteria | 18399 |
| 65 | Ga0070682_100002014 | 3300005337 | Bacteria | 11352 |
| 66 | Ga0070689_100003352 | 3300005340 | Bacteria | 10649 |
| 67 | Ga0070661_100004407 | 3300005344 | Bacteria | 9704 |
| 68 | Ga0070661_100015590 | 3300005344 | Bacteria | 5364 |
| 69 | Ga0070661_100029315 | 3300005344 | Bacteria | 3972 |
| 70 | Ga0070661_100116631 | 3300005344 | Bacteria | 1997 |
| 71 | Ga0070692_10080198 | 3300005345 | Bacteria | 1756 |
| 72 | Ga0070668_100004046 | 3300005347 | Bacteria | 10853 |
| 73 | Ga0070688_100035669 | 3300005365 | Bacteria | 3022 |
| 74 | Ga0070659_100018023 | 3300005366 | Bacteria | 5324 |
| 75 | Ga0070659_100299622 | 3300005366 | Bacteria | 1340 |
| 76 | Ga0070659_100350507 | 3300005366 | Bacteria | 1238 |
| 77 | Ga0070714_100000180 | 3300005435 | Bacteria | 50386 |
| 78 | Ga0070714_100002914 | 3300005435 | Bacteria | 12654 |
| 79 | Ga0070713_100003831 | 3300005436 | Bacteria | 9962 |
| 80 | Ga0070710_10140263 | 3300005437 | Bacteria | 1482 |
| 81 | Ga0070694_100060302 | 3300005444 | Bacteria | 2587 |
| 82 | Ga0070663_100036660 | 3300005455 | Bacteria | 3407 |
| 83 | Ga0070663_100128046 | 3300005455 | Bacteria | 1925 |
| 84 | Ga0070663_100292889 | 3300005455 | Bacteria | 1300 |
| 85 | Ga0070678_100013902 | 3300005456 | Bacteria | 5061 |
| 86 | Ga0070681_10053688 | 3300005458 | Bacteria | 4016 |
| 87 | Ga0070679_100026284 | 3300005530 | Bacteria | 5716 |
| 88 | Ga0070679_100054077 | 3300005530 | Bacteria | 3996 |
| 89 | Ga0070679_100168247 | 3300005530 | Unclassified | 2165 |
| 90 | Ga0070679_100193247 | 3300005530 | Bacteria | 2003 |
| 91 | Ga0070679_100390193 | 3300005530 | Bacteria | 1338 |
| 92 | Ga0068853_100000720 | 3300005539 | Bacteria | 22869 |
| 93 | Ga0068853_100099017 | 3300005539 | Bacteria | 2575 |
| 94 | Ga0070696_100001266 | 3300005546 | Bacteria | 16419 |
| 95 | Ga0070696_100067131 | 3300005546 | Bacteria | 2517 |
| 96 | Ga0070696_100135599 | 3300005546 | Bacteria | 1794 |
| 97 | Ga0070693_100003356 | 3300005547 | Bacteria | 7445 |
| 98 | Ga0070665_100010878 | 3300005548 | Bacteria | 9204 |
| 99 | Ga0068855_100036076 | 3300005563 | Bacteria | 5886 |
| 100 | Ga0068855_100192682 | 3300005563 | Bacteria | 2298 |
| 101 | Ga0068857_100005031 | 3300005577 | Bacteria | 11234 |
| 102 | Ga0068857_100135134 | 3300005577 | Bacteria | 2226 |
| 103 | Ga0068854_100542156 | 3300005578 | Bacteria | 985 |
| 104 | Ga0068856_100000086 | 3300005614 | Bacteria | 87570 |
| 105 | Ga0068856_100093388 | 3300005614 | Bacteria | 2994 |
| 106 | Ga0068852_100014146 | 3300005616 | Bacteria | 6129 |
| 107 | Ga0068852_100030349 | 3300005616 | Bacteria | 4449 |
| 108 | Ga0068859_100027472 | 3300005617 | Bacteria | 5707 |
| 109 | Ga0068864_100918760 | 3300005618 | Bacteria | 865 |
| 110 | Ga0068851_10052768 | 3300005834 | Bacteria | 2068 |
| 111 | Ga0068863_100024540 | 3300005841 | Bacteria | 5751 |
| 112 | Ga0068858_100256898 | 3300005842 | Unclassified | 1660 |
| 113 | Ga0068858_100649259 | 3300005842 | Bacteria | 1025 |
| 114 | Ga0068860_100018156 | 3300005843 | Bacteria | 6847 |
| 115 | Ga0068862_100093017 | 3300005844 | Bacteria | 2629 |
| 116 | Ga0075364_10133406 | 3300006051 | Bacteria | 1667 |
| 117 | Ga0075364_10335848 | 3300006051 | Bacteria | 1029 |
| 118 | Ga0075369_10010563 | 3300006186 | Bacteria | 3614 |
| 119 | Ga0097621_100154539 | 3300006237 | Bacteria | 1968 |
| 120 | Ga0075431_100004170 | 3300006847 | Bacteria | 14134 |
| 121 | Ga0075429_100008129 | 3300006880 | Bacteria | 9121 |
| 122 | Ga0068865_100521957 | 3300006881 | Bacteria | 993 |
| 123 | Ga0097620_100027472 | 3300006931 | Bacteria | 5707 |
| 124 | Ga0105244_10162289 | 3300009036 | Bacteria | 1067 |
| 125 | Ga0105240_10015130 | 3300009093 | Bacteria | 10501 |
| 126 | Ga0105240_10064044 | 3300009093 | Bacteria | 4570 |
| 127 | Ga0111539_10004789 | 3300009094 | Bacteria | 17656 |
| 128 | Ga0111539_10039397 | 3300009094 | Bacteria | 5696 |
| 129 | Ga0111539_10523121 | 3300009094 | Bacteria | 1382 |
| 130 | Ga0105247_10002001 | 3300009101 | Bacteria | 14120 |
| 131 | Ga0105237_10000070 | 3300009545 | Bacteria | 136694 |
| 132 | Ga0105237_10000134 | 3300009545 | Bacteria | 104004 |
| 133 | Ga0105237_10124846 | 3300009545 | Bacteria | 2568 |
| 134 | Ga0105238_10000175 | 3300009551 | Bacteria | 69973 |
| 135 | Ga0105238_10009039 | 3300009551 | Bacteria | 9969 |
| 136 | Ga0105238_10041838 | 3300009551 | Bacteria | 4641 |
| 137 | Ga0105238_10070552 | 3300009551 | Bacteria | 3492 |
| 138 | Ga0105238_10071154 | 3300009551 | Bacteria | 3475 |
| 139 | Ga0105238_10937211 | 3300009551 | Bacteria | 885 |
| 140 | Ga0105239_10001034 | 3300010375 | Bacteria | 38757 |
| 141 | Ga0105239_10197697 | 3300010375 | Bacteria | 2252 |
| 142 | Ga0157373_10009800 | 3300013100 | Bacteria | 7067 |
| 143 | Ga0157373_10032380 | 3300013100 | Bacteria | 3763 |
| 144 | Ga0157373_10193348 | 3300013100 | Bacteria | 1434 |
| 145 | Ga0157373_10207275 | 3300013100 | Bacteria | 1382 |
| 146 | Ga0157373_10245423 | 3300013100 | Bacteria | 1266 |
| 147 | Ga0157371_10000243 | 3300013102 | Bacteria | 77959 |
| 148 | Ga0157371_10002303 | 3300013102 | Bacteria | 18376 |
| 149 | Ga0157371_10010395 | 3300013102 | Bacteria | 7255 |
| 150 | Ga0157371_10388022 | 3300013102 | Bacteria | 1020 |
| 151 | Ga0157370_10001260 | 3300013104 | Bacteria | 31632 |
| 152 | Ga0157370_10010380 | 3300013104 | Bacteria | 9820 |
| 153 | Ga0157370_10014883 | 3300013104 | Bacteria | 7936 |
| 154 | Ga0157370_10044732 | 3300013104 | Bacteria | 4252 |
| 155 | Ga0157370_10063691 | 3300013104 | Bacteria | 3492 |
| 156 | Ga0157370_10131797 | 3300013104 | Bacteria | 2331 |
| 157 | Ga0157370_10132116 | 3300013104 | Bacteria | 2328 |
| 158 | Ga0157370_10225069 | 3300013104 | Bacteria | 1737 |
| 159 | Ga0157369_10009062 | 3300013105 | Bacteria | 11394 |
| 160 | Ga0157369_10011965 | 3300013105 | Bacteria | 9858 |
| 161 | Ga0157369_10147375 | 3300013105 | Bacteria | 2488 |
| 162 | Ga0157369_10167155 | 3300013105 | Bacteria | 2319 |
| 163 | Ga0157374_10054774 | 3300013296 | Bacteria | 3721 |
| 164 | Ga0157374_10532731 | 3300013296 | Bacteria | 1181 |
| 165 | Ga0157378_10152547 | 3300013297 | Bacteria | 2154 |
| 166 | Ga0157372_10007598 | 3300013307 | Bacteria | 11524 |
| 167 | Ga0157372_10016909 | 3300013307 | Bacteria | 7830 |
| 168 | Ga0157372_10028390 | 3300013307 | Bacteria | 6105 |
| 169 | Ga0157372_10444809 | 3300013307 | Bacteria | 1510 |
| 170 | Ga0157372_10450468 | 3300013307 | Bacteria | 1500 |
| 171 | Ga0157380_10096186 | 3300014326 | Bacteria | 2455 |
| 172 | Ga0182008_10008822 | 3300014497 | Bacteria | 5474 |
| 173 | Ga0182008_10016470 | 3300014497 | Bacteria | 3841 |
