F467111

General Info

Members Datasets Scaffolds Average Seq Length
592 308 1184 225

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100011336|Ga0070659_1000113363
Length 265
Sequence MSLAALISEETQGSKFVVTHESRIPAFNSRMAGHPGFQQPHGWSSRPLTIRRLGRQPYEATWRAMSAFTDSRGADTPDELWLLEHDPVFTLGQAGKMEHVLAPGDIPVIPVDRGGQVTYHGPGQIVGYPLIDLRRAGVGVRELVRRIEQALIDTLAHWNVTAVRREGAPGVYVGEAKIAALGLRVRRGCSFHGLAFNVAMDLEPFQRINPCGYKGLAVTQLVDLADSPQLADVEDVLVEEFCRQFRFVAEPAAPVLPELPARVAV

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
84 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
85 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
92 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
93 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
157 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
158 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
159 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
160 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
166 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
176 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
177 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
178 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
182 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
200 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
220 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
221 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
222 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
223 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
224 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
225 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
236 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
245 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
262 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
272 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
278 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
281 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
282 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
283 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
284 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
285 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
286 2738543009 Luteibacter sp. OK325 Isolate Unclassified
287 2739367700 Dyella sp. YR388 Isolate Unclassified
288 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
289 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
290 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
291 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
292 2884411467 Dyella sp. AD56 Isolate Rhizosphere
293 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
294 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
295 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
296 2919404418 Luteibacter sp. 3190 Isolate Unclassified
297 2919513703 Luteimonas sp. 3794 Isolate Unclassified
298 2919675420 Luteimonas terrae 4099 Isolate Unclassified
299 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
300 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
301 2928963466 Dyella japonica 1073 Isolate Unclassified
302 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
303 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
304 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
305 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
306 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
307 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
308 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.92
Metatranscriptomes 1.35
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.57
Nodule 0
Rhizoplane 2.7
Rhizosphere 66.39
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100011336 3300005366 Bacteria 6591
2 JGI24739J22299_10000877 3300001989 Bacteria 11124
3 JGI24739J22299_10009549 3300001989 Bacteria 3611
4 JGI24737J22298_10009825 3300001990 Bacteria 3170
5 JGI24737J22298_10060286 3300001990 Bacteria 1143
6 JGI24735J21928_10000330 3300002067 Bacteria 16497
7 JGI24735J21928_10006866 3300002067 Bacteria 3727
8 JGI25156J39149_1002101 3300002705 Bacteria 7538
9 JGI25156J39149_1005166 3300002705 Bacteria 3831
10 JGI25162J39368_1001076 3300002737 Bacteria 16652
11 JGI25162J39368_1001198 3300002737 Bacteria 15189
12 JGI25162J39368_1001629 3300002737 Bacteria 11191
13 JGI25162J39368_1005057 3300002737 Bacteria 2757
14 JGI25162J39368_1005129 3300002737 Bacteria 2699
15 JGI25157J39369_1000967 3300002741 Bacteria 13425
16 JGI25157J39369_1001225 3300002741 Bacteria 10664
17 JGI25157J39369_1001443 3300002741 Bacteria 8930
18 JGI25157J39369_1001525 3300002741 Bacteria 8403
19 JGI25163J39215_1000307 3300002771 Bacteria 16531
20 JGI25164J39214_1000055 3300002772 Bacteria 119135
21 JGI25164J39214_1000333 3300002772 Bacteria 30196
22 JGI25164J39214_1002561 3300002772 Bacteria 2699
23 JGI25152J39213_1000103 3300002773 Bacteria 59472
24 JGI25152J39213_1022601 3300002773 Bacteria 1084
25 JGI25150J39212_1000183 3300002774 Bacteria 35389
26 JGI25151J46595_10000271 3300003187 Bacteria 59472
27 JGI25165J46597_1000161 3300003214 Bacteria 107058
28 JGI25165J46597_1000213 3300003214 Bacteria 82308
29 JGI25165J46597_1004821 3300003214 Bacteria 2757
30 JGI25165J46597_1004918 3300003214 Bacteria 2699
31 JGI25153J46596_10000190 3300003215 Bacteria 59472
32 JGI25153J46596_10013250 3300003215 Bacteria 3498
33 rootH2_10010505 3300003320 Bacteria 6442
34 Ga0006562J51391_1039069 3300003578 Bacteria 8681
35 Ga0006562J51391_1039071 3300003578 Bacteria 5140
36 Ga0006562J51391_1129535 3300003578 Bacteria 7285
37 Ga0006562J51391_1129537 3300003578 Bacteria 5590
38 Ga0055538_1006065 3300003751 Bacteria 1198
39 Ga0055527_1003885 3300003760 Bacteria 2137
40 Ga0055527_1009028 3300003760 Bacteria 1179
41 Ga0055527_1011792 3300003760 Bacteria 995
42 Ga0055535_1001153 3300003761 Bacteria 15611
43 Ga0055535_1001171 3300003761 Bacteria 15320
