F467091
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 591 | 325 | 565 | 358 |
Family's Representative Sequence
| Representative Sequence | 3300050513|nmdc:mga0rr50_16629_c1|nmdc:mga0rr50_16629_c1_1248_2456 |
| Length | 402 |
| Sequence | LDKRLIAALKRRTETTPRRQTGGRDAMCRARLNAIRRVFSMKRREFLGAAGAGFTASVLAAPALAQSSPEIKWRCTSSFPKSLDTLYGAAEVFAKAVGEATDNRFQIQVFAAGEIVPGLQAADAVGNGTVEMAHTASYYYVGKDPTFAMATAQPFGLNSRMQSAWMHFGGGIDSFNEFYKKYNFLALPAGNTGCQMGGWFRKEIKQPEDLNGLKFRIAGFAGRILQKLGTVPQQLAGGDIYPALEKGTIDAAEWVGPYDDEKLGFQKVAQFYYYPGWWEGGAMLHNFINLEKWQALPKNYQAIIRSASEQAHTWMQAKYDAGNPAALKRLVANGAQLRPFPQPVLEACYKAATDTYGEISAASAEFKKIHDSIMAFRGDQYLWWQVAEYGFDNFMIRQRARG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 3 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 4 | 2547132512 | Azospira oryzae 6a3 | Isolate | Unclassified |
| 5 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 6 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 7 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 8 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 9 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 10 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 11 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 12 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 13 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 14 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 15 | 2897803580 | Azospirillum doebereinerae GSF71 | Isolate | Unclassified |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 18 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 69 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 158 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 176 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 177 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 178 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 182 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 191 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 207 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 208 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 209 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 261 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 262 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 263 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 292 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 293 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 296 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 315 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 316 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 317 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 318 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 319 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 321 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 324 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
| 325 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.12 |
| Metatranscriptomes | 0 |
| Isolates | 2.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.31 |
| Nodule | 1.35 |
| Rhizoplane | 0.85 |
| Rhizosphere | 84.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000638 | 3300001979 | Bacteria | 15126 |
| 2 | JGI25159J45721_1002032 | 3300002987 | Bacteria | 8005 |