| 174 | Ga0182008_10056941 | 3300014497 | Bacteria | 1931 |
| 175 | Ga0182008_10074321 | 3300014497 | Bacteria | 1672 |
| 176 | Ga0182008_10224347 | 3300014497 | Bacteria | 962 |
| 177 | Ga0157376_10005164 | 3300014969 | Bacteria | 9105 |
| 178 | Ga0157376_10033922 | 3300014969 | Bacteria | 4115 |
| 179 | Ga0182006_1000426 | 3300015261 | Bacteria | 33653 |
| 180 | Ga0182006_1017509 | 3300015261 | Bacteria | 3042 |
| 181 | Ga0182007_10000079 | 3300015262 | Bacteria | 73543 |
| 182 | Ga0182007_10010422 | 3300015262 | Bacteria | 3672 |
| 183 | Ga0182007_10015088 | 3300015262 | Bacteria | 2893 |
| 184 | Ga0182007_10044035 | 3300015262 | Bacteria | 1482 |
| 185 | Ga0182005_1000166 | 3300015265 | Bacteria | 45594 |
| 186 | Ga0182005_1000177 | 3300015265 | Bacteria | 43741 |
| 187 | Ga0182005_1007680 | 3300015265 | Bacteria | 3220 |
| 188 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 189 | Ga0183368_1003 | 3300015687 | Bacteria | 1276390 |
| 190 | Ga0163161_10013517 | 3300017792 | Bacteria | 5684 |
| 191 | Ga0163161_10049215 | 3300017792 | Bacteria | 3045 |
| 192 | Ga0206356_10858187 | 3300020070 | Bacteria | 5012 |
| 193 | Ga0206349_1121353 | 3300020075 | Bacteria | 4561 |
| 194 | Ga0206354_10991871 | 3300020081 | Bacteria | 4680 |
| 195 | Ga0206353_10988314 | 3300020082 | Bacteria | 1901 |
| 196 | Ga0213872_10002643 | 3300021361 | Bacteria | 10403 |
| 197 | Ga0209435_105848 | 3300025206 | Bacteria | 1377 |
| 198 | Ga0209760_100151 | 3300025207 | Bacteria | 42314 |
| 199 | Ga0209784_100119 | 3300025224 | Bacteria | 82900 |
| 200 | Ga0209674_100033 | 3300025226 | Bacteria | 423450 |
| 201 | Ga0209674_100719 | 3300025226 | Bacteria | 11343 |
| 202 | Ga0209674_100721 | 3300025226 | Bacteria | 11322 |
| 203 | Ga0209672_100437 | 3300025228 | Bacteria | 23820 |
| 204 | Ga0209672_101014 | 3300025228 | Bacteria | 12254 |
| 205 | Ga0209672_102221 | 3300025228 | Bacteria | 5050 |
| 206 | Ga0207427_100037 | 3300025231 | Bacteria | 303108 |
| 207 | Ga0207427_100142 | 3300025231 | Bacteria | 82907 |
| 208 | Ga0207427_100344 | 3300025231 | Bacteria | 30048 |
| 209 | Ga0207427_100349 | 3300025231 | Bacteria | 29540 |
| 210 | Ga0207427_104032 | 3300025231 | Bacteria | 2675 |
| 211 | Ga0209437_100074 | 3300025233 | Bacteria | 300858 |
| 212 | Ga0209437_100083 | 3300025233 | Bacteria | 256005 |
| 213 | Ga0209437_100157 | 3300025233 | Bacteria | 151821 |
| 214 | Ga0209437_100162 | 3300025233 | Bacteria | 147864 |
| 215 | Ga0209437_100886 | 3300025233 | Bacteria | 12095 |
| 216 | Ga0209437_101643 | 3300025233 | Bacteria | 5073 |
| 217 | Ga0209258_100057 | 3300025242 | Bacteria | 334259 |
| 218 | Ga0209258_100127 | 3300025242 | Bacteria | 177606 |
| 219 | Ga0209258_100538 | 3300025242 | Bacteria | 35688 |
| 220 | Ga0209258_103198 | 3300025242 | Bacteria | 3668 |
| 221 | Ga0209646_1001148 | 3300025246 | Bacteria | 7760 |
| 222 | Ga0209026_1000200 | 3300025250 | Bacteria | 82913 |
| 223 | Ga0209026_1000237 | 3300025250 | Bacteria | 73153 |
| 224 | Ga0209026_1000378 | 3300025250 | Bacteria | 40841 |
| 225 | Ga0209026_1000603 | 3300025250 | Bacteria | 23162 |
| 226 | Ga0209026_1003698 | 3300025250 | Bacteria | 4889 |
| 227 | Ga0209148_1000005 | 3300025254 | Bacteria | 1806504 |
| 228 | Ga0209148_1000036 | 3300025254 | Bacteria | 530505 |
| 229 | Ga0209148_1000068 | 3300025254 | Bacteria | 335510 |
| 230 | Ga0209148_1000775 | 3300025254 | Bacteria | 23906 |
| 231 | Ga0209148_1002174 | 3300025254 | Bacteria | 7262 |
| 232 | Ga0209759_1000286 | 3300025256 | Bacteria | 70415 |
| 233 | Ga0209759_1001277 | 3300025256 | Bacteria | 15075 |
| 234 | Ga0209759_1001677 | 3300025256 | Bacteria | 11545 |
| 235 | Ga0209759_1012457 | 3300025256 | Bacteria | 2355 |
| 236 | Ga0209129_1000239 | 3300025258 | Bacteria | 59863 |
| 237 | Ga0209129_1001622 | 3300025258 | Bacteria | 12193 |
| 238 | Ga0209233_1000040 | 3300025261 | Bacteria | 530395 |
| 239 | Ga0209233_1000075 | 3300025261 | Bacteria | 356837 |
| 240 | Ga0209233_1000096 | 3300025261 | Bacteria | 303482 |
| 241 | Ga0209233_1000998 | 3300025261 | Bacteria | 12103 |
| 242 | Ga0209233_1008075 | 3300025261 | Bacteria | 3286 |
| 243 | Ga0209455_1000040 | 3300025272 | Bacteria | 430197 |
| 244 | Ga0209455_1000071 | 3300025272 | Bacteria | 300858 |
| 245 | Ga0209455_1000151 | 3300025272 | Bacteria | 129842 |
| 246 | Ga0209455_1005468 | 3300025272 | Bacteria | 3918 |
| 247 | Ga0209455_1010429 | 3300025272 | Bacteria | 2362 |
| 248 | Ga0209676_1000018 | 3300025292 | Bacteria | 631385 |
| 249 | Ga0209676_1001983 | 3300025292 | Bacteria | 16281 |
| 250 | Ga0209025_1000048 | 3300025294 | Bacteria | 335574 |
| 251 | Ga0209758_1000056 | 3300025297 | Bacteria | 335574 |
| 252 | Ga0209758_1000874 | 3300025297 | Bacteria | 41508 |
| 253 | Ga0209758_1009524 | 3300025297 | Bacteria | 6014 |
| 254 | Ga0209050_1000592 | 3300025298 | Bacteria | 57827 |
| 255 | Ga0209051_1003638 | 3300025303 | Bacteria | 9986 |
| 256 | Ga0209257_1000035 | 3300025304 | Bacteria | 631463 |
| 257 | Ga0209257_1001448 | 3300025304 | Bacteria | 28059 |
| 258 | Ga0207656_10032870 | 3300025321 | Bacteria | 2157 |
| 259 | Ga0207655_1030214 | 3300025728 | Bacteria | 2523 |
| 260 | Ga0207655_1132452 | 3300025728 | Bacteria | 811 |
| 261 | Ga0207710_10010072 | 3300025900 | Bacteria | 3977 |
| 262 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 263 | Ga0207647_10000188 | 3300025904 | Bacteria | 50006 |
| 264 | Ga0207647_10000865 | 3300025904 | Bacteria | 23447 |
| 265 | Ga0207647_10006553 | 3300025904 | Bacteria | 8459 |
| 266 | Ga0207647_10047442 | 3300025904 | Bacteria | 2672 |
| 267 | Ga0207705_10001049 | 3300025909 | Bacteria | 22456 |
| 268 | Ga0207705_10027986 | 3300025909 | Bacteria | 4018 |
| 269 | Ga0207705_10096042 | 3300025909 | Bacteria | 2176 |
| 270 | Ga0207705_10259840 | 3300025909 | Bacteria | 1326 |
| 271 | Ga0207695_10000997 | 3300025913 | Bacteria | 50121 |
| 272 | Ga0207695_10005208 | 3300025913 | Bacteria | 17393 |
| 273 | Ga0207695_10011198 | 3300025913 | Bacteria | 10881 |
| 274 | Ga0207695_10025714 | 3300025913 | Bacteria | 6585 |
| 275 | Ga0207671_10000037 | 3300025914 | Bacteria | 230395 |
| 276 | Ga0207671_10001266 | 3300025914 | Bacteria | 29783 |
| 277 | Ga0207660_10188374 | 3300025917 | Bacteria | 1605 |
| 278 | Ga0207660_10307163 | 3300025917 | Bacteria | 1264 |
| 279 | Ga0207657_10057772 | 3300025919 | Bacteria | 3342 |
| 280 | Ga0207657_10101310 | 3300025919 | Bacteria | 2390 |
| 281 | Ga0207657_10101900 | 3300025919 | Bacteria | 2382 |
| 282 | Ga0207657_10275283 | 3300025919 | Bacteria | 1337 |
| 283 | Ga0207649_10012167 | 3300025920 | Bacteria | 4764 |