44 Ga0055535_1001789 3300003761 Bacteria 9444
45 Ga0055535_1004503 3300003761 Bacteria 3365
46 Ga0055535_1021973 3300003761 Bacteria 767
47 Ga0055542_1001079 3300003762 Bacteria 16652
48 Ga0055542_1001167 3300003762 Bacteria 15189
49 Ga0055542_1001346 3300003762 Bacteria 12683
50 Ga0055542_1001386 3300003762 Bacteria 12280
51 Ga0055529_1000196 3300003763 Bacteria 82308
52 Ga0055529_1000768 3300003763 Bacteria 20210
53 Ga0055529_1005457 3300003763 Bacteria 1840
54 Ga0065165_1002248 3300005262 Bacteria 17114
55 Ga0070658_10007622 3300005327 Bacteria 8729
56 Ga0070658_10061938 3300005327 Bacteria 3049
57 Ga0070658_10249206 3300005327 Bacteria 1507
58 Ga0070658_10316617 3300005327 Bacteria 1332
59 Ga0070658_10404009 3300005327 Bacteria 1173
60 Ga0068869_100027267 3300005334 Bacteria 3981
61 Ga0070666_10000022 3300005335 Bacteria 166910
62 Ga0070680_100035663 3300005336 Bacteria 4016
63 Ga0070680_100353029 3300005336 Bacteria 1250
64 Ga0070682_100000806 3300005337 Bacteria 18399
65 Ga0070682_100002014 3300005337 Bacteria 11352
66 Ga0070689_100003352 3300005340 Bacteria 10649
67 Ga0070661_100004407 3300005344 Bacteria 9704
68 Ga0070661_100015590 3300005344 Bacteria 5364
69 Ga0070661_100029315 3300005344 Bacteria 3972
70 Ga0070661_100116631 3300005344 Bacteria 1997
71 Ga0070692_10080198 3300005345 Bacteria 1756
72 Ga0070668_100004046 3300005347 Bacteria 10853
73 Ga0070688_100035669 3300005365 Bacteria 3022
74 Ga0070659_100018023 3300005366 Bacteria 5324
75 Ga0070659_100299622 3300005366 Bacteria 1340
76 Ga0070659_100350507 3300005366 Bacteria 1238
77 Ga0070714_100000180 3300005435 Bacteria 50386
78 Ga0070714_100002914 3300005435 Bacteria 12654
79 Ga0070713_100003831 3300005436 Bacteria 9962
80 Ga0070710_10140263 3300005437 Bacteria 1482
81 Ga0070694_100060302 3300005444 Bacteria 2587
82 Ga0070663_100036660 3300005455 Bacteria 3407
83 Ga0070663_100128046 3300005455 Bacteria 1925
84 Ga0070663_100292889 3300005455 Bacteria 1300
85 Ga0070678_100013902 3300005456 Bacteria 5061
86 Ga0070681_10053688 3300005458 Bacteria 4016
87 Ga0070679_100026284 3300005530 Bacteria 5716
88 Ga0070679_100054077 3300005530 Bacteria 3996
89 Ga0070679_100168247 3300005530 Unclassified 2165
90 Ga0070679_100193247 3300005530 Bacteria 2003
91 Ga0070679_100390193 3300005530 Bacteria 1338
92 Ga0068853_100000720 3300005539 Bacteria 22869
93 Ga0068853_100099017 3300005539 Bacteria 2575
94 Ga0070696_100001266 3300005546 Bacteria 16419
95 Ga0070696_100067131 3300005546 Bacteria 2517
96 Ga0070696_100135599 3300005546 Bacteria 1794
97 Ga0070693_100003356 3300005547 Bacteria 7445
98 Ga0070665_100010878 3300005548 Bacteria 9204
99 Ga0068855_100036076 3300005563 Bacteria 5886
100 Ga0068855_100192682 3300005563 Bacteria 2298
101 Ga0068857_100005031 3300005577 Bacteria 11234
102 Ga0068857_100135134 3300005577 Bacteria 2226
103 Ga0068854_100542156 3300005578 Bacteria 985
104 Ga0068856_100000086 3300005614 Bacteria 87570
105 Ga0068856_100093388 3300005614 Bacteria 2994
106 Ga0068852_100014146 3300005616 Bacteria 6129
107 Ga0068852_100030349 3300005616 Bacteria 4449
108 Ga0068859_100027472 3300005617 Bacteria 5707
109 Ga0068864_100918760 3300005618 Bacteria 865
110 Ga0068851_10052768 3300005834 Bacteria 2068
111 Ga0068863_100024540 3300005841 Bacteria 5751
112 Ga0068858_100256898 3300005842 Unclassified 1660
113 Ga0068858_100649259 3300005842 Bacteria 1025
114 Ga0068860_100018156 3300005843 Bacteria 6847
115 Ga0068862_100093017 3300005844 Bacteria 2629
116 Ga0075364_10133406 3300006051 Bacteria 1667
117 Ga0075364_10335848 3300006051 Bacteria 1029
118 Ga0075369_10010563 3300006186 Bacteria 3614
119 Ga0097621_100154539 3300006237 Bacteria 1968
120 Ga0075431_100004170 3300006847 Bacteria 14134
121 Ga0075429_100008129 3300006880 Bacteria 9121
122 Ga0068865_100521957 3300006881 Bacteria 993
123 Ga0097620_100027472 3300006931 Bacteria 5707
124 Ga0105244_10162289 3300009036 Bacteria 1067
125 Ga0105240_10015130 3300009093 Bacteria 10501
126 Ga0105240_10064044 3300009093 Bacteria 4570
127 Ga0111539_10004789 3300009094 Bacteria 17656
128 Ga0111539_10039397 3300009094 Bacteria 5696
129 Ga0111539_10523121 3300009094 Bacteria 1382
130 Ga0105247_10002001 3300009101 Bacteria 14120
131 Ga0105237_10000070 3300009545 Bacteria 136694
132 Ga0105237_10000134 3300009545 Bacteria 104004
133 Ga0105237_10124846 3300009545 Bacteria 2568
134 Ga0105238_10000175 3300009551 Bacteria 69973
135 Ga0105238_10009039 3300009551 Bacteria 9969
136 Ga0105238_10041838 3300009551 Bacteria 4641
137 Ga0105238_10070552 3300009551 Bacteria 3492
138 Ga0105238_10071154 3300009551 Bacteria 3475
139 Ga0105238_10937211 3300009551 Bacteria 885
140 Ga0105239_10001034 3300010375 Bacteria 38757
141 Ga0105239_10197697 3300010375 Bacteria 2252
142 Ga0157373_10009800 3300013100 Bacteria 7067
143 Ga0157373_10032380 3300013100 Bacteria 3763
144 Ga0157373_10193348 3300013100 Bacteria 1434
145 Ga0157373_10207275 3300013100 Bacteria 1382
146 Ga0157373_10245423 3300013100 Bacteria 1266
147 Ga0157371_10000243 3300013102 Bacteria 77959
148 Ga0157371_10002303 3300013102 Bacteria 18376
149 Ga0157371_10010395 3300013102 Bacteria 7255
150 Ga0157371_10388022 3300013102 Bacteria 1020
151 Ga0157370_10001260 3300013104 Bacteria 31632
152 Ga0157370_10010380 3300013104 Bacteria 9820
153 Ga0157370_10014883 3300013104 Bacteria 7936
154 Ga0157370_10044732 3300013104 Bacteria 4252
155 Ga0157370_10063691 3300013104 Bacteria 3492
156 Ga0157370_10131797 3300013104 Bacteria 2331
157 Ga0157370_10132116 3300013104 Bacteria 2328
158 Ga0157370_10225069 3300013104 Bacteria 1737
159 Ga0157369_10009062 3300013105 Bacteria 11394
160 Ga0157369_10011965 3300013105 Bacteria 9858
161 Ga0157369_10147375 3300013105 Bacteria 2488
162 Ga0157369_10167155 3300013105 Bacteria 2319
163 Ga0157374_10054774 3300013296 Bacteria 3721
164 Ga0157374_10532731 3300013296 Bacteria 1181
165 Ga0157378_10152547 3300013297 Bacteria 2154