| 3 | JGI25406J46586_10002392 | 3300003203 | Bacteria | 8870 |
| 4 | JGI25153J46596_10006619 | 3300003215 | Bacteria | 5835 |
| 5 | JGI25404J52841_10000386 | 3300003659 | Bacteria | 6065 |
| 6 | Ga0065165_1000218 | 3300005262 | Bacteria | 100161 |
| 7 | Ga0065704_10093776 | 3300005289 | Bacteria | 2579 |
| 8 | Ga0070658_10005001 | 3300005327 | Bacteria | 10795 |
| 9 | Ga0070658_10005554 | 3300005327 | Bacteria | 10230 |
| 10 | Ga0070658_10017407 | 3300005327 | Bacteria | 5750 |
| 11 | Ga0070658_10281067 | 3300005327 | Bacteria | 1417 |
| 12 | Ga0070666_10123734 | 3300005335 | Bacteria | 1794 |
| 13 | Ga0070680_100001108 | 3300005336 | Bacteria | 19337 |
| 14 | Ga0070680_100003405 | 3300005336 | Bacteria | 11876 |
| 15 | Ga0068868_100196902 | 3300005338 | Bacteria | 1678 |
| 16 | Ga0068868_100203183 | 3300005338 | Bacteria | 1653 |
| 17 | Ga0070660_100015257 | 3300005339 | Bacteria | 5543 |
| 18 | Ga0070660_100068474 | 3300005339 | Bacteria | 2767 |
| 19 | Ga0070689_100133228 | 3300005340 | Bacteria | 1994 |
| 20 | Ga0070689_100142701 | 3300005340 | Bacteria | 1927 |
| 21 | Ga0070691_10093064 | 3300005341 | Bacteria | 1488 |
| 22 | Ga0070668_100000766 | 3300005347 | Bacteria | 22083 |
| 23 | Ga0070668_100060258 | 3300005347 | Bacteria | 2939 |
| 24 | Ga0070675_100047938 | 3300005354 | Bacteria | 3502 |
| 25 | Ga0070675_100268608 | 3300005354 | Bacteria | 1496 |
| 26 | Ga0070675_100323947 | 3300005354 | Bacteria | 1362 |
| 27 | Ga0070688_100177535 | 3300005365 | Bacteria | 1475 |
| 28 | Ga0070667_100239869 | 3300005367 | Bacteria | 1618 |
| 29 | Ga0070709_10056242 | 3300005434 | Bacteria | 2487 |
| 30 | Ga0070709_10101581 | 3300005434 | Bacteria | 1917 |
| 31 | Ga0070709_10218905 | 3300005434 | Bacteria | 1357 |
| 32 | Ga0070714_100014985 | 3300005435 | Bacteria | 6232 |
| 33 | Ga0070714_100040203 | 3300005435 | Bacteria | 3941 |
| 34 | Ga0070714_100097401 | 3300005435 | Bacteria | 2586 |
| 35 | Ga0070713_100001555 | 3300005436 | Bacteria | 14678 |
| 36 | Ga0070713_100031411 | 3300005436 | Bacteria | 4230 |
| 37 | Ga0070710_10067082 | 3300005437 | Bacteria | 2058 |
| 38 | Ga0070711_100016017 | 3300005439 | Bacteria | 4752 |
| 39 | Ga0070711_100018729 | 3300005439 | Bacteria | 4427 |
| 40 | Ga0070711_100205342 | 3300005439 | Bacteria | 1523 |
| 41 | Ga0070663_100117437 | 3300005455 | Bacteria | 2006 |
| 42 | Ga0070662_100204957 | 3300005457 | Bacteria | 1567 |
| 43 | Ga0070681_10009265 | 3300005458 | Bacteria | 9680 |
| 44 | Ga0070681_10045176 | 3300005458 | Bacteria | 4408 |
| 45 | Ga0070681_10152140 | 3300005458 | Bacteria | 2240 |
| 46 | Ga0070699_100001182 | 3300005518 | Bacteria | 24181 |
| 47 | Ga0070679_100047946 | 3300005530 | Bacteria | 4257 |
| 48 | Ga0070679_100067237 | 3300005530 | Bacteria | 3574 |
| 49 | Ga0070679_100153515 | 3300005530 | Bacteria | 2278 |
| 50 | Ga0068853_100066065 | 3300005539 | Bacteria | 3140 |
| 51 | Ga0070695_100125940 | 3300005545 | Bacteria | 1759 |
| 52 | Ga0070696_100047064 | 3300005546 | Bacteria | 2992 |
| 53 | Ga0070665_100016716 | 3300005548 | Bacteria | 7353 |
| 54 | Ga0070665_100146937 | 3300005548 | Bacteria | 2360 |
| 55 | Ga0068855_100011086 | 3300005563 | Bacteria | 10877 |
| 56 | Ga0068855_100021711 | 3300005563 | Bacteria | 7698 |
| 57 | Ga0068855_100030635 | 3300005563 | Bacteria | 6432 |