| 284 | Ga0207649_10047167 | 3300025920 | Bacteria | 2650 |
| 285 | Ga0207652_10016667 | 3300025921 | Bacteria | 6004 |
| 286 | Ga0207694_10000257 | 3300025924 | Bacteria | 50545 |
| 287 | Ga0207694_10056309 | 3300025924 | Bacteria | 3053 |
| 288 | Ga0207694_10307918 | 3300025924 | Bacteria | 1305 |
| 289 | Ga0207700_10058673 | 3300025928 | Bacteria | 2908 |
| 290 | Ga0207664_10000041 | 3300025929 | Bacteria | 154806 |
| 291 | Ga0207664_10001637 | 3300025929 | Bacteria | 14760 |
| 292 | Ga0207664_10028700 | 3300025929 | Bacteria | 4231 |
| 293 | Ga0207664_10249820 | 3300025929 | Bacteria | 1548 |
| 294 | Ga0207690_10000285 | 3300025932 | Bacteria | 35963 |
| 295 | Ga0207690_10019109 | 3300025932 | Bacteria | 4211 |
| 296 | Ga0207690_10024127 | 3300025932 | Bacteria | 3805 |
| 297 | Ga0207690_10029598 | 3300025932 | Bacteria | 3484 |
| 298 | Ga0207690_10138366 | 3300025932 | Bacteria | 1791 |
| 299 | Ga0207706_10368470 | 3300025933 | Bacteria | 1248 |
| 300 | Ga0207670_10022479 | 3300025936 | Bacteria | 3910 |
| 301 | Ga0207704_10332922 | 3300025938 | Bacteria | 1176 |
| 302 | Ga0207711_10118412 | 3300025941 | Bacteria | 2363 |
| 303 | Ga0207689_10017785 | 3300025942 | Bacteria | 6007 |
| 304 | Ga0207667_10000184 | 3300025949 | Bacteria | 90846 |
| 305 | Ga0207667_10012090 | 3300025949 | Bacteria | 9979 |
| 306 | Ga0207667_10013456 | 3300025949 | Bacteria | 9363 |
| 307 | Ga0207667_10091604 | 3300025949 | Bacteria | 3140 |
| 308 | Ga0207668_10019101 | 3300025972 | Bacteria | 4326 |
| 309 | Ga0207668_10056198 | 3300025972 | Bacteria | 2740 |
| 310 | Ga0207668_10080851 | 3300025972 | Bacteria | 2355 |
| 311 | Ga0207640_10010677 | 3300025981 | Bacteria | 5180 |
| 312 | Ga0207639_10003146 | 3300026041 | Bacteria | 11096 |
| 313 | Ga0207639_10050886 | 3300026041 | Bacteria | 3148 |
| 314 | Ga0207639_10165576 | 3300026041 | Bacteria | 1867 |
| 315 | Ga0207639_10313944 | 3300026041 | Bacteria | 1389 |
| 316 | Ga0207678_10014149 | 3300026067 | Bacteria | 7014 |
| 317 | Ga0207678_10057051 | 3300026067 | Bacteria | 3361 |
| 318 | Ga0207678_10154420 | 3300026067 | Bacteria | 1960 |
| 319 | Ga0207678_10204508 | 3300026067 | Bacteria | 1689 |
| 320 | Ga0207702_10000222 | 3300026078 | Bacteria | 66254 |
| 321 | Ga0207702_10457402 | 3300026078 | Bacteria | 1239 |
| 322 | Ga0207641_10045468 | 3300026088 | Bacteria | 3697 |
| 323 | Ga0207648_10054097 | 3300026089 | Bacteria | 3507 |
| 324 | Ga0207674_10008040 | 3300026116 | Bacteria | 12228 |
| 325 | Ga0207674_10081355 | 3300026116 | Bacteria | 3241 |
| 326 | Ga0207674_10299985 | 3300026116 | Bacteria | 1556 |
| 327 | Ga0207683_10026617 | 3300026121 | Bacteria | 4994 |
| 328 | Ga0210000_1032506 | 3300027462 | Bacteria | 818 |
| 329 | Ga0209999_1013189 | 3300027543 | Bacteria | 1500 |
| 330 | Ga0209983_1001045 | 3300027665 | Bacteria | 6100 |
| 331 | Ga0209974_10004142 | 3300027876 | Bacteria | 5181 |
| 332 | Ga0207428_10076073 | 3300027907 | Bacteria | 2629 |
| 333 | Ga0268266_10000091 | 3300028379 | Bacteria | 195002 |
| 334 | Ga0268265_10055187 | 3300028380 | Bacteria | 3018 |
| 335 | Ga0268264_10153509 | 3300028381 | Bacteria | 2067 |
| 336 | Ga0265334_10000008 | 3300028573 | Bacteria | 200602 |
| 337 | Ga0265338_10510223 | 3300028800 | Bacteria | 846 |
| 338 | Ga0265313_10000076 | 3300031595 | Bacteria | 96542 |
| 339 | Ga0307508_10027818 | 3300031616 | Bacteria | 5116 |
| 340 | Ga0316579_10002909 | 3300031691 | Bacteria | 6571 |
| 341 | Ga0316576_10026686 | 3300031727 | Bacteria | 4055 |
| 342 | Ga0316578_10002032 | 3300031728 | Bacteria | 8624 |
| 343 | Ga0307516_10054539 | 3300031730 | Bacteria | 3905 |
| 344 | Ga0316577_10002503 | 3300031733 | Bacteria | 9118 |
| 345 | Ga0307412_10002394 | 3300031911 | Bacteria | 10417 |
| 346 | Ga0307412_10054365 | 3300031911 | Bacteria | 2657 |
| 347 | Ga0307412_10464174 | 3300031911 | Bacteria | 1046 |
| 348 | Ga0307416_100024526 | 3300032002 | Bacteria | 4405 |
| 349 | Ga0307414_10157937 | 3300032004 | Bacteria | 1797 |
| 350 | Ga0307414_10164938 | 3300032004 | Bacteria | 1764 |
| 351 | Ga0307414_10240271 | 3300032004 | Bacteria | 1499 |
| 352 | Ga0307411_10410272 | 3300032005 | Bacteria | 1122 |
| 353 | Ga0316583_10122034 | 3300032133 | Bacteria | 908 |
| 354 | Ga0316585_10002574 | 3300032137 | Bacteria | 4908 |
| 355 | Ga0395899_0050873 | 3300037312 | Bacteria | 3075 |
| 356 | Ga0395899_0086216 | 3300037312 | Bacteria | 2281 |
| 357 | Ga0395899_0135215 | 3300037312 | Bacteria | 1757 |
| 358 | Ga0395900_0000446 | 3300037418 | Bacteria | 59137 |
| 359 | Ga0395900_0001441 | 3300037418 | Bacteria | 28406 |
| 360 | Ga0395900_0079860 | 3300037418 | Bacteria | 3361 |
| 361 | Ga0395900_0347995 | 3300037418 | Bacteria | 1456 |
| 362 | Ga0395898_0000362 | 3300037466 | Bacteria | 99858 |
| 363 | Ga0395898_0005272 | 3300037466 | Bacteria | 13973 |
| 364 | Ga0395898_0013116 | 3300037466 | Bacteria | 8545 |
| 365 | Ga0395898_0024694 | 3300037466 | Bacteria | 6061 |
| 366 | Ga0395901_0001926 | 3300038443 | Bacteria | 21373 |
| 367 | Ga0395901_0001974 | 3300038443 | Bacteria | 21107 |
| 368 | Ga0395901_0086506 | 3300038443 | Bacteria | 3277 |
| 369 | Ga0395901_0366403 | 3300038443 | Bacteria | 1485 |
| 370 | Ga0400487_22015 | 3300039110 | Bacteria | 27561 |
| 371 | Ga0436361_0547085 | 3300039447 | Bacteria | 16773 |
| 372 | Ga0439436_0000009 | 3300041404 | Bacteria | 108375 |
| 373 | Ga0439465_0001199 | 3300041413 | Bacteria | 8345 |
| 374 | Ga0451787_336456 | 3300041441 | Bacteria | 1571 |
| 375 | Ga0451793_0608163 | 3300041452 | Bacteria | 730 |
| 376 | Ga0451793_0975326 | 3300041452 | Bacteria | 10175 |
| 377 | Ga0451837_1331880 | 3300041494 | Bacteria | 1837 |
| 378 | Ga0451841_1409615 | 3300041498 | Bacteria | 1002 |
| 379 | Ga0439448_0025379 | 3300042005 | Bacteria | 1859 |
| 380 | Ga0439448_0080885 | 3300042005 | Bacteria | 1091 |
| 381 | Ga0439449_0005572 | 3300042007 | Bacteria | 4820 |
| 382 | Ga0439463_026647 | 3300042016 | Bacteria | 1452 |
| 383 | Ga0439459_0000115 | 3300042438 | Bacteria | 7629 |
| 384 | Ga0451577_0016708 | 3300042876 | Bacteria | 6787 |
| 385 | Ga0451577_0045810 | 3300042876 | Bacteria | 3914 |
| 386 | Ga0466969_0167392 | 3300044656 | Bacteria | 1008 |
| 387 | Ga0466972_0050630 | 3300044658 | Bacteria | 2004 |
| 388 | Ga0466965_0008160 | 3300044683 | Bacteria | 4836 |
| 389 | Ga0466966_0001209 | 3300044684 | Bacteria | 16563 |
| 390 | Ga0466961_0005390 | 3300044693 | Bacteria | 8052 |
| 391 | Ga0466961_0082381 | 3300044693 | Bacteria | 2035 |
| 392 | Ga0466964_0006378 | 3300044706 | Bacteria | 4396 |
| 393 | Ga0466971_0019652 | 3300044719 | Bacteria | 3001 |