166 Ga0157372_10007598 3300013307 Bacteria 11524
167 Ga0157372_10016909 3300013307 Bacteria 7830
168 Ga0157372_10028390 3300013307 Bacteria 6105
169 Ga0157372_10444809 3300013307 Bacteria 1510
170 Ga0157372_10450468 3300013307 Bacteria 1500
171 Ga0157380_10096186 3300014326 Bacteria 2455
172 Ga0182008_10008822 3300014497 Bacteria 5474
173 Ga0182008_10016470 3300014497 Bacteria 3841
174 Ga0182008_10056941 3300014497 Bacteria 1931
175 Ga0182008_10074321 3300014497 Bacteria 1672
176 Ga0182008_10224347 3300014497 Bacteria 962
177 Ga0157376_10005164 3300014969 Bacteria 9105
178 Ga0157376_10033922 3300014969 Bacteria 4115
179 Ga0182006_1000426 3300015261 Bacteria 33653
180 Ga0182006_1017509 3300015261 Bacteria 3042
181 Ga0182007_10000079 3300015262 Bacteria 73543
182 Ga0182007_10010422 3300015262 Bacteria 3672
183 Ga0182007_10015088 3300015262 Bacteria 2893
184 Ga0182007_10044035 3300015262 Bacteria 1482
185 Ga0182005_1000166 3300015265 Bacteria 45594
186 Ga0182005_1000177 3300015265 Bacteria 43741
187 Ga0182005_1007680 3300015265 Bacteria 3220
188 Ga0183369_1003 3300015685 Bacteria 726443
189 Ga0183368_1003 3300015687 Bacteria 1276390
190 Ga0163161_10013517 3300017792 Bacteria 5684
191 Ga0163161_10049215 3300017792 Bacteria 3045
192 Ga0206356_10858187 3300020070 Bacteria 5012
193 Ga0206349_1121353 3300020075 Bacteria 4561
194 Ga0206354_10991871 3300020081 Bacteria 4680
195 Ga0206353_10988314 3300020082 Bacteria 1901
196 Ga0213872_10002643 3300021361 Bacteria 10403
197 Ga0209435_105848 3300025206 Bacteria 1377
198 Ga0209760_100151 3300025207 Bacteria 42314
199 Ga0209784_100119 3300025224 Bacteria 82900
200 Ga0209674_100033 3300025226 Bacteria 423450
201 Ga0209674_100719 3300025226 Bacteria 11343
202 Ga0209674_100721 3300025226 Bacteria 11322
203 Ga0209672_100437 3300025228 Bacteria 23820
204 Ga0209672_101014 3300025228 Bacteria 12254
205 Ga0209672_102221 3300025228 Bacteria 5050
206 Ga0207427_100037 3300025231 Bacteria 303108
207 Ga0207427_100142 3300025231 Bacteria 82907
208 Ga0207427_100344 3300025231 Bacteria 30048
209 Ga0207427_100349 3300025231 Bacteria 29540
210 Ga0207427_104032 3300025231 Bacteria 2675
211 Ga0209437_100074 3300025233 Bacteria 300858
212 Ga0209437_100083 3300025233 Bacteria 256005
213 Ga0209437_100157 3300025233 Bacteria 151821
214 Ga0209437_100162 3300025233 Bacteria 147864
215 Ga0209437_100886 3300025233 Bacteria 12095
216 Ga0209437_101643 3300025233 Bacteria 5073
217 Ga0209258_100057 3300025242 Bacteria 334259
218 Ga0209258_100127 3300025242 Bacteria 177606
219 Ga0209258_100538 3300025242 Bacteria 35688
220 Ga0209258_103198 3300025242 Bacteria 3668
221 Ga0209646_1001148 3300025246 Bacteria 7760
222 Ga0209026_1000200 3300025250 Bacteria 82913
223 Ga0209026_1000237 3300025250 Bacteria 73153
224 Ga0209026_1000378 3300025250 Bacteria 40841
225 Ga0209026_1000603 3300025250 Bacteria 23162
226 Ga0209026_1003698 3300025250 Bacteria 4889
227 Ga0209148_1000005 3300025254 Bacteria 1806504
228 Ga0209148_1000036 3300025254 Bacteria 530505
229 Ga0209148_1000068 3300025254 Bacteria 335510
230 Ga0209148_1000775 3300025254 Bacteria 23906
231 Ga0209148_1002174 3300025254 Bacteria 7262
232 Ga0209759_1000286 3300025256 Bacteria 70415
233 Ga0209759_1001277 3300025256 Bacteria 15075
234 Ga0209759_1001677 3300025256 Bacteria 11545
235 Ga0209759_1012457 3300025256 Bacteria 2355
236 Ga0209129_1000239 3300025258 Bacteria 59863
237 Ga0209129_1001622 3300025258 Bacteria 12193
238 Ga0209233_1000040 3300025261 Bacteria 530395
239 Ga0209233_1000075 3300025261 Bacteria 356837
240 Ga0209233_1000096 3300025261 Bacteria 303482
241 Ga0209233_1000998 3300025261 Bacteria 12103
242 Ga0209233_1008075 3300025261 Bacteria 3286
243 Ga0209455_1000040 3300025272 Bacteria 430197
244 Ga0209455_1000071 3300025272 Bacteria 300858
245 Ga0209455_1000151 3300025272 Bacteria 129842
246 Ga0209455_1005468 3300025272 Bacteria 3918
247 Ga0209455_1010429 3300025272 Bacteria 2362
248 Ga0209676_1000018 3300025292 Bacteria 631385
249 Ga0209676_1001983 3300025292 Bacteria 16281
250 Ga0209025_1000048 3300025294 Bacteria 335574
251 Ga0209758_1000056 3300025297 Bacteria 335574
252 Ga0209758_1000874 3300025297 Bacteria 41508
253 Ga0209758_1009524 3300025297 Bacteria 6014
254 Ga0209050_1000592 3300025298 Bacteria 57827
255 Ga0209051_1003638 3300025303 Bacteria 9986
256 Ga0209257_1000035 3300025304 Bacteria 631463
257 Ga0209257_1001448 3300025304 Bacteria 28059
258 Ga0207656_10032870 3300025321 Bacteria 2157
259 Ga0207655_1030214 3300025728 Bacteria 2523
260 Ga0207655_1132452 3300025728 Bacteria 811
261 Ga0207710_10010072 3300025900 Bacteria 3977
262 Ga0207680_10000001 3300025903 Bacteria 1091453
263 Ga0207647_10000188 3300025904 Bacteria 50006
264 Ga0207647_10000865 3300025904 Bacteria 23447
265 Ga0207647_10006553 3300025904 Bacteria 8459
266 Ga0207647_10047442 3300025904 Bacteria 2672
267 Ga0207705_10001049 3300025909 Bacteria 22456
268 Ga0207705_10027986 3300025909 Bacteria 4018
269 Ga0207705_10096042 3300025909 Bacteria 2176
270 Ga0207705_10259840 3300025909 Bacteria 1326
271 Ga0207695_10000997 3300025913 Bacteria 50121
272 Ga0207695_10005208 3300025913 Bacteria 17393
273 Ga0207695_10011198 3300025913 Bacteria 10881
274 Ga0207695_10025714 3300025913 Bacteria 6585
275 Ga0207671_10000037 3300025914 Bacteria 230395
276 Ga0207671_10001266 3300025914 Bacteria 29783
277 Ga0207660_10188374 3300025917 Bacteria 1605
278 Ga0207660_10307163 3300025917 Bacteria 1264
279 Ga0207657_10057772 3300025919 Bacteria 3342
280 Ga0207657_10101310 3300025919 Bacteria 2390
281 Ga0207657_10101900 3300025919 Bacteria 2382
282 Ga0207657_10275283 3300025919 Bacteria 1337
283 Ga0207649_10012167 3300025920 Bacteria 4764
284 Ga0207649_10047167 3300025920 Bacteria 2650
285 Ga0207652_10016667 3300025921 Bacteria 6004
286 Ga0207694_10000257 3300025924 Bacteria 50545
287 Ga0207694_10056309 3300025924 Bacteria 3053
288 Ga0207694_10307918 3300025924 Bacteria 1305