| 58 | Ga0068855_100062035 | 3300005563 | Bacteria | 4365 |
| 59 | Ga0070664_100214447 | 3300005564 | Bacteria | 1721 |
| 60 | Ga0068857_100044064 | 3300005577 | Bacteria | 3957 |
| 61 | Ga0068857_100166180 | 3300005577 | Bacteria | 2004 |
| 62 | Ga0068854_100005953 | 3300005578 | Bacteria | 7725 |
| 63 | Ga0068854_100021941 | 3300005578 | Bacteria | 4340 |
| 64 | Ga0068856_100111390 | 3300005614 | Bacteria | 2734 |
| 65 | Ga0068856_100240808 | 3300005614 | Bacteria | 1824 |
| 66 | Ga0068852_100275492 | 3300005616 | Bacteria | 1620 |
| 67 | Ga0068851_10002111 | 3300005834 | Bacteria | 8743 |
| 68 | Ga0068858_100238476 | 3300005842 | Bacteria | 1725 |
| 69 | Ga0068860_100006084 | 3300005843 | Bacteria | 12143 |
| 70 | Ga0068860_100104011 | 3300005843 | Bacteria | 2711 |
| 71 | Ga0068860_100185815 | 3300005843 | Bacteria | 2010 |
| 72 | Ga0081455_10001801 | 3300005937 | Bacteria | 25856 |
| 73 | Ga0081455_10003377 | 3300005937 | Bacteria | 18403 |
| 74 | Ga0081455_10029006 | 3300005937 | Bacteria | 5049 |
| 75 | Ga0081455_10045312 | 3300005937 | Bacteria | 3828 |
| 76 | Ga0081538_10034440 | 3300005981 | Bacteria | 3348 |
| 77 | Ga0081540_1000008 | 3300005983 | Bacteria | 203702 |
| 78 | Ga0081540_1001504 | 3300005983 | Bacteria | 20051 |
| 79 | Ga0081539_10000101 | 3300005985 | Bacteria | 198612 |
| 80 | Ga0081539_10003832 | 3300005985 | Bacteria | 17662 |
| 81 | Ga0075365_10016973 | 3300006038 | Bacteria | 4445 |
| 82 | Ga0075368_10016573 | 3300006042 | Bacteria | 2747 |
| 83 | Ga0075363_100004780 | 3300006048 | Bacteria | 5970 |
| 84 | Ga0070715_10007530 | 3300006163 | Bacteria | 3752 |
| 85 | Ga0070712_100224077 | 3300006175 | Bacteria | 1490 |
| 86 | Ga0075362_10006572 | 3300006177 | Bacteria | 4341 |
| 87 | Ga0075362_10011334 | 3300006177 | Bacteria | 3510 |
| 88 | Ga0075362_10019885 | 3300006177 | Bacteria | 2799 |
| 89 | Ga0075362_10058980 | 3300006177 | Bacteria | 1732 |
| 90 | Ga0075367_10030264 | 3300006178 | Bacteria | 3102 |
| 91 | Ga0075367_10095334 | 3300006178 | Bacteria | 1815 |
| 92 | Ga0075369_10001445 | 3300006186 | Bacteria | 8107 |
| 93 | Ga0075369_10013806 | 3300006186 | Bacteria | 3214 |
| 94 | Ga0075369_10022060 | 3300006186 | Bacteria | 2624 |
| 95 | Ga0075369_10022961 | 3300006186 | Bacteria | 2576 |
| 96 | Ga0075366_10000552 | 3300006195 | Bacteria | 17460 |
| 97 | Ga0075366_10081187 | 3300006195 | Bacteria | 1937 |
| 98 | Ga0097621_100019769 | 3300006237 | Bacteria | 5178 |
| 99 | Ga0075370_10019433 | 3300006353 | Bacteria | 3700 |
| 100 | Ga0075370_10028419 | 3300006353 | Bacteria | 3109 |
| 101 | Ga0075370_10043877 | 3300006353 | Bacteria | 2528 |
| 102 | Ga0075428_100001096 | 3300006844 | Bacteria | 28836 |
| 103 | Ga0075428_100229121 | 3300006844 | Bacteria | 2005 |
| 104 | Ga0075428_100529850 | 3300006844 | Bacteria | 1260 |
| 105 | Ga0075430_100021252 | 3300006846 | Bacteria | 5518 |
| 106 | Ga0075431_100002284 | 3300006847 | Bacteria | 18392 |
| 107 | Ga0075433_10003438 | 3300006852 | Bacteria | 12216 |
| 108 | Ga0075433_10050303 | 3300006852 | Bacteria | 3627 |
| 109 | Ga0075433_10182893 | 3300006852 | Bacteria | 1865 |
| 110 | Ga0075434_100000268 | 3300006871 | Bacteria | 37082 |
| 111 | Ga0075434_100144742 | 3300006871 | Bacteria | 2397 |
| 112 | Ga0075434_100171033 | 3300006871 | Bacteria | 2193 |