| 394 | Ga0466971_0023982 | 3300044719 | Bacteria | 2720 |
| 395 | Ga0466968_0004187 | 3300044735 | Bacteria | 5376 |
| 396 | Ga0466970_0012604 | 3300044765 | Bacteria | 4325 |
| 397 | Ga0466957_0096346 | 3300044842 | Bacteria | 1859 |
| 398 | Ga0466957_0242886 | 3300044842 | Bacteria | 1195 |
| 399 | Ga0466959_0003364 | 3300045049 | Bacteria | 10451 |
| 400 | Ga0466958_0006702 | 3300045836 | Bacteria | 6284 |
| 401 | Ga0466967_0103052 | 3300045976 | Bacteria | 2611 |
| 402 | Ga0466967_0526662 | 3300045976 | Bacteria | 1162 |
| 403 | Ga0495617_000523 | 3300046452 | Bacteria | 19954 |
| 404 | Ga0495638_0000180 | 3300046460 | Bacteria | 96716 |
| 405 | Ga0495638_0001693 | 3300046460 | Bacteria | 19448 |
| 406 | Ga0495638_0014890 | 3300046460 | Bacteria | 5240 |
| 407 | Ga0495650_0000469 | 3300046471 | Bacteria | 62135 |
| 408 | Ga0495650_0002069 | 3300046471 | Bacteria | 17390 |
| 409 | Ga0495650_0007187 | 3300046471 | Bacteria | 6748 |
| 410 | Ga0495585_0000437 | 3300046492 | Bacteria | 39894 |
| 411 | Ga0495607_0000654 | 3300046501 | Bacteria | 33669 |
| 412 | Ga0495607_0027278 | 3300046501 | Bacteria | 3533 |
| 413 | Ga0495606_0002503 | 3300046507 | Bacteria | 21222 |
| 414 | Ga0495606_0014630 | 3300046507 | Bacteria | 6105 |
| 415 | Ga0495610_0002419 | 3300046512 | Bacteria | 15714 |
| 416 | Ga0495610_0028688 | 3300046512 | Bacteria | 2939 |
| 417 | Ga0495616_0000190 | 3300046513 | Bacteria | 51392 |
| 418 | Ga0495620_0039922 | 3300046515 | Bacteria | 2070 |
| 419 | Ga0495631_0196002 | 3300046518 | Bacteria | 864 |
| 420 | Ga0495632_0000135 | 3300046519 | Bacteria | 75082 |
| 421 | Ga0495632_0048840 | 3300046519 | Bacteria | 2093 |
| 422 | Ga0495643_0083501 | 3300046522 | Bacteria | 1658 |
| 423 | Ga0495648_0001900 | 3300046524 | Bacteria | 19949 |
| 424 | Ga0495648_0058575 | 3300046524 | Bacteria | 2302 |
| 425 | Ga0495663_0057458 | 3300046525 | Bacteria | 1217 |
| 426 | Ga0495609_0048118 | 3300046538 | Bacteria | 1907 |
| 427 | Ga0495597_0076485 | 3300046542 | Bacteria | 1436 |
| 428 | Ga0495622_0004707 | 3300046557 | Bacteria | 6326 |
| 429 | Ga0495633_0013300 | 3300046558 | Bacteria | 4341 |
| 430 | Ga0495668_0002918 | 3300046616 | Bacteria | 13486 |
| 431 | Ga0495611_0000004 | 3300046648 | Bacteria | 308149 |
| 432 | Ga0495611_0001192 | 3300046648 | Bacteria | 13465 |
| 433 | Ga0495625_0000617 | 3300046660 | Bacteria | 51659 |
| 434 | Ga0495625_0007542 | 3300046660 | Bacteria | 9451 |
| 435 | Ga0495625_0088749 | 3300046660 | Bacteria | 2141 |
| 436 | Ga0495661_0001320 | 3300046665 | Bacteria | 21068 |
| 437 | Ga0495671_0052533 | 3300046692 | Bacteria | 2025 |
| 438 | Ga0495649_0050860 | 3300046694 | Bacteria | 2247 |
| 439 | Ga0495589_0000555 | 3300046794 | Bacteria | 25768 |
| 440 | Ga0495660_0000356 | 3300046810 | Bacteria | 40494 |
| 441 | Ga0495660_0002959 | 3300046810 | Bacteria | 10627 |
| 442 | Ga0495683_0001003 | 3300047323 | Bacteria | 19727 |
| 443 | Ga0495679_000011 | 3300047446 | Bacteria | 324498 |
| 444 | Ga0495673_0000036 | 3300047469 | Bacteria | 311035 |
| 445 | Ga0495673_0000151 | 3300047469 | Bacteria | 122181 |
| 446 | Ga0495686_0000126 | 3300047472 | Bacteria | 157350 |
| 447 | Ga0496100_0161391 | 3300048903 | Bacteria | 1607 |
| 448 | Ga0496101_0388529 | 3300048904 | Bacteria | 1098 |
| 449 | Ga0496104_0022837 | 3300048907 | Bacteria | 5748 |
| 450 | Ga0496104_0692958 | 3300048907 | Bacteria | 927 |
| 451 | Ga0496104_0963788 | 3300048907 | Bacteria | 757 |
| 452 | Ga0496105_0002564 | 3300048908 | Bacteria | 13194 |
| 453 | Ga0496105_0474272 | 3300048908 | Bacteria | 985 |
| 454 | Ga0496106_0010847 | 3300048909 | Bacteria | 6732 |
| 455 | Ga0496106_0049427 | 3300048909 | Bacteria | 3168 |
| 456 | Ga0496106_0192611 | 3300048909 | Bacteria | 1621 |
| 457 | Ga0496107_0017259 | 3300048910 | Bacteria | 5076 |
| 458 | Ga0496115_0000008 | 3300048918 | Bacteria | 237485 |
| 459 | Ga0496115_0010402 | 3300048918 | Bacteria | 6949 |
| 460 | Ga0496116_0003670 | 3300048919 | Bacteria | 15053 |
| 461 | Ga0496118_0004467 | 3300048921 | Bacteria | 16586 |
| 462 | Ga0496118_0006061 | 3300048921 | Bacteria | 13467 |
| 463 | Ga0496118_0025116 | 3300048921 | Bacteria | 5120 |
| 464 | Ga0496118_0030781 | 3300048921 | Bacteria | 4467 |
| 465 | Ga0496118_0370434 | 3300048921 | Bacteria | 756 |
| 466 | Ga0496119_0000218 | 3300048922 | Bacteria | 81458 |
| 467 | Ga0496119_0011983 | 3300048922 | Bacteria | 7100 |
| 468 | Ga0496119_0015104 | 3300048922 | Bacteria | 5976 |
| 469 | Ga0496120_0001849 | 3300048923 | Bacteria | 23568 |
| 470 | Ga0496120_0002027 | 3300048923 | Bacteria | 22032 |
| 471 | Ga0496121_0001803 | 3300048924 | Bacteria | 34595 |
| 472 | Ga0496121_0003410 | 3300048924 | Bacteria | 22722 |
| 473 | Ga0496121_0003449 | 3300048924 | Bacteria | 22580 |
| 474 | Ga0496121_0017512 | 3300048924 | Bacteria | 7311 |
| 475 | Ga0496121_0022889 | 3300048924 | Bacteria | 6039 |
| 476 | Ga0496121_0048827 | 3300048924 | Bacteria | 3596 |
| 477 | Ga0496121_0264157 | 3300048924 | Bacteria | 1186 |
| 478 | Ga0496122_0017062 | 3300048925 | Bacteria | 6815 |
| 479 | Ga0496122_0019895 | 3300048925 | Bacteria | 6103 |
| 480 | Ga0496122_0079922 | 3300048925 | Bacteria | 2283 |
| 481 | Ga0496123_0001416 | 3300048926 | Bacteria | 33518 |
| 482 | Ga0496123_0058936 | 3300048926 | Bacteria | 2486 |
| 483 | Ga0496124_0001552 | 3300048927 | Bacteria | 33193 |
| 484 | Ga0496125_0004471 | 3300048928 | Bacteria | 16112 |
| 485 | Ga0496125_0019364 | 3300048928 | Bacteria | 6422 |
| 486 | Ga0496125_0030941 | 3300048928 | Bacteria | 4778 |
| 487 | Ga0496126_0003595 | 3300048929 | Bacteria | 19418 |
| 488 | Ga0496126_0027285 | 3300048929 | Bacteria | 5457 |
| 489 | Ga0496126_0096466 | 3300048929 | Bacteria | 2592 |
| 490 | Ga0496126_0174466 | 3300048929 | Bacteria | 1829 |
| 491 | Ga0496126_0280884 | 3300048929 | Bacteria | 1379 |
| 492 | Ga0495678_000067 | 3300049459 | Bacteria | 132540 |
| 493 | Ga0495682_0006722 | 3300049460 | Bacteria | 4641 |
| 494 | Ga0495682_0018969 | 3300049460 | Bacteria | 2589 |
| 495 | Ga0501032_0018354 | 3300049569 | Bacteria | 4902 |
| 496 | Ga0501032_0130089 | 3300049569 | Bacteria | 1661 |
| 497 | Ga0501033_0068344 | 3300049570 | Bacteria | 2612 |
| 498 | Ga0501033_0209086 | 3300049570 | Bacteria | 1392 |
| 499 | Ga0501034_0054713 | 3300049571 | Bacteria | 4017 |
| 500 | Ga0501034_0060864 | 3300049571 | Bacteria | 3793 |
| 501 | Ga0501034_0312304 | 3300049571 | Bacteria | 1506 |
| 502 | Ga0501034_0447458 | 3300049571 | Bacteria | 1210 |
| 503 | Ga0501034_0482129 | 3300049571 | Bacteria | 1155 |
| 504 | Ga0501037_0247010 | 3300049573 | Bacteria | 1249 |