289 Ga0207700_10058673 3300025928 Bacteria 2908
290 Ga0207664_10000041 3300025929 Bacteria 154806
291 Ga0207664_10001637 3300025929 Bacteria 14760
292 Ga0207664_10028700 3300025929 Bacteria 4231
293 Ga0207664_10249820 3300025929 Bacteria 1548
294 Ga0207690_10000285 3300025932 Bacteria 35963
295 Ga0207690_10019109 3300025932 Bacteria 4211
296 Ga0207690_10024127 3300025932 Bacteria 3805
297 Ga0207690_10029598 3300025932 Bacteria 3484
298 Ga0207690_10138366 3300025932 Bacteria 1791
299 Ga0207706_10368470 3300025933 Bacteria 1248
300 Ga0207670_10022479 3300025936 Bacteria 3910
301 Ga0207704_10332922 3300025938 Bacteria 1176
302 Ga0207711_10118412 3300025941 Bacteria 2363
303 Ga0207689_10017785 3300025942 Bacteria 6007
304 Ga0207667_10000184 3300025949 Bacteria 90846
305 Ga0207667_10012090 3300025949 Bacteria 9979
306 Ga0207667_10013456 3300025949 Bacteria 9363
307 Ga0207667_10091604 3300025949 Bacteria 3140
308 Ga0207668_10019101 3300025972 Bacteria 4326
309 Ga0207668_10056198 3300025972 Bacteria 2740
310 Ga0207668_10080851 3300025972 Bacteria 2355
311 Ga0207640_10010677 3300025981 Bacteria 5180
312 Ga0207639_10003146 3300026041 Bacteria 11096
313 Ga0207639_10050886 3300026041 Bacteria 3148
314 Ga0207639_10165576 3300026041 Bacteria 1867
315 Ga0207639_10313944 3300026041 Bacteria 1389
316 Ga0207678_10014149 3300026067 Bacteria 7014
317 Ga0207678_10057051 3300026067 Bacteria 3361
318 Ga0207678_10154420 3300026067 Bacteria 1960
319 Ga0207678_10204508 3300026067 Bacteria 1689
320 Ga0207702_10000222 3300026078 Bacteria 66254
321 Ga0207702_10457402 3300026078 Bacteria 1239
322 Ga0207641_10045468 3300026088 Bacteria 3697
323 Ga0207648_10054097 3300026089 Bacteria 3507
324 Ga0207674_10008040 3300026116 Bacteria 12228
325 Ga0207674_10081355 3300026116 Bacteria 3241
326 Ga0207674_10299985 3300026116 Bacteria 1556
327 Ga0207683_10026617 3300026121 Bacteria 4994
328 Ga0210000_1032506 3300027462 Bacteria 818
329 Ga0209999_1013189 3300027543 Bacteria 1500
330 Ga0209983_1001045 3300027665 Bacteria 6100
331 Ga0209974_10004142 3300027876 Bacteria 5181
332 Ga0207428_10076073 3300027907 Bacteria 2629
333 Ga0268266_10000091 3300028379 Bacteria 195002
334 Ga0268265_10055187 3300028380 Bacteria 3018
335 Ga0268264_10153509 3300028381 Bacteria 2067
336 Ga0265334_10000008 3300028573 Bacteria 200602
337 Ga0265338_10510223 3300028800 Bacteria 846
338 Ga0265313_10000076 3300031595 Bacteria 96542
339 Ga0307508_10027818 3300031616 Bacteria 5116
340 Ga0316579_10002909 3300031691 Bacteria 6571
341 Ga0316576_10026686 3300031727 Bacteria 4055
342 Ga0316578_10002032 3300031728 Bacteria 8624
343 Ga0307516_10054539 3300031730 Bacteria 3905
344 Ga0316577_10002503 3300031733 Bacteria 9118
345 Ga0307412_10002394 3300031911 Bacteria 10417
346 Ga0307412_10054365 3300031911 Bacteria 2657
347 Ga0307412_10464174 3300031911 Bacteria 1046
348 Ga0307416_100024526 3300032002 Bacteria 4405
349 Ga0307414_10157937 3300032004 Bacteria 1797
350 Ga0307414_10164938 3300032004 Bacteria 1764
351 Ga0307414_10240271 3300032004 Bacteria 1499
352 Ga0307411_10410272 3300032005 Bacteria 1122
353 Ga0316583_10122034 3300032133 Bacteria 908
354 Ga0316585_10002574 3300032137 Bacteria 4908
355 Ga0395899_0050873 3300037312 Bacteria 3075
356 Ga0395899_0086216 3300037312 Bacteria 2281
357 Ga0395899_0135215 3300037312 Bacteria 1757
358 Ga0395900_0000446 3300037418 Bacteria 59137
359 Ga0395900_0001441 3300037418 Bacteria 28406
360 Ga0395900_0079860 3300037418 Bacteria 3361
361 Ga0395900_0347995 3300037418 Bacteria 1456
362 Ga0395898_0000362 3300037466 Bacteria 99858
363 Ga0395898_0005272 3300037466 Bacteria 13973
364 Ga0395898_0013116 3300037466 Bacteria 8545
365 Ga0395898_0024694 3300037466 Bacteria 6061
366 Ga0395901_0001926 3300038443 Bacteria 21373
367 Ga0395901_0001974 3300038443 Bacteria 21107
368 Ga0395901_0086506 3300038443 Bacteria 3277
369 Ga0395901_0366403 3300038443 Bacteria 1485
370 Ga0400487_22015 3300039110 Bacteria 27561
371 Ga0436361_0547085 3300039447 Bacteria 16773
372 Ga0439436_0000009 3300041404 Bacteria 108375
373 Ga0439465_0001199 3300041413 Bacteria 8345
374 Ga0451787_336456 3300041441 Bacteria 1571
375 Ga0451793_0608163 3300041452 Bacteria 730
376 Ga0451793_0975326 3300041452 Bacteria 10175
377 Ga0451837_1331880 3300041494 Bacteria 1837
378 Ga0451841_1409615 3300041498 Bacteria 1002
379 Ga0439448_0025379 3300042005 Bacteria 1859
380 Ga0439448_0080885 3300042005 Bacteria 1091
381 Ga0439449_0005572 3300042007 Bacteria 4820
382 Ga0439463_026647 3300042016 Bacteria 1452
383 Ga0439459_0000115 3300042438 Bacteria 7629
384 Ga0451577_0016708 3300042876 Bacteria 6787
385 Ga0451577_0045810 3300042876 Bacteria 3914
386 Ga0466969_0167392 3300044656 Bacteria 1008
387 Ga0466972_0050630 3300044658 Bacteria 2004
388 Ga0466965_0008160 3300044683 Bacteria 4836
389 Ga0466966_0001209 3300044684 Bacteria 16563
390 Ga0466961_0005390 3300044693 Bacteria 8052
391 Ga0466961_0082381 3300044693 Bacteria 2035
392 Ga0466964_0006378 3300044706 Bacteria 4396
393 Ga0466971_0019652 3300044719 Bacteria 3001
394 Ga0466971_0023982 3300044719 Bacteria 2720
395 Ga0466968_0004187 3300044735 Bacteria 5376
396 Ga0466970_0012604 3300044765 Bacteria 4325
397 Ga0466957_0096346 3300044842 Bacteria 1859
398 Ga0466957_0242886 3300044842 Bacteria 1195
399 Ga0466959_0003364 3300045049 Bacteria 10451
400 Ga0466958_0006702 3300045836 Bacteria 6284
401 Ga0466967_0103052 3300045976 Bacteria 2611
402 Ga0466967_0526662 3300045976 Bacteria 1162
403 Ga0495617_000523 3300046452 Bacteria 19954
404 Ga0495638_0000180 3300046460 Bacteria 96716
405 Ga0495638_0001693 3300046460 Bacteria 19448
406 Ga0495638_0014890 3300046460 Bacteria 5240
407 Ga0495650_0000469 3300046471 Bacteria 62135
408 Ga0495650_0002069 3300046471 Bacteria 17390
409 Ga0495650_0007187 3300046471 Bacteria 6748
410 Ga0495585_0000437 3300046492 Bacteria 39894
411 Ga0495607_0000654 3300046501 Bacteria 33669
412 Ga0495607_0027278 3300046501 Bacteria 3533