| 113 | Ga0075429_100026528 | 3300006880 | Bacteria | 5032 |
| 114 | Ga0075429_100276051 | 3300006880 | Bacteria | 1472 |
| 115 | Ga0068865_100075257 | 3300006881 | Bacteria | 2407 |
| 116 | Ga0075436_100113703 | 3300006914 | Bacteria | 1890 |
| 117 | Ga0075435_100014848 | 3300007076 | Bacteria | 5840 |
| 118 | Ga0075435_100109420 | 3300007076 | Bacteria | 2297 |
| 119 | Ga0099794_10013479 | 3300007265 | Bacteria | 3559 |
| 120 | Ga0099794_10052267 | 3300007265 | Bacteria | 1969 |
| 121 | Ga0099795_10018985 | 3300007788 | Bacteria | 2218 |
| 122 | Ga0099795_10026446 | 3300007788 | Bacteria | 1955 |
| 123 | Ga0105240_10004293 | 3300009093 | Bacteria | 21772 |
| 124 | Ga0105240_10014218 | 3300009093 | Bacteria | 10871 |
| 125 | Ga0105240_10082544 | 3300009093 | Bacteria | 3947 |
| 126 | Ga0111539_10000835 | 3300009094 | Bacteria | 40036 |
| 127 | Ga0111539_10012926 | 3300009094 | Bacteria | 10447 |
| 128 | Ga0114129_10003226 | 3300009147 | Bacteria | 22877 |
| 129 | Ga0114129_10005100 | 3300009147 | Bacteria | 18497 |
| 130 | Ga0114129_10167375 | 3300009147 | Bacteria | 2998 |
| 131 | Ga0105241_10007599 | 3300009174 | Bacteria | 7969 |
| 132 | Ga0105242_10003626 | 3300009176 | Bacteria | 12016 |
| 133 | Ga0105242_10123007 | 3300009176 | Bacteria | 2230 |
| 134 | Ga0105248_10004953 | 3300009177 | Bacteria | 14715 |
| 135 | Ga0105237_10046872 | 3300009545 | Bacteria | 4346 |
| 136 | Ga0105237_10063677 | 3300009545 | Bacteria | 3686 |
| 137 | Ga0105238_10006897 | 3300009551 | Bacteria | 11342 |
| 138 | Ga0105238_10012634 | 3300009551 | Bacteria | 8523 |
| 139 | Ga0105238_10041790 | 3300009551 | Bacteria | 4643 |
| 140 | Ga0105238_10099672 | 3300009551 | Bacteria | 2888 |
| 141 | Ga0105249_10001094 | 3300009553 | Bacteria | 24097 |
| 142 | Ga0099796_10017643 | 3300010159 | Bacteria | 2129 |
| 143 | Ga0105239_10008003 | 3300010375 | Bacteria | 12065 |
| 144 | Ga0157373_10073590 | 3300013100 | Bacteria | 2411 |
| 145 | Ga0157370_10030206 | 3300013104 | Bacteria | 5312 |
| 146 | Ga0157369_10085056 | 3300013105 | Bacteria | 3380 |
| 147 | Ga0157369_10111880 | 3300013105 | Bacteria | 2902 |
| 148 | Ga0157369_10181167 | 3300013105 | Bacteria | 2216 |
| 149 | Ga0157374_10051238 | 3300013296 | Bacteria | 3840 |
| 150 | Ga0163162_10169417 | 3300013306 | Bacteria | 2308 |
| 151 | Ga0157375_10047413 | 3300013308 | Bacteria | 4196 |
| 152 | Ga0157380_10072980 | 3300014326 | Bacteria | 2781 |
| 153 | Ga0157380_10119753 | 3300014326 | Bacteria | 2227 |
| 154 | Ga0157380_10247031 | 3300014326 | Bacteria | 1613 |
| 155 | Ga0182008_10047960 | 3300014497 | Bacteria | 2122 |
| 156 | Ga0157379_10244174 | 3300014968 | Bacteria | 1629 |
| 157 | Ga0157376_10009491 | 3300014969 | Bacteria | 7068 |
| 158 | Ga0157376_10131508 | 3300014969 | Bacteria | 2234 |
| 159 | Ga0157376_10348882 | 3300014969 | Bacteria | 1416 |
| 160 | Ga0163161_10164275 | 3300017792 | Bacteria | 1694 |
| 161 | Ga0213874_10050651 | 3300021377 | Bacteria | 1273 |
| 162 | Ga0213876_10050181 | 3300021384 | Bacteria | 2204 |
| 163 | Ga0209130_1000632 | 3300025284 | Bacteria | 33065 |
| 164 | Ga0209025_1001538 | 3300025294 | Bacteria | 29419 |
| 165 | Ga0209758_1000063 | 3300025297 | Bacteria | 315999 |
| 166 | Ga0207426_1003065 | 3300025302 | Bacteria | 9614 |
| 167 | Ga0207692_10101611 | 3300025898 | Bacteria | 1579 |