| 505 | Ga0501037_0297889 | 3300049573 | Bacteria | 1120 |
| 506 | Ga0501038_0041530 | 3300049574 | Bacteria | 4011 |
| 507 | Ga0501038_0278809 | 3300049574 | Bacteria | 1316 |
| 508 | Ga0501038_0279456 | 3300049574 | Bacteria | 1315 |
| 509 | Ga0501039_0118596 | 3300049575 | Bacteria | 2073 |
| 510 | Ga0501039_0229796 | 3300049575 | Bacteria | 1458 |
| 511 | Ga0501042_0352399 | 3300049578 | Bacteria | 1065 |
| 512 | Ga0501043_0026156 | 3300049579 | Bacteria | 4578 |
| 513 | Ga0501043_0034199 | 3300049579 | Bacteria | 3998 |
| 514 | Ga0501043_0134891 | 3300049579 | Bacteria | 1934 |
| 515 | Ga0501043_0138220 | 3300049579 | Bacteria | 1908 |
| 516 | Ga0501046_0042107 | 3300049580 | Bacteria | 3641 |
| 517 | Ga0501046_0164767 | 3300049580 | Bacteria | 1665 |
| 518 | Ga0501046_0372913 | 3300049580 | Bacteria | 1034 |
| 519 | Ga0501047_0014077 | 3300049581 | Bacteria | 7601 |
| 520 | Ga0501047_0223030 | 3300049581 | Bacteria | 1741 |
| 521 | Ga0501047_0317443 | 3300049581 | Bacteria | 1398 |
| 522 | Ga0501048_0357050 | 3300049582 | Bacteria | 1042 |
| 523 | Ga0501068_0140443 | 3300049584 | Bacteria | 1514 |
| 524 | Ga0501070_0346120 | 3300049586 | Bacteria | 1207 |
| 525 | Ga0501070_0407885 | 3300049586 | Bacteria | 1098 |
| 526 | Ga0501070_0526019 | 3300049586 | Bacteria | 948 |
| 527 | Ga0501079_0112231 | 3300049741 | Bacteria | 2119 |
| 528 | Ga0501080_0039836 | 3300049742 | Bacteria | 4384 |
| 529 | Ga0501080_0455038 | 3300049742 | Bacteria | 1147 |
| 530 | Ga0501083_0011507 | 3300049744 | Bacteria | 6208 |
| 531 | Ga0501035_0024127 | 3300049822 | Bacteria | 5579 |
| 532 | Ga0501035_0041977 | 3300049822 | Bacteria | 4127 |
| 533 | Ga0501035_0138592 | 3300049822 | Bacteria | 2116 |
| 534 | Ga0501035_0144016 | 3300049822 | Bacteria | 2071 |
| 535 | Ga0501035_0335666 | 3300049822 | Bacteria | 1267 |
| 536 | Ga0501035_0499321 | 3300049822 | Bacteria | 1001 |
| 537 | Ga0501035_0645989 | 3300049822 | Bacteria | 858 |
| 538 | Ga0501044_0052943 | 3300049823 | Bacteria | 4178 |
| 539 | Ga0501044_0297497 | 3300049823 | Bacteria | 1543 |
| 540 | Ga0501044_0403339 | 3300049823 | Bacteria | 1279 |
| 541 | nmdc:mga00v17_153376_c1 | 3300050491 | Bacteria | 1481 |
| 542 | nmdc:mga00v17_279684_c1 | 3300050491 | Bacteria | 1083 |
| 543 | nmdc:mga00v17_321449_c1 | 3300050491 | Unclassified | 1005 |
| 544 | nmdc:mga00v17_77606_c1 | 3300050491 | Bacteria | 2068 |
| 545 | nmdc:mga0yw44_167476_c1 | 3300050492 | Bacteria | 1441 |
| 546 | nmdc:mga05p37_5968_c1 | 3300050507 | Bacteria | 6163 |
| 547 | nmdc:mga09592_5296_c1 | 3300050508 | Bacteria | 10483 |
| 548 | nmdc:mga06r32_2458_c1 | 3300050510 | Bacteria | 16578 |
| 549 | nmdc:mga08y16_1907_c1 | 3300050511 | Bacteria | 21252 |
| 550 | nmdc:mga08y16_2683_c1 | 3300050511 | Bacteria | 18277 |
| 551 | nmdc:mga0sz30_24728_c1 | 3300050516 | Bacteria | 2452 |
| 552 | nmdc:mga0sz30_306048_c1 | 3300050516 | Bacteria | 709 |
| 553 | Ga0500643_000012 | 3300053087 | Bacteria | 369839 |
| 554 | Ga0500646_0089636 | 3300053090 | Bacteria | 950 |
| 555 | Ga0500651_0003309 | 3300053093 | Bacteria | 8779 |
| 556 | Ga0500555_002193 | 3300053103 | Bacteria | 5709 |
| 557 | Ga0500559_0276158 | 3300053136 | Bacteria | 790 |
| 558 | Ga0500636_0000164 | 3300053177 | Bacteria | 34785 |
| 559 | Ga0500637_0187715 | 3300053178 | Bacteria | 1182 |
| 560 | Ga0500625_016497 | 3300053729 | Bacteria | 3441 |
| 561 | Ga0501082_0040078 | 3300060353 | Bacteria | 4041 |
| 562 | Ga0501082_0165667 | 3300060353 | Bacteria | 1921 |
| 563 | Ga0466962_0000988 | 3300061719 | Bacteria | 12968 |
| 564 | Ga0466962_0001385 | 3300061719 | Bacteria | 11253 |
| 565 | 2595447752 | 2593339238 | Bacteria | 4182970 |
| 566 | 2595451044 | 2593339239 | Bacteria | 4124669 |
| 567 | 2643897017 | 2643221577 | Bacteria | 3710843 |
| 568 | 2687581722 | 2687453130 | Bacteria | 4227172 |
| 569 | 2721029007 | 2718218334 | Bacteria | 4765486 |
| 570 | 2739227389 | 2738543009 | Bacteria | 4944499 |
| 571 | 2739733999 | 2739367700 | Bacteria | 4747630 |
| 572 | 2819565843 | 2818991440 | Bacteria | 4774720 |
| 573 | 2842921934 | 2842918807 | Bacteria | 4289178 |
| 574 | 2852652119 | 2852649853 | Bacteria | 4036942 |
| 575 | 2874223202 | 2874220319 | Bacteria | 4594709 |
| 576 | 2884415401 | 2884411467 | Bacteria | 5246714 |
| 577 | 2895395809 | 2895395659 | Bacteria | 3983269 |
| 578 | 2904467307 | 2904463128 | Bacteria | 4775606 |
| 579 | 2919093237 | 2919089067 | Bacteria | 4560942 |
| 580 | 2919407925 | 2919404418 | Bacteria | 4232372 |
| 581 | 2919517141 | 2919513703 | Bacteria | 3844312 |
| 582 | 2919677596 | 2919675420 | Bacteria | 3969095 |
| 583 | 2919691953 | 2919688452 | Bacteria | 4595932 |
| 584 | 2928499868 | 2928496128 | Bacteria | 4631123 |
| 585 | 2928966154 | 2928963466 | Bacteria | 5165703 |
| 586 | 2931383361 | 2931380184 | Bacteria | 4455911 |
| 587 | 2937614334 | 2937610967 | Bacteria | 4618818 |
| 588 | 2939614071 | 2939611941 | Bacteria | 3892017 |
| 589 | 2939630924 | 2939626828 | Bacteria | 4695272 |
| 590 | 2941478742 | 2941475908 | Bacteria | 4145589 |
| 591 | 2953997026 | 2953994433 | Bacteria | 4303959 |
| 592 | 2961049966 | 2961047084 | Bacteria | 4594415 |
| 593 | Ga0070659_100011336 | |||
| 594 | JGI24739J22299_10000877 | |||
| 595 | JGI24739J22299_10009549 | |||
| 596 | JGI24737J22298_10009825 | |||
| 597 | JGI24737J22298_10060286 | |||
| 598 | JGI24735J21928_10000330 | |||
| 599 | JGI24735J21928_10006866 | |||
| 600 | JGI25156J39149_1002101 | |||
| 601 | JGI25156J39149_1005166 | |||
| 602 | JGI25162J39368_1001076 | |||
| 603 | JGI25162J39368_1001198 | |||
| 604 | JGI25162J39368_1001629 | |||
| 605 | JGI25162J39368_1005057 | |||
| 606 | JGI25162J39368_1005129 | |||
| 607 | JGI25157J39369_1000967 | |||
| 608 | JGI25157J39369_1001225 | |||
| 609 | JGI25157J39369_1001443 | |||
| 610 | JGI25157J39369_1001525 | |||
| 611 | JGI25163J39215_1000307 | |||
| 612 | JGI25164J39214_1000055 | |||
| 613 | JGI25164J39214_1000333 | |||
| 614 | JGI25164J39214_1002561 | |||
| 615 | JGI25152J39213_1000103 | |||
| 616 | JGI25152J39213_1022601 | |||
| 617 | JGI25150J39212_1000183 | |||
| 618 | JGI25151J46595_10000271 | |||
| 619 | JGI25165J46597_1000161 | |||
| 620 | JGI25165J46597_1000213 | |||
| 621 | JGI25165J46597_1004821 | |||
| 622 | JGI25165J46597_1004918 | |||
| 623 | JGI25153J46596_10000190 | |||
| 624 | JGI25153J46596_10013250 | |||
| 625 | rootH2_10010505 | |||
| 626 | Ga0006562J51391_1039069 | |||
| 627 | Ga0006562J51391_1039071 | |||
| 628 | Ga0006562J51391_1129535 | |||
| 629 | Ga0006562J51391_1129537 | |||
| 630 | Ga0055538_1006065 | |||