413 Ga0495606_0002503 3300046507 Bacteria 21222
414 Ga0495606_0014630 3300046507 Bacteria 6105
415 Ga0495610_0002419 3300046512 Bacteria 15714
416 Ga0495610_0028688 3300046512 Bacteria 2939
417 Ga0495616_0000190 3300046513 Bacteria 51392
418 Ga0495620_0039922 3300046515 Bacteria 2070
419 Ga0495631_0196002 3300046518 Bacteria 864
420 Ga0495632_0000135 3300046519 Bacteria 75082
421 Ga0495632_0048840 3300046519 Bacteria 2093
422 Ga0495643_0083501 3300046522 Bacteria 1658
423 Ga0495648_0001900 3300046524 Bacteria 19949
424 Ga0495648_0058575 3300046524 Bacteria 2302
425 Ga0495663_0057458 3300046525 Bacteria 1217
426 Ga0495609_0048118 3300046538 Bacteria 1907
427 Ga0495597_0076485 3300046542 Bacteria 1436
428 Ga0495622_0004707 3300046557 Bacteria 6326
429 Ga0495633_0013300 3300046558 Bacteria 4341
430 Ga0495668_0002918 3300046616 Bacteria 13486
431 Ga0495611_0000004 3300046648 Bacteria 308149
432 Ga0495611_0001192 3300046648 Bacteria 13465
433 Ga0495625_0000617 3300046660 Bacteria 51659
434 Ga0495625_0007542 3300046660 Bacteria 9451
435 Ga0495625_0088749 3300046660 Bacteria 2141
436 Ga0495661_0001320 3300046665 Bacteria 21068
437 Ga0495671_0052533 3300046692 Bacteria 2025
438 Ga0495649_0050860 3300046694 Bacteria 2247
439 Ga0495589_0000555 3300046794 Bacteria 25768
440 Ga0495660_0000356 3300046810 Bacteria 40494
441 Ga0495660_0002959 3300046810 Bacteria 10627
442 Ga0495683_0001003 3300047323 Bacteria 19727
443 Ga0495679_000011 3300047446 Bacteria 324498
444 Ga0495673_0000036 3300047469 Bacteria 311035
445 Ga0495673_0000151 3300047469 Bacteria 122181
446 Ga0495686_0000126 3300047472 Bacteria 157350
447 Ga0496100_0161391 3300048903 Bacteria 1607
448 Ga0496101_0388529 3300048904 Bacteria 1098
449 Ga0496104_0022837 3300048907 Bacteria 5748
450 Ga0496104_0692958 3300048907 Bacteria 927
451 Ga0496104_0963788 3300048907 Bacteria 757
452 Ga0496105_0002564 3300048908 Bacteria 13194
453 Ga0496105_0474272 3300048908 Bacteria 985
454 Ga0496106_0010847 3300048909 Bacteria 6732
455 Ga0496106_0049427 3300048909 Bacteria 3168
456 Ga0496106_0192611 3300048909 Bacteria 1621
457 Ga0496107_0017259 3300048910 Bacteria 5076
458 Ga0496115_0000008 3300048918 Bacteria 237485
459 Ga0496115_0010402 3300048918 Bacteria 6949
460 Ga0496116_0003670 3300048919 Bacteria 15053
461 Ga0496118_0004467 3300048921 Bacteria 16586
462 Ga0496118_0006061 3300048921 Bacteria 13467
463 Ga0496118_0025116 3300048921 Bacteria 5120
464 Ga0496118_0030781 3300048921 Bacteria 4467
465 Ga0496118_0370434 3300048921 Bacteria 756
466 Ga0496119_0000218 3300048922 Bacteria 81458
467 Ga0496119_0011983 3300048922 Bacteria 7100
468 Ga0496119_0015104 3300048922 Bacteria 5976
469 Ga0496120_0001849 3300048923 Bacteria 23568
470 Ga0496120_0002027 3300048923 Bacteria 22032
471 Ga0496121_0001803 3300048924 Bacteria 34595
472 Ga0496121_0003410 3300048924 Bacteria 22722
473 Ga0496121_0003449 3300048924 Bacteria 22580
474 Ga0496121_0017512 3300048924 Bacteria 7311
475 Ga0496121_0022889 3300048924 Bacteria 6039
476 Ga0496121_0048827 3300048924 Bacteria 3596
477 Ga0496121_0264157 3300048924 Bacteria 1186
478 Ga0496122_0017062 3300048925 Bacteria 6815
479 Ga0496122_0019895 3300048925 Bacteria 6103
480 Ga0496122_0079922 3300048925 Bacteria 2283
481 Ga0496123_0001416 3300048926 Bacteria 33518
482 Ga0496123_0058936 3300048926 Bacteria 2486
483 Ga0496124_0001552 3300048927 Bacteria 33193
484 Ga0496125_0004471 3300048928 Bacteria 16112
485 Ga0496125_0019364 3300048928 Bacteria 6422
486 Ga0496125_0030941 3300048928 Bacteria 4778
487 Ga0496126_0003595 3300048929 Bacteria 19418
488 Ga0496126_0027285 3300048929 Bacteria 5457
489 Ga0496126_0096466 3300048929 Bacteria 2592
490 Ga0496126_0174466 3300048929 Bacteria 1829
491 Ga0496126_0280884 3300048929 Bacteria 1379
492 Ga0495678_000067 3300049459 Bacteria 132540
493 Ga0495682_0006722 3300049460 Bacteria 4641
494 Ga0495682_0018969 3300049460 Bacteria 2589
495 Ga0501032_0018354 3300049569 Bacteria 4902
496 Ga0501032_0130089 3300049569 Bacteria 1661
497 Ga0501033_0068344 3300049570 Bacteria 2612
498 Ga0501033_0209086 3300049570 Bacteria 1392
499 Ga0501034_0054713 3300049571 Bacteria 4017
500 Ga0501034_0060864 3300049571 Bacteria 3793
501 Ga0501034_0312304 3300049571 Bacteria 1506
502 Ga0501034_0447458 3300049571 Bacteria 1210
503 Ga0501034_0482129 3300049571 Bacteria 1155
504 Ga0501037_0247010 3300049573 Bacteria 1249
505 Ga0501037_0297889 3300049573 Bacteria 1120
506 Ga0501038_0041530 3300049574 Bacteria 4011
507 Ga0501038_0278809 3300049574 Bacteria 1316
508 Ga0501038_0279456 3300049574 Bacteria 1315
509 Ga0501039_0118596 3300049575 Bacteria 2073
510 Ga0501039_0229796 3300049575 Bacteria 1458
511 Ga0501042_0352399 3300049578 Bacteria 1065
512 Ga0501043_0026156 3300049579 Bacteria 4578
513 Ga0501043_0034199 3300049579 Bacteria 3998
514 Ga0501043_0134891 3300049579 Bacteria 1934
515 Ga0501043_0138220 3300049579 Bacteria 1908
516 Ga0501046_0042107 3300049580 Bacteria 3641
517 Ga0501046_0164767 3300049580 Bacteria 1665
518 Ga0501046_0372913 3300049580 Bacteria 1034
519 Ga0501047_0014077 3300049581 Bacteria 7601
520 Ga0501047_0223030 3300049581 Bacteria 1741
521 Ga0501047_0317443 3300049581 Bacteria 1398
522 Ga0501048_0357050 3300049582 Bacteria 1042
523 Ga0501068_0140443 3300049584 Bacteria 1514
524 Ga0501070_0346120 3300049586 Bacteria 1207
525 Ga0501070_0407885 3300049586 Bacteria 1098
526 Ga0501070_0526019 3300049586 Bacteria 948
527 Ga0501079_0112231 3300049741 Bacteria 2119
528 Ga0501080_0039836 3300049742 Bacteria 4384
529 Ga0501080_0455038 3300049742 Bacteria 1147
530 Ga0501083_0011507 3300049744 Bacteria 6208
531 Ga0501035_0024127 3300049822 Bacteria 5579
532 Ga0501035_0041977 3300049822 Bacteria 4127
533 Ga0501035_0138592 3300049822 Bacteria 2116
534 Ga0501035_0144016 3300049822 Bacteria 2071
535 Ga0501035_0335666 3300049822 Bacteria 1267
536 Ga0501035_0499321 3300049822 Bacteria 1001