| 168 | Ga0207680_10053481 | 3300025903 | Bacteria | 2424 |
| 169 | Ga0207699_10102097 | 3300025906 | Bacteria | 1822 |
| 170 | Ga0207699_10137891 | 3300025906 | Bacteria | 1600 |
| 171 | Ga0207699_10143742 | 3300025906 | Bacteria | 1570 |
| 172 | Ga0207705_10042643 | 3300025909 | Bacteria | 3258 |
| 173 | Ga0207654_10000163 | 3300025911 | Bacteria | 42749 |
| 174 | Ga0207707_10010597 | 3300025912 | Bacteria | 8006 |
| 175 | Ga0207707_10029619 | 3300025912 | Bacteria | 4786 |
| 176 | Ga0207707_10127850 | 3300025912 | Bacteria | 2222 |
| 177 | Ga0207695_10001114 | 3300025913 | Bacteria | 46680 |
| 178 | Ga0207695_10300011 | 3300025913 | Bacteria | 1498 |
| 179 | Ga0207695_10339153 | 3300025913 | Bacteria | 1391 |
| 180 | Ga0207693_10034982 | 3300025915 | Bacteria | 3962 |
| 181 | Ga0207693_10059148 | 3300025915 | Bacteria | 3002 |
| 182 | Ga0207693_10178799 | 3300025915 | Bacteria | 1669 |
| 183 | Ga0207663_10016595 | 3300025916 | Bacteria | 4087 |
| 184 | Ga0207660_10024491 | 3300025917 | Bacteria | 4087 |
| 185 | Ga0207660_10066810 | 3300025917 | Bacteria | 2602 |
| 186 | Ga0207657_10023148 | 3300025919 | Bacteria | 5791 |
| 187 | Ga0207657_10027346 | 3300025919 | Bacteria | 5225 |
| 188 | Ga0207657_10079605 | 3300025919 | Bacteria | 2757 |
| 189 | Ga0207652_10022043 | 3300025921 | Bacteria | 5264 |
| 190 | Ga0207652_10046882 | 3300025921 | Bacteria | 3690 |
| 191 | Ga0207681_10103054 | 3300025923 | Bacteria | 2062 |
| 192 | Ga0207694_10000050 | 3300025924 | Bacteria | 159920 |
| 193 | Ga0207694_10069194 | 3300025924 | Bacteria | 2758 |
| 194 | Ga0207694_10097536 | 3300025924 | Bacteria | 2326 |
| 195 | Ga0207694_10127730 | 3300025924 | Bacteria | 2035 |
| 196 | Ga0207659_10070668 | 3300025926 | Bacteria | 2546 |
| 197 | Ga0207659_10241067 | 3300025926 | Bacteria | 1463 |
| 198 | Ga0207659_10280621 | 3300025926 | Bacteria | 1362 |
| 199 | Ga0207700_10015855 | 3300025928 | Bacteria | 4986 |
| 200 | Ga0207664_10305043 | 3300025929 | Bacteria | 1401 |
| 201 | Ga0207644_10083365 | 3300025931 | Bacteria | 2367 |
| 202 | Ga0207706_10108662 | 3300025933 | Bacteria | 2441 |
| 203 | Ga0207686_10004471 | 3300025934 | Bacteria | 7490 |
| 204 | Ga0207670_10020124 | 3300025936 | Bacteria | 4093 |
| 205 | Ga0207670_10045131 | 3300025936 | Bacteria | 2920 |
| 206 | Ga0207665_10047708 | 3300025939 | Bacteria | 2872 |
| 207 | Ga0207691_10278867 | 3300025940 | Bacteria | 1438 |
| 208 | Ga0207661_10071720 | 3300025944 | Bacteria | 2832 |
| 209 | Ga0207667_10011990 | 3300025949 | Bacteria | 10034 |
| 210 | Ga0207667_10017786 | 3300025949 | Bacteria | 7994 |
| 211 | Ga0207667_10040449 | 3300025949 | Bacteria | 4964 |
| 212 | Ga0207667_10091586 | 3300025949 | Bacteria | 3140 |
| 213 | Ga0207651_10031281 | 3300025960 | Bacteria | 3400 |
| 214 | Ga0207640_10004789 | 3300025981 | Bacteria | 7349 |
| 215 | Ga0207640_10072100 | 3300025981 | Bacteria | 2329 |
| 216 | Ga0207658_10304935 | 3300025986 | Bacteria | 1373 |
| 217 | Ga0207639_10148927 | 3300026041 | Bacteria | 1958 |
| 218 | Ga0207702_10000002 | 3300026078 | Bacteria | 491507 |
| 219 | Ga0207702_10042471 | 3300026078 | Bacteria | 3814 |
| 220 | Ga0207702_10302256 | 3300026078 | Bacteria | 1519 |
| 221 | Ga0207641_10316481 | 3300026088 | Bacteria | 1479 |
| 222 | Ga0207648_10126938 | 3300026089 | Bacteria | 2