| 631 | Ga0055527_1003885 | |||
| 632 | Ga0055527_1009028 | |||
| 633 | Ga0055527_1011792 | |||
| 634 | Ga0055535_1001153 | |||
| 635 | Ga0055535_1001171 | |||
| 636 | Ga0055535_1001789 | |||
| 637 | Ga0055535_1004503 | |||
| 638 | Ga0055535_1021973 | |||
| 639 | Ga0055542_1001079 | |||
| 640 | Ga0055542_1001167 | |||
| 641 | Ga0055542_1001346 | |||
| 642 | Ga0055542_1001386 | |||
| 643 | Ga0055529_1000196 | |||
| 644 | Ga0055529_1000768 | |||
| 645 | Ga0055529_1005457 | |||
| 646 | Ga0065165_1002248 | |||
| 647 | Ga0070658_10007622 | |||
| 648 | Ga0070658_10061938 | |||
| 649 | Ga0070658_10249206 | |||
| 650 | Ga0070658_10316617 | |||
| 651 | Ga0070658_10404009 | |||
| 652 | Ga0068869_100027267 | |||
| 653 | Ga0070666_10000022 | |||
| 654 | Ga0070680_100035663 | |||
| 655 | Ga0070680_100353029 | |||
| 656 | Ga0070682_100000806 | |||
| 657 | Ga0070682_100002014 | |||
| 658 | Ga0070689_100003352 | |||
| 659 | Ga0070661_100004407 | |||
| 660 | Ga0070661_100015590 | |||
| 661 | Ga0070661_100029315 | |||
| 662 | Ga0070661_100116631 | |||
| 663 | Ga0070692_10080198 | |||
| 664 | Ga0070668_100004046 | |||
| 665 | Ga0070688_100035669 | |||
| 666 | Ga0070659_100018023 | |||
| 667 | Ga0070659_100299622 | |||
| 668 | Ga0070659_100350507 | |||
| 669 | Ga0070714_100000180 | |||
| 670 | Ga0070714_100002914 | |||
| 671 | Ga0070713_100003831 | |||
| 672 | Ga0070710_10140263 | |||
| 673 | Ga0070694_100060302 | |||
| 674 | Ga0070663_100036660 | |||
| 675 | Ga0070663_100128046 | |||
| 676 | Ga0070663_100292889 | |||
| 677 | Ga0070678_100013902 | |||
| 678 | Ga0070681_10053688 | |||
| 679 | Ga0070679_100026284 | |||
| 680 | Ga0070679_100054077 | |||
| 681 | Ga0070679_100168247 | |||
| 682 | Ga0070679_100193247 | |||
| 683 | Ga0070679_100390193 | |||
| 684 | Ga0068853_100000720 | |||
| 685 | Ga0068853_100099017 | |||
| 686 | Ga0070696_100001266 | |||
| 687 | Ga0070696_100067131 | |||
| 688 | Ga0070696_100135599 | |||
| 689 | Ga0070693_100003356 | |||
| 690 | Ga0070665_100010878 | |||
| 691 | Ga0068855_100036076 | |||
| 692 | Ga0068855_100192682 | |||
| 693 | Ga0068857_100005031 | |||
| 694 | Ga0068857_100135134 | |||
| 695 | Ga0068854_100542156 | |||
| 696 | Ga0068856_100000086 | |||
| 697 | Ga0068856_100093388 | |||
| 698 | Ga0068852_100014146 | |||
| 699 | Ga0068852_100030349 | |||
| 700 | Ga0068859_100027472 | |||
| 701 | Ga0068864_100918760 | |||
| 702 | Ga0068851_10052768 | |||
| 703 | Ga0068863_100024540 | |||
| 704 | Ga0068858_100256898 | |||
| 705 | Ga0068858_100649259 | |||
| 706 | Ga0068860_100018156 | |||
| 707 | Ga0068862_100093017 | |||
| 708 | Ga0075364_10133406 | |||
| 709 | Ga0075364_10335848 | |||
| 710 | Ga0075369_10010563 | |||
| 711 | Ga0097621_100154539 | |||
| 712 | Ga0075431_100004170 | |||
| 713 | Ga0075429_100008129 | |||
| 714 | Ga0068865_100521957 | |||
| 715 | Ga0097620_100027472 | |||
| 716 | Ga0105244_10162289 | |||
| 717 | Ga0105240_10015130 | |||
| 718 | Ga0105240_10064044 | |||
| 719 | Ga0111539_10004789 | |||
| 720 | Ga0111539_10039397 | |||
| 721 | Ga0111539_10523121 | |||
| 722 | Ga0105247_10002001 | |||
| 723 | Ga0105237_10000070 | |||
| 724 | Ga0105237_10000134 | |||
| 725 | Ga0105237_10124846 | |||
| 726 | Ga0105238_10000175 | |||
| 727 | Ga0105238_10009039 | |||
| 728 | Ga0105238_10041838 | |||
| 729 | Ga0105238_10070552 | |||
| 730 | Ga0105238_10071154 | |||
| 731 | Ga0105238_10937211 | |||
| 732 | Ga0105239_10001034 | |||
| 733 | Ga0105239_10197697 | |||
| 734 | Ga0157373_10009800 | |||
| 735 | Ga0157373_10032380 | |||
| 736 | Ga0157373_10193348 | |||
| 737 | Ga0157373_10207275 | |||
| 738 | Ga0157373_10245423 | |||
| 739 | Ga0157371_10000243 | |||
| 740 | Ga0157371_10002303 | |||
| 741 | Ga0157371_10010395 | |||
| 742 | Ga0157371_10388022 | |||
| 743 | Ga0157370_10001260 | |||
| 744 | Ga0157370_10010380 | |||
| 745 | Ga0157370_10014883 | |||
| 746 | Ga0157370_10044732 | |||
| 747 | Ga0157370_10063691 | |||
| 748 | Ga0157370_10131797 | |||
| 749 | Ga0157370_10132116 | |||
| 750 | Ga0157370_10225069 | |||
| 751 | Ga0157369_10009062 | |||
| 752 | Ga0157369_10011965 | |||
| 753 | Ga0157369_10147375 | |||
| 754 | Ga0157369_10167155 | |||
| 755 | Ga0157374_10054774 | |||
| 756 | Ga0157374_10532731 | |||
| 757 | Ga0157378_10152547 | |||
| 758 | Ga0157372_10007598 | |||
| 759 | Ga0157372_10016909 | |||
| 760 | Ga0157372_10028390 | |||
| 761 | Ga0157372_10444809 | |||
| 762 | Ga0157372_10450468 | |||
| 763 | Ga0157380_10096186 | |||
| 764 | Ga0182008_10008822 | |||
| 765 | Ga0182008_10016470 | |||
| 766 | Ga0182008_10056941 | |||
| 767 | Ga0182008_10074321 | |||
| 768 | Ga0182008_10224347 | |||
| 769 | Ga0157376_10005164 | |||
| 770 | Ga0157376_10033922 | |||
| 771 | Ga0182006_1000426 | |||
| 772 | Ga0182006_1017509 | |||
| 773 | Ga0182007_10000079 | |||
| 774 | Ga0182007_10010422 | |||
| 775 | Ga0182007_10015088 | |||
| 776 | Ga0182007_10044035 | |||
| 777 | Ga0182005_1000166 | |||
| 778 | Ga0182005_1000177 | |||
| 779 | Ga0182005_1007680 | |||
| 780 | Ga0183369_1003 | |||
| 781 | Ga0183368_1003 | |||
| 782 | Ga0163161_10013517 | |||
| 783 | Ga0163161_10049215 | |||
| 784 | Ga0206356_10858187 | |||
| 785 | Ga0206349_1121353 | |||
| 786 | Ga0206354_10991871 | |||
| 787 | Ga0206353_10988314 | |||
| 788 | Ga0213872_10002643 | |||
| 789 | Ga0209435_105848 | |||
| 790 | Ga0209760_100151 | |||
| 791 | Ga0209784_100119 | |||
| 792 | Ga0209674_100033 | |||
| 793 | Ga0209674_100719 | |||
| 794 | Ga0209674_100721 | |||
| 795 | Ga0209672_100437 | |||
| 796 | Ga0209672_101014 | |||
| 797 | Ga0209672_102221 | |||
| 798 | Ga0207427_100037 | |||
| 799 | Ga0207427_100142 | |||
| 800 | Ga0207427_100344 | |||
| 801 | Ga0207427_100349 | |||
| 802 | Ga0207427_104032 | |||
| 803 | Ga0209437_100074 | |||
| 804 | Ga0209437_100083 | |||
| 805 | Ga0209437_100157 | |||
| 806 | Ga0209437_100162 | |||
| 807 | Ga0209437_100886 | |||
| 808 | Ga0209437_101643 | |||
| 809 | Ga0209258_100057 | |||
| 810 | Ga0209258_100127 | |||
| 811 | Ga0209258_100538 | |||
| 812 | Ga0209258_103198 | |||
| 813 | Ga0209646_1001148 | |||
| 814 | Ga0209026_1000200 | |||
| 815 | Ga0209026_1000237 | |||
| 816 | Ga0209026_1000378 | |||
| 817 | Ga0209026_1000603 | |||
| 818 | Ga0209026_1003698 | |||
| 819 | Ga0209148_1000005 | |||
| 820 | Ga0209148_1000036 | |||
| 821 | Ga0209148_1000068 | |||
| 822 | Ga0209148_1000775 | |||
| 823 | Ga0209148_1002174 | |||
| 824 | Ga0209759_1000286 | |||
| 825 | Ga0209759_1001277 | |||
| 826 | Ga0209759_1001677 | |||
| 827 | Ga0209759_1012457 | |||
| 828 | Ga0209129_1000239 | |||
| 829 | Ga0209129_1001622 | |||
| 830 | Ga0209233_1000040 | |||
| 831 | Ga0209233_1000075 | |||