537 Ga0501035_0645989 3300049822 Bacteria 858
538 Ga0501044_0052943 3300049823 Bacteria 4178
539 Ga0501044_0297497 3300049823 Bacteria 1543
540 Ga0501044_0403339 3300049823 Bacteria 1279
541 nmdc:mga00v17_153376_c1 3300050491 Bacteria 1481
542 nmdc:mga00v17_279684_c1 3300050491 Bacteria 1083
543 nmdc:mga00v17_321449_c1 3300050491 Unclassified 1005
544 nmdc:mga00v17_77606_c1 3300050491 Bacteria 2068
545 nmdc:mga0yw44_167476_c1 3300050492 Bacteria 1441
546 nmdc:mga05p37_5968_c1 3300050507 Bacteria 6163
547 nmdc:mga09592_5296_c1 3300050508 Bacteria 10483
548 nmdc:mga06r32_2458_c1 3300050510 Bacteria 16578
549 nmdc:mga08y16_1907_c1 3300050511 Bacteria 21252
550 nmdc:mga08y16_2683_c1 3300050511 Bacteria 18277
551 nmdc:mga0sz30_24728_c1 3300050516 Bacteria 2452
552 nmdc:mga0sz30_306048_c1 3300050516 Bacteria 709
553 Ga0500643_000012 3300053087 Bacteria 369839
554 Ga0500646_0089636 3300053090 Bacteria 950
555 Ga0500651_0003309 3300053093 Bacteria 8779
556 Ga0500555_002193 3300053103 Bacteria 5709
557 Ga0500559_0276158 3300053136 Bacteria 790
558 Ga0500636_0000164 3300053177 Bacteria 34785
559 Ga0500637_0187715 3300053178 Bacteria 1182
560 Ga0500625_016497 3300053729 Bacteria 3441
561 Ga0501082_0040078 3300060353 Bacteria 4041
562 Ga0501082_0165667 3300060353 Bacteria 1921
563 Ga0466962_0000988 3300061719 Bacteria 12968
564 Ga0466962_0001385 3300061719 Bacteria 11253
565 2595447752 2593339238 Bacteria 4182970
566 2595451044 2593339239 Bacteria 4124669
567 2643897017 2643221577 Bacteria 3710843
568 2687581722 2687453130 Bacteria 4227172
569 2721029007 2718218334 Bacteria 4765486
570 2739227389 2738543009 Bacteria 4944499
571 2739733999 2739367700 Bacteria 4747630
572 2819565843 2818991440 Bacteria 4774720
573 2842921934 2842918807 Bacteria 4289178
574 2852652119 2852649853 Bacteria 4036942
575 2874223202 2874220319 Bacteria 4594709
576 2884415401 2884411467 Bacteria 5246714
577 2895395809 2895395659 Bacteria 3983269
578 2904467307 2904463128 Bacteria 4775606
579 2919093237 2919089067 Bacteria 4560942
580 2919407925 2919404418 Bacteria 4232372
581 2919517141 2919513703 Bacteria 3844312
582 2919677596 2919675420 Bacteria 3969095
583 2919691953 2919688452 Bacteria 4595932
584 2928499868 2928496128 Bacteria 4631123
585 2928966154 2928963466 Bacteria 5165703
586 2931383361 2931380184 Bacteria 4455911
587 2937614334 2937610967 Bacteria 4618818
588 2939614071 2939611941 Bacteria 3892017
589 2939630924 2939626828 Bacteria 4695272
590 2941478742 2941475908 Bacteria 4145589
591 2953997026 2953994433 Bacteria 4303959
592 2961049966 2961047084 Bacteria 4594415
593 Ga0070659_100011336
594 JGI24739J22299_10000877
595 JGI24739J22299_10009549
596 JGI24737J22298_10009825
597 JGI24737J22298_10060286
598 JGI24735J21928_10000330
599 JGI24735J21928_10006866
600 JGI25156J39149_1002101
601 JGI25156J39149_1005166
602 JGI25162J39368_1001076
603 JGI25162J39368_1001198
604 JGI25162J39368_1001629
605 JGI25162J39368_1005057
606 JGI25162J39368_1005129
607 JGI25157J39369_1000967
608 JGI25157J39369_1001225
609 JGI25157J39369_1001443
610 JGI25157J39369_1001525
611 JGI25163J39215_1000307
612 JGI25164J39214_1000055
613 JGI25164J39214_1000333
614 JGI25164J39214_1002561
615 JGI25152J39213_1000103
616 JGI25152J39213_1022601
617 JGI25150J39212_1000183
618 JGI25151J46595_10000271
619 JGI25165J46597_1000161
620 JGI25165J46597_1000213
621 JGI25165J46597_1004821
622 JGI25165J46597_1004918
623 JGI25153J46596_10000190
624 JGI25153J46596_10013250
625 rootH2_10010505
626 Ga0006562J51391_1039069
627 Ga0006562J51391_1039071
628 Ga0006562J51391_1129535
629 Ga0006562J51391_1129537
630 Ga0055538_1006065
631 Ga0055527_1003885
632 Ga0055527_1009028
633 Ga0055527_1011792
634 Ga0055535_1001153
635 Ga0055535_1001171
636 Ga0055535_1001789
637 Ga0055535_1004503
638 Ga0055535_1021973
639 Ga0055542_1001079
640 Ga0055542_1001167
641 Ga0055542_1001346
642 Ga0055542_1001386
643 Ga0055529_1000196
644 Ga0055529_1000768
645 Ga0055529_1005457
646 Ga0065165_1002248
647 Ga0070658_10007622
648 Ga0070658_10061938
649 Ga0070658_10249206
650 Ga0070658_10316617
651 Ga0070658_10404009
652 Ga0068869_100027267
653 Ga0070666_10000022
654 Ga0070680_100035663
655 Ga0070680_100353029
656 Ga0070682_100000806
657 Ga0070682_100002014
658 Ga0070689_100003352
659 Ga0070661_100004407
660 Ga0070661_100015590
661 Ga0070661_100029315
662 Ga0070661_100116631
663 Ga0070692_10080198
664 Ga0070668_100004046
665 Ga0070688_100035669
666 Ga0070659_100018023
667 Ga0070659_100299622
668 Ga0070659_100350507
669 Ga0070714_100000180
670 Ga0070714_100002914
671 Ga0070713_100003831
672 Ga0070710_10140263
673 Ga0070694_100060302
674 Ga0070663_100036660
675 Ga0070663_100128046
676 Ga0070663_100292889
677 Ga0070678_100013902
678 Ga0070681_10053688
679 Ga0070679_100026284
680 Ga0070679_100054077
681 Ga0070679_100168247
682 Ga0070679_100193247
683 Ga0070679_100390193
684 Ga0068853_100000720
685 Ga0068853_100099017
686 Ga0070696_100001266
687 Ga0070696_100067131
688 Ga0070696_100135599
689 Ga0070693_100003356
690 Ga0070665_100010878
691 Ga0068855_100036076
692 Ga0068855_100192682
693 Ga0068857_100005031
694 Ga0068857_100135134
695 Ga0068854_100542156
696 Ga0068856_100000086
697 Ga0068856_100093388
698 Ga0068852_100014146
699 Ga0068852_100030349
700 Ga0068859_100027472
701 Ga0068864_100918760
702 Ga0068851_10052768
703 Ga0068863_100024540
704 Ga0068858_100256898
705 Ga0068858_100649259
706 Ga0068860_100018156
707 Ga0068862_100093017
708 Ga0075364_10133406
709 Ga0075364_10335848
710 Ga0075369_10010563
711 Ga0097621_100154539
712 Ga0075431_100004170
713 Ga0075429_100008129
714 Ga0068865_100521957
715 Ga0097620_100027472
716 Ga0105244_10162289
717 Ga0105240_10015130
718 Ga0105240_10064044
719 Ga0111539_10004789
720 Ga0111539_10039397
721 Ga0111539_10523121
722 Ga0105247_10002001
723 Ga0105237_10000070
724 Ga0105237_10000134
725 Ga0105237_10124846
726 Ga0105238_10000175
727 Ga0105238_10009039
728 Ga0105238_10041838
729 Ga0105238_10070552
730 Ga0105238_10071154
731 Ga0105238_10937211
732 Ga0105239_10001034
733 Ga0105239_10197697
734 Ga0157373_10009800
735 Ga0157373_10032380
736 Ga0157373_10193348
737 Ga0157373_10207275
738 Ga0157373_10245423
739 Ga0157371_10000243
740 Ga0157371_10002303
741 Ga0157371_10010395
742 Ga0157371_10388022
743 Ga0157370_10001260
744 Ga0157370_10010380
745 Ga0157370_10014883
746 Ga0157370_10044732
747 Ga0157370_10063691
748 Ga0157370_10131797
749 Ga0157370_10132116
750 Ga0157370_10225069
751 Ga0157369_10009062
752 Ga0157369_10011965
753 Ga0157369_10147375
754 Ga0157369_10167155
755 Ga0157374_10054774
756 Ga0157374_10532731
757 Ga0157378_10152547
758 Ga0157372_10007598
759 Ga0157372_10016909
760 Ga0157372_10028390
761 Ga0157372_10444809
762 Ga0157372_10450468
763 Ga0157380_10096186
764 Ga0182008_10008822
765 Ga0182008_10016470
766 Ga0182008_10056941
767 Ga0182008_10074321
768 Ga0182008_10224347
769 Ga0157376_10005164
770 Ga0157376_10033922
771 Ga0182006_1000426
772 Ga0182006_1017509
773 Ga0182007_10000079
774 Ga0182007_10010422
775 Ga0182007_10015088
776 Ga0182007_10044035
777 Ga0182005_1000166
778 Ga0182005_1000177
779 Ga0182005_1007680
780 Ga0183369_1003
781 Ga0183368_1003
782 Ga0163161_10013517
783 Ga0163161_10049215
784 Ga0206356_10858187
785 Ga0206349_1121353
786 Ga0206354_10991871
787 Ga0206353_10988314
788 Ga0213872_10002643
789 Ga0209435_105848
790 Ga0209760_100151
791 Ga0209784_100119
792 Ga0209674_100033
793 Ga0209674_100719
794 Ga0209674_100721
795 Ga0209672_100437
796 Ga0209672_101014
797 Ga0209672_102221
798 Ga0207427_100037
799 Ga0207427_100142
800 Ga0207427_100344
801 Ga0207427_100349
802 Ga0207427_104032
803 Ga0209437_100074
804 Ga0209437_100083
805 Ga0209437_100157
806 Ga0209437_100162
807 Ga0209437_100886
808 Ga0209437_101643
809 Ga0209258_100057
810 Ga0209258_100127
811 Ga0209258_100538
812 Ga0209258_103198
813 Ga0209646_1001148
814 Ga0209026_1000200
815 Ga0209026_1000237
816 Ga0209026_1000378
817 Ga0209026_1000603
818 Ga0209026_1003698
819 Ga0209148_1000005
820 Ga0209148_1000036
821 Ga0209148_1000068
822 Ga0209148_1000775
823 Ga0209148_1002174
824 Ga0209759_1000286
825 Ga0209759_1001277
826 Ga0209759_1001677
827 Ga0209759_1012457
828 Ga0209129_1000239
829 Ga0209129_1001622
830 Ga0209233_1000040
831 Ga0209233_1000075
832 Ga0209233_1000096
833 Ga0209233_1000998
834 Ga0209233_1008075
835 Ga0209455_1000040
836 Ga0209455_1000071
837 Ga0209455_1000151
838 Ga0209455_1005468
839 Ga0209455_1010429
840 Ga0209676_1000018
841 Ga0209676_1001983
842 Ga0209025_1000048
843 Ga0209758_1000056
844 Ga0209758_1000874
845 Ga0209758_1009524
846 Ga0209050_1000592
847 Ga0209051_1003638
848 Ga0209257_1000035
849 Ga0209257_1001448
850 Ga0207656_10032870
851 Ga0207655_1030214
852 Ga0207655_1132452
853 Ga0207710_10010072
854 Ga0207680_10000001
855 Ga0207647_10000188
856 Ga0207647_10000865
857 Ga0207647_10006553
858 Ga0207647_10047442
859 Ga0207705_10001049
860 Ga0207705_10027986
861 Ga0207705_10096042
862 Ga0207705_10259840
863 Ga0207695_10000997
864 Ga0207695_10005208
865 Ga0207695_10011198
866 Ga0207695_10025714
867 Ga0207671_10000037
868 Ga0207671_10001266
869 Ga0207660_10188374
870 Ga0207660_10307163
871 Ga0207657_10057772
872 Ga0207657_10101310
873 Ga0207657_10101900
874 Ga0207657_10275283
875 Ga0207649_10012167
876 Ga0207649_10047167
877 Ga0207652_10016667
878 Ga0207694_10000257
879 Ga0207694_10056309
880 Ga0207694_10307918
881 Ga0207700_10058673
882 Ga0207664_10000041
883 Ga0207664_10001637
884 Ga0207664_10028700
885 Ga0207664_10249820
886 Ga0207690_10000285
887 Ga0207690_10019109
888 Ga0207690_10024127
889 Ga0207690_10029598
890 Ga0207690_10138366
891 Ga0207706_10368470
892 Ga0207670_10022479
893 Ga0207704_10332922
894 Ga0207711_10118412
895 Ga0207689_10017785
896 Ga0207667_10000184
897 Ga0207667_10012090
898 Ga0207667_10013456
899 Ga0207667_10091604
900 Ga0207668_10019101
901 Ga0207668_10056198
902 Ga0207668_10080851
903 Ga0207640_10010677
904 Ga0207639_10003146
905 Ga0207639_10050886
906 Ga0207639_10165576
907 Ga0207639_10313944
908 Ga0207678_10014149
909 Ga0207678_10057051
910 Ga0207678_10154420
911 Ga0207678_10204508
912 Ga0207702_10000222
913 Ga0207702_10457402
914 Ga0207641_10045468
915 Ga0207648_10054097
916 Ga0207674_10008040
917 Ga0207674_10081355
918 Ga0207674_10299985
919 Ga0207683_10026617
920 Ga0210000_1032506
921 Ga0209999_1013189
922 Ga0209983_1001045
923 Ga0209974_10004142
924 Ga0207428_10076073
925 Ga0268266_10000091
926 Ga0268265_10055187
927 Ga0268264_10153509
928 Ga0265334_10000008
929 Ga0265338_10510223
930 Ga0265313_10000076
931 Ga0307508_10027818
932 Ga0316579_10002909
933 Ga0316576_10026686
934 Ga0316578_10002032
935 Ga0307516_10054539
936 Ga0316577_10002503
937 Ga0307412_10002394
938 Ga0307412_10054365
939 Ga0307412_10464174
940 Ga0307416_100024526
941 Ga0307414_10157937
942 Ga0307414_10164938
943 Ga0307414_10240271
944 Ga0307411_10410272
945 Ga0316583_10122034
946 Ga0316585_10002574
947 Ga0395899_0050873
948 Ga0395899_0086216
949 Ga0395899_0135215
950 Ga0395900_0000446
951 Ga0395900_0001441
952 Ga0395900_0079860
953 Ga0395900_0347995
954 Ga0395898_0000362
955 Ga0395898_0005272
956 Ga0395898_0013116
957 Ga0395898_0024694
958 Ga0395901_0001926
959 Ga0395901_0001974
960 Ga0395901_0086506
961 Ga0395901_0366403
962 Ga0400487_22015
963 Ga0436361_0547085
964 Ga0439436_0000009
965 Ga0439465_0001199
966 Ga0451787_336456
967 Ga0451793_0608163
968 Ga0451793_0975326
969 Ga0451837_1331880
970 Ga0451841_1409615
971 Ga0439448_0025379
972 Ga0439448_0080885
973 Ga0439449_0005572
974 Ga0439463_026647
975 Ga0439459_0000115
976 Ga0451577_0016708
977 Ga0451577_0045810
978 Ga0466969_0167392
979 Ga0466972_0050630
980 Ga0466965_0008160
981 Ga0466966_0001209
982 Ga0466961_0005390
983 Ga0466961_0082381
984 Ga0466964_0006378
985 Ga0466971_0019652
986 Ga0466971_0023982
987 Ga0466968_0004187
988 Ga0466970_0012604
989 Ga0466957_0096346
990 Ga0466957_0242886
991 Ga0466959_0003364