| 832 | Ga0209233_1000096 | |||
| 833 | Ga0209233_1000998 | |||
| 834 | Ga0209233_1008075 | |||
| 835 | Ga0209455_1000040 | |||
| 836 | Ga0209455_1000071 | |||
| 837 | Ga0209455_1000151 | |||
| 838 | Ga0209455_1005468 | |||
| 839 | Ga0209455_1010429 | |||
| 840 | Ga0209676_1000018 | |||
| 841 | Ga0209676_1001983 | |||
| 842 | Ga0209025_1000048 | |||
| 843 | Ga0209758_1000056 | |||
| 844 | Ga0209758_1000874 | |||
| 845 | Ga0209758_1009524 | |||
| 846 | Ga0209050_1000592 | |||
| 847 | Ga0209051_1003638 | |||
| 848 | Ga0209257_1000035 | |||
| 849 | Ga0209257_1001448 | |||
| 850 | Ga0207656_10032870 | |||
| 851 | Ga0207655_1030214 | |||
| 852 | Ga0207655_1132452 | |||
| 853 | Ga0207710_10010072 | |||
| 854 | Ga0207680_10000001 | |||
| 855 | Ga0207647_10000188 | |||
| 856 | Ga0207647_10000865 | |||
| 857 | Ga0207647_10006553 | |||
| 858 | Ga0207647_10047442 | |||
| 859 | Ga0207705_10001049 | |||
| 860 | Ga0207705_10027986 | |||
| 861 | Ga0207705_10096042 | |||
| 862 | Ga0207705_10259840 | |||
| 863 | Ga0207695_10000997 | |||
| 864 | Ga0207695_10005208 | |||
| 865 | Ga0207695_10011198 | |||
| 866 | Ga0207695_10025714 | |||
| 867 | Ga0207671_10000037 | |||
| 868 | Ga0207671_10001266 | |||
| 869 | Ga0207660_10188374 | |||
| 870 | Ga0207660_10307163 | |||
| 871 | Ga0207657_10057772 | |||
| 872 | Ga0207657_10101310 | |||
| 873 | Ga0207657_10101900 | |||
| 874 | Ga0207657_10275283 | |||
| 875 | Ga0207649_10012167 | |||
| 876 | Ga0207649_10047167 | |||
| 877 | Ga0207652_10016667 | |||
| 878 | Ga0207694_10000257 | |||
| 879 | Ga0207694_10056309 | |||
| 880 | Ga0207694_10307918 | |||
| 881 | Ga0207700_10058673 | |||
| 882 | Ga0207664_10000041 | |||
| 883 | Ga0207664_10001637 | |||
| 884 | Ga0207664_10028700 | |||
| 885 | Ga0207664_10249820 | |||
| 886 | Ga0207690_10000285 | |||
| 887 | Ga0207690_10019109 | |||
| 888 | Ga0207690_10024127 | |||
| 889 | Ga0207690_10029598 | |||
| 890 | Ga0207690_10138366 | |||
| 891 | Ga0207706_10368470 | |||
| 892 | Ga0207670_10022479 | |||
| 893 | Ga0207704_10332922 | |||
| 894 | Ga0207711_10118412 | |||
| 895 | Ga0207689_10017785 | |||
| 896 | Ga0207667_10000184 | |||
| 897 | Ga0207667_10012090 | |||
| 898 | Ga0207667_10013456 | |||
| 899 | Ga0207667_10091604 | |||
| 900 | Ga0207668_10019101 | |||
| 901 | Ga0207668_10056198 | |||
| 902 | Ga0207668_10080851 | |||
| 903 | Ga0207640_10010677 | |||
| 904 | Ga0207639_10003146 | |||
| 905 | Ga0207639_10050886 | |||
| 906 | Ga0207639_10165576 | |||
| 907 | Ga0207639_10313944 | |||
| 908 | Ga0207678_10014149 | |||
| 909 | Ga0207678_10057051 | |||
| 910 | Ga0207678_10154420 | |||
| 911 | Ga0207678_10204508 | |||
| 912 | Ga0207702_10000222 | |||
| 913 | Ga0207702_10457402 | |||
| 914 | Ga0207641_10045468 | |||
| 915 | Ga0207648_10054097 | |||
| 916 | Ga0207674_10008040 | |||
| 917 | Ga0207674_10081355 | |||
| 918 | Ga0207674_10299985 | |||
| 919 | Ga0207683_10026617 | |||
| 920 | Ga0210000_1032506 | |||
| 921 | Ga0209999_1013189 | |||
| 922 | Ga0209983_1001045 | |||
| 923 | Ga0209974_10004142 | |||
| 924 | Ga0207428_10076073 | |||
| 925 | Ga0268266_10000091 | |||
| 926 | Ga0268265_10055187 | |||
| 927 | Ga0268264_10153509 | |||
| 928 | Ga0265334_10000008 | |||
| 929 | Ga0265338_10510223 | |||
| 930 | Ga0265313_10000076 | |||
| 931 | Ga0307508_10027818 | |||
| 932 | Ga0316579_10002909 | |||
| 933 | Ga0316576_10026686 | |||
| 934 | Ga0316578_10002032 | |||
| 935 | Ga0307516_10054539 | |||
| 936 | Ga0316577_10002503 | |||
| 937 | Ga0307412_10002394 | |||
| 938 | Ga0307412_10054365 | |||
| 939 | Ga0307412_10464174 | |||
| 940 | Ga0307416_100024526 | |||
| 941 | Ga0307414_10157937 | |||
| 942 | Ga0307414_10164938 | |||
| 943 | Ga0307414_10240271 | |||
| 944 | Ga0307411_10410272 | |||
| 945 | Ga0316583_10122034 | |||
| 946 | Ga0316585_10002574 | |||
| 947 | Ga0395899_0050873 | |||
| 948 | Ga0395899_0086216 | |||
| 949 | Ga0395899_0135215 | |||
| 950 | Ga0395900_0000446 | |||
| 951 | Ga0395900_0001441 | |||
| 952 | Ga0395900_0079860 | |||
| 953 | Ga0395900_0347995 | |||
| 954 | Ga0395898_0000362 | |||
| 955 | Ga0395898_0005272 | |||
| 956 | Ga0395898_0013116 | |||
| 957 | Ga0395898_0024694 | |||
| 958 | Ga0395901_0001926 | |||
| 959 | Ga0395901_0001974 | |||
| 960 | Ga0395901_0086506 | |||
| 961 | Ga0395901_0366403 | |||
| 962 | Ga0400487_22015 | |||
| 963 | Ga0436361_0547085 | |||
| 964 | Ga0439436_0000009 | |||
| 965 | Ga0439465_0001199 | |||
| 966 | Ga0451787_336456 | |||
| 967 | Ga0451793_0608163 | |||
| 968 | Ga0451793_0975326 | |||
| 969 | Ga0451837_1331880 | |||
| 970 | Ga0451841_1409615 | |||
| 971 | Ga0439448_0025379 | |||
| 972 | Ga0439448_0080885 | |||
| 973 | Ga0439449_0005572 | |||
| 974 | Ga0439463_026647 | |||
| 975 | Ga0439459_0000115 | |||
| 976 | Ga0451577_0016708 | |||
| 977 | Ga0451577_0045810 | |||
| 978 | Ga0466969_0167392 | |||
| 979 | Ga0466972_0050630 | |||
| 980 | Ga0466965_0008160 | |||
| 981 | Ga0466966_0001209 | |||
| 982 | Ga0466961_0005390 | |||
| 983 | Ga0466961_0082381 | |||
| 984 | Ga0466964_0006378 | |||
| 985 | Ga0466971_0019652 | |||
| 986 | Ga0466971_0023982 | |||
| 987 | Ga0466968_0004187 | |||
| 988 | Ga0466970_0012604 | |||
| 989 | Ga0466957_0096346 | |||
| 990 | Ga0466957_0242886 | |||
| 991 | Ga0466959_0003364 | |||
| 992 | Ga0466958_0006702 | |||
| 993 | Ga0466967_0103052 | |||
| 994 | Ga0466967_0526662 | |||
| 995 | Ga0495617_000523 | |||
| 996 | Ga0495638_0000180 | |||
| 997 | Ga0495638_0001693 | |||
| 998 | Ga0495638_0014890 | |||
| 999 | Ga0495650_0000469 | |||
| 1000 | Ga0495650_0002069 | |||
| 1001 | Ga0495650_0007187 | |||
| 1002 | Ga0495585_0000437 | |||
| 1003 | Ga0495607_0000654 | |||
| 1004 | Ga0495607_0027278 | |||
| 1005 | Ga0495606_0002503 | |||
| 1006 | Ga0495606_0014630 | |||
| 1007 | Ga0495610_0002419 | |||
| 1008 | Ga0495610_0028688 | |||
| 1009 | Ga0495616_0000190 | |||
| 1010 | Ga0495620_0039922 | |||
| 1011 | Ga0495631_0196002 | |||
| 1012 | Ga0495632_0000135 | |||
| 1013 | Ga0495632_0048840 | |||
| 1014 | Ga0495643_0083501 | |||
| 1015 | Ga0495648_0001900 | |||
| 1016 | Ga0495648_0058575 | |||
| 1017 | Ga0495663_0057458 | |||
| 1018 | Ga0495609_0048118 | |||
| 1019 | Ga0495597_0076485 | |||
| 1020 | Ga0495622_0004707 | |||
| 1021 | Ga0495633_0013300 | |||
| 1022 | Ga0495668_0002918 | |||
| 1023 | Ga0495611_0000004 | |||
| 1024 | Ga0495611_0001192 | |||
| 1025 | Ga0495625_0000617 | |||
| 1026 | Ga0495625_0007542 | |||
| 1027 | Ga0495625_0088749 | |||
| 1028 | Ga0495661_0001320 | |||
| 1029 | Ga0495671_0052533 | |||
| 1030 | Ga0495649_0050860 | |||
| 1031 | Ga0495589_0000555 | |||
| 1032 | Ga0495660_0000356 | |||
| 1033 | Ga0495660_0002959 | |||