992 Ga0466958_0006702
993 Ga0466967_0103052
994 Ga0466967_0526662
995 Ga0495617_000523
996 Ga0495638_0000180
997 Ga0495638_0001693
998 Ga0495638_0014890
999 Ga0495650_0000469
1000 Ga0495650_0002069
1001 Ga0495650_0007187
1002 Ga0495585_0000437
1003 Ga0495607_0000654
1004 Ga0495607_0027278
1005 Ga0495606_0002503
1006 Ga0495606_0014630
1007 Ga0495610_0002419
1008 Ga0495610_0028688
1009 Ga0495616_0000190
1010 Ga0495620_0039922
1011 Ga0495631_0196002
1012 Ga0495632_0000135
1013 Ga0495632_0048840
1014 Ga0495643_0083501
1015 Ga0495648_0001900
1016 Ga0495648_0058575
1017 Ga0495663_0057458
1018 Ga0495609_0048118
1019 Ga0495597_0076485
1020 Ga0495622_0004707
1021 Ga0495633_0013300
1022 Ga0495668_0002918
1023 Ga0495611_0000004
1024 Ga0495611_0001192
1025 Ga0495625_0000617
1026 Ga0495625_0007542
1027 Ga0495625_0088749
1028 Ga0495661_0001320
1029 Ga0495671_0052533
1030 Ga0495649_0050860
1031 Ga0495589_0000555
1032 Ga0495660_0000356
1033 Ga0495660_0002959
1034 Ga0495683_0001003
1035 Ga0495679_000011
1036 Ga0495673_0000036
1037 Ga0495673_0000151
1038 Ga0495686_0000126
1039 Ga0496100_0161391
1040 Ga0496101_0388529
1041 Ga0496104_0022837
1042 Ga0496104_0692958
1043 Ga0496104_0963788
1044 Ga0496105_0002564
1045 Ga0496105_0474272
1046 Ga0496106_0010847
1047 Ga0496106_0049427
1048 Ga0496106_0192611
1049 Ga0496107_0017259
1050 Ga0496115_0000008
1051 Ga0496115_0010402
1052 Ga0496116_0003670
1053 Ga0496118_0004467
1054 Ga0496118_0006061
1055 Ga0496118_0025116
1056 Ga0496118_0030781
1057 Ga0496118_0370434
1058 Ga0496119_0000218
1059 Ga0496119_0011983
1060 Ga0496119_0015104
1061 Ga0496120_0001849
1062 Ga0496120_0002027
1063 Ga0496121_0001803
1064 Ga0496121_0003410
1065 Ga0496121_0003449
1066 Ga0496121_0017512
1067 Ga0496121_0022889
1068 Ga0496121_0048827
1069 Ga0496121_0264157
1070 Ga0496122_0017062
1071 Ga0496122_0019895
1072 Ga0496122_0079922
1073 Ga0496123_0001416
1074 Ga0496123_0058936
1075 Ga0496124_0001552
1076 Ga0496125_0004471
1077 Ga0496125_0019364
1078 Ga0496125_0030941
1079 Ga0496126_0003595
1080 Ga0496126_0027285
1081 Ga0496126_0096466
1082 Ga0496126_0174466
1083 Ga0496126_0280884
1084 Ga0495678_000067
1085 Ga0495682_0006722
1086 Ga0495682_0018969
1087 Ga0501032_0018354
1088 Ga0501032_0130089
1089 Ga0501033_0068344
1090 Ga0501033_0209086
1091 Ga0501034_0054713
1092 Ga0501034_0060864
1093 Ga0501034_0312304
1094 Ga0501034_0447458
1095 Ga0501034_0482129
1096 Ga0501037_0247010
1097 Ga0501037_0297889
1098 Ga0501038_0041530
1099 Ga0501038_0278809
1100 Ga0501038_0279456
1101 Ga0501039_0118596
1102 Ga0501039_0229796
1103 Ga0501042_0352399
1104 Ga0501043_0026156
1105 Ga0501043_0034199
1106 Ga0501043_0134891
1107 Ga0501043_0138220
1108 Ga0501046_0042107
1109 Ga0501046_0164767
1110 Ga0501046_0372913
1111 Ga0501047_0014077
1112 Ga0501047_0223030
1113 Ga0501047_0317443
1114 Ga0501048_0357050
1115 Ga0501068_0140443
1116 Ga0501070_0346120
1117 Ga0501070_0407885
1118 Ga0501070_0526019
1119 Ga0501079_0112231
1120 Ga0501080_0039836
1121 Ga0501080_0455038
1122 Ga0501083_0011507
1123 Ga0501035_0024127
1124 Ga0501035_0041977
1125 Ga0501035_0138592
1126 Ga0501035_0144016
1127 Ga0501035_0335666
1128 Ga0501035_0499321
1129 Ga0501035_0645989
1130 Ga0501044_0052943
1131 Ga0501044_0297497
1132 Ga0501044_0403339
1133 nmdc:mga00v17_153376_c1
1134 nmdc:mga00v17_279684_c1
1135 nmdc:mga00v17_321449_c1
1136 nmdc:mga00v17_77606_c1
1137 nmdc:mga0yw44_167476_c1
1138 nmdc:mga05p37_5968_c1
1139 nmdc:mga09592_5296_c1
1140 nmdc:mga06r32_2458_c1
1141 nmdc:mga08y16_1907_c1
1142 nmdc:mga08y16_2683_c1
1143 nmdc:mga0sz30_24728_c1
1144 nmdc:mga0sz30_306048_c1
1145 Ga0500643_000012
1146 Ga0500646_0089636
1147 Ga0500651_0003309
1148 Ga0500555_002193
1149 Ga0500559_0276158
1150 Ga0500636_0000164
1151 Ga0500637_0187715
1152 Ga0500625_016497
1153 Ga0501082_0040078
1154 Ga0501082_0165667
1155 Ga0466962_0000988
1156 Ga0466962_0001385
1157 2595447752
1158 2595451044
1159 2643897017
1160 2687581722
1161 2721029007
1162 2739227389
1163 2739733999
1164 2819565843
1165 2842921934
1166 2852652119
1167 2874223202
1168 2884415401
1169 2895395809
1170 2904467307
1171 2919093237
1172 2919407925
1173 2919517141
1174 2919677596
1175 2919691953
1176 2928499868
1177 2928966154
1178 2931383361
1179 2937614334
1180 2939614071
1181 2939630924
1182 2941478742
1183 2953997026
1184 2961049966

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21948

LplA-B_cat

Lipoyl protein ligase A/B catalytic domain

57

242

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.9271 3 202
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8794 3 206
2qhv-assembly1.cif.gz_A structural basis of octanoic acid recognition by lipoate-protein ligase b 0.8515 3 206
1w66-assembly1.cif.gz_A structure of a lipoate-protein ligase b from mycobacterium tuberculosis 0.8495 3 202
2c7i-assembly4.cif.gz_D structure of protein ta0514, putative lipoate protein ligase from t. acidophilum. 0.7951 1 209
ID Description Score Start End Superfamily
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9835 1 200 3.30.930.10
af_P60720_2_203_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9691 1 200 3.30.930.10
1w66A01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9271 3 202 3.30.930.10
af_Q9SXP7_6_215_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.9063 5 201 3.30.930.10
af_P0C7R2_45_252_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8921 3 193 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A534A8Q8-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 1 22 201 GO:0005737
GO:0033819
AF-A0A3B0VSD3-F1-model_v4 lipoyl(octanoyl) transferase (EC 2.3.1.181) 0.9963 3 91 GO:0033819
AF-A0A3D3D3L3-F1-model_v4 deleted 0.9958 6 82
AF-A0A1E4L021-F1-model_v4 deleted 0.9955 1 209
AF-A0A7S6SHU9-F1-model_v4 Octanoyltransferase (EC 2.3.1.181) (Lipoate-protein ligase B) (Lipoyl/octanoyl transferase) (Octanoyl-[acyl-carrier-protein]-protein N-octanoyltransferase) 0.995 3 201 GO:0005737
GO:0033819

Map