| 1034 | Ga0495683_0001003 | |||
| 1035 | Ga0495679_000011 | |||
| 1036 | Ga0495673_0000036 | |||
| 1037 | Ga0495673_0000151 | |||
| 1038 | Ga0495686_0000126 | |||
| 1039 | Ga0496100_0161391 | |||
| 1040 | Ga0496101_0388529 | |||
| 1041 | Ga0496104_0022837 | |||
| 1042 | Ga0496104_0692958 | |||
| 1043 | Ga0496104_0963788 | |||
| 1044 | Ga0496105_0002564 | |||
| 1045 | Ga0496105_0474272 | |||
| 1046 | Ga0496106_0010847 | |||
| 1047 | Ga0496106_0049427 | |||
| 1048 | Ga0496106_0192611 | |||
| 1049 | Ga0496107_0017259 | |||
| 1050 | Ga0496115_0000008 | |||
| 1051 | Ga0496115_0010402 | |||
| 1052 | Ga0496116_0003670 | |||
| 1053 | Ga0496118_0004467 | |||
| 1054 | Ga0496118_0006061 | |||
| 1055 | Ga0496118_0025116 | |||
| 1056 | Ga0496118_0030781 | |||
| 1057 | Ga0496118_0370434 | |||
| 1058 | Ga0496119_0000218 | |||
| 1059 | Ga0496119_0011983 | |||
| 1060 | Ga0496119_0015104 | |||
| 1061 | Ga0496120_0001849 | |||
| 1062 | Ga0496120_0002027 | |||
| 1063 | Ga0496121_0001803 | |||
| 1064 | Ga0496121_0003410 | |||
| 1065 | Ga0496121_0003449 | |||
| 1066 | Ga0496121_0017512 | |||
| 1067 | Ga0496121_0022889 | |||
| 1068 | Ga0496121_0048827 | |||
| 1069 | Ga0496121_0264157 | |||
| 1070 | Ga0496122_0017062 | |||
| 1071 | Ga0496122_0019895 | |||
| 1072 | Ga0496122_0079922 | |||
| 1073 | Ga0496123_0001416 | |||
| 1074 | Ga0496123_0058936 | |||
| 1075 | Ga0496124_0001552 | |||
| 1076 | Ga0496125_0004471 | |||
| 1077 | Ga0496125_0019364 | |||
| 1078 | Ga0496125_0030941 | |||
| 1079 | Ga0496126_0003595 | |||
| 1080 | Ga0496126_0027285 | |||
| 1081 | Ga0496126_0096466 | |||
| 1082 | Ga0496126_0174466 | |||
| 1083 | Ga0496126_0280884 | |||
| 1084 | Ga0495678_000067 | |||
| 1085 | Ga0495682_0006722 | |||
| 1086 | Ga0495682_0018969 | |||
| 1087 | Ga0501032_0018354 | |||
| 1088 | Ga0501032_0130089 | |||
| 1089 | Ga0501033_0068344 | |||
| 1090 | Ga0501033_0209086 | |||
| 1091 | Ga0501034_0054713 | |||
| 1092 | Ga0501034_0060864 | |||
| 1093 | Ga0501034_0312304 | |||
| 1094 | Ga0501034_0447458 | |||
| 1095 | Ga0501034_0482129 | |||
| 1096 | Ga0501037_0247010 | |||
| 1097 | Ga0501037_0297889 | |||
| 1098 | Ga0501038_0041530 | |||
| 1099 | Ga0501038_0278809 | |||
| 1100 | Ga0501038_0279456 | |||
| 1101 | Ga0501039_0118596 | |||
| 1102 | Ga0501039_0229796 | |||
| 1103 | Ga0501042_0352399 | |||
| 1104 | Ga0501043_0026156 | |||
| 1105 | Ga0501043_0034199 | |||
| 1106 | Ga0501043_0134891 | |||
| 1107 | Ga0501043_0138220 | |||
| 1108 | Ga0501046_0042107 | |||
| 1109 | Ga0501046_0164767 | |||
| 1110 | Ga0501046_0372913 | |||
| 1111 | Ga0501047_0014077 | |||
| 1112 | Ga0501047_0223030 | |||
| 1113 | Ga0501047_0317443 | |||
| 1114 | Ga0501048_0357050 | |||
| 1115 | Ga0501068_0140443 | |||
| 1116 | Ga0501070_0346120 | |||
| 1117 | Ga0501070_0407885 | |||
| 1118 | Ga0501070_0526019 | |||
| 1119 | Ga0501079_0112231 | |||
| 1120 | Ga0501080_0039836 | |||
| 1121 | Ga0501080_0455038 | |||
| 1122 | Ga0501083_0011507 | |||
| 1123 | Ga0501035_0024127 | |||
| 1124 | Ga0501035_0041977 | |||
| 1125 | Ga0501035_0138592 | |||
| 1126 | Ga0501035_0144016 | |||
| 1127 | Ga0501035_0335666 | |||
| 1128 | Ga0501035_0499321 | |||
| 1129 | Ga0501035_0645989 | |||
| 1130 | Ga0501044_0052943 | |||
| 1131 | Ga0501044_0297497 | |||
| 1132 | Ga0501044_0403339 | |||
| 1133 | nmdc:mga00v17_153376_c1 | |||
| 1134 | nmdc:mga00v17_279684_c1 | |||
| 1135 | nmdc:mga00v17_321449_c1 | |||
| 1136 | nmdc:mga00v17_77606_c1 | |||
| 1137 | nmdc:mga0yw44_167476_c1 | |||
| 1138 | nmdc:mga05p37_5968_c1 | |||
| 1139 | nmdc:mga09592_5296_c1 | |||
| 1140 | nmdc:mga06r32_2458_c1 | |||
| 1141 | nmdc:mga08y16_1907_c1 | |||
| 1142 | nmdc:mga08y16_2683_c1 | |||
| 1143 | nmdc:mga0sz30_24728_c1 | |||
| 1144 | nmdc:mga0sz30_306048_c1 | |||
| 1145 | Ga0500643_000012 | |||
| 1146 | Ga0500646_0089636 | |||
| 1147 | Ga0500651_0003309 | |||
| 1148 | Ga0500555_002193 | |||
| 1149 | Ga0500559_0276158 | |||
| 1150 | Ga0500636_0000164 | |||
| 1151 | Ga0500637_0187715 | |||
| 1152 | Ga0500625_016497 | |||
| 1153 | Ga0501082_0040078 | |||
| 1154 | Ga0501082_0165667 | |||
| 1155 | Ga0466962_0000988 | |||
| 1156 | Ga0466962_0001385 | |||
| 1157 | 2595447752 | |||
| 1158 | 2595451044 | |||
| 1159 | 2643897017 | |||
| 1160 | 2687581722 | |||
| 1161 | 2721029007 | |||
| 1162 | 2739227389 | |||
| 1163 | 2739733999 | |||
| 1164 | 2819565843 | |||
| 1165 | 2842921934 | |||
| 1166 | 2852652119 | |||
| 1167 | 2874223202 | |||
| 1168 | 2884415401 | |||
| 1169 | 2895395809 | |||
| 1170 | 2904467307 | |||
| 1171 | 2919093237 | |||
| 1172 | 2919407925 | |||
| 1173 | 2919517141 | |||
| 1174 | 2919677596 | |||
| 1175 | 2919691953 | |||
| 1176 | 2928499868 | |||
| 1177 | 2928966154 | |||
| 1178 | 2931383361 | |||
| 1179 | 2937614334 | |||
| 1180 | 2939614071 | |||
| 1181 | 2939630924 | |||
| 1182 | 2941478742 | |||
| 1183 | 2953997026 | |||
| 1184 | 2961049966 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1w66-assembly1.cif.gz_A | structure of a lipoate-protein ligase b from mycobacterium tuberculosis | 0.9271 | 3 | 202 |
| 2qhv-assembly1.cif.gz_A | structural basis of octanoic acid recognition by lipoate-protein ligase b | 0.8794 | 3 | 206 |
| 2qhv-assembly1.cif.gz_A | structural basis of octanoic acid recognition by lipoate-protein ligase b | 0.8515 | 3 | 206 |
| 1w66-assembly1.cif.gz_A | structure of a lipoate-protein ligase b from mycobacterium tuberculosis | 0.8495 | 3 | 202 |
| 2c7i-assembly4.cif.gz_D | structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. | 0.7951 | 1 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P60720_2_203_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9835 | 1 | 200 | 3.30.930.10 |
| af_P60720_2_203_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9691 | 1 | 200 | 3.30.930.10 |
| 1w66A01 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9271 | 3 | 202 | 3.30.930.10 |
| af_Q9SXP7_6_215_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.9063 | 5 | 201 | 3.30.930.10 |
| af_P0C7R2_45_252_3.30.930.10 | Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 | 0.8921 | 3 | 193 | 3.30.930.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534A8Q8-F1-model_v4 | Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) | 1 | 22 | 201 |
GO:0005737
GO:0033819 |
| AF-A0A3B0VSD3-F1-model_v4 | lipoyl(octanoyl) transferase (EC 2.3.1.181) | 0.9963 | 3 | 91 |
GO:0033819
|
| AF-A0A3D3D3L3-F1-model_v4 | deleted | 0.9958 | 6 | 82 |
|
| AF-A0A1E4L021-F1-model_v4 | deleted | 0.9955 | 1 | 209 |
|
| AF-A0A7S6SHU9-F1-model_v4 | Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) | 0.995 | 3 | 201 |
GO:0005737
GO:0033819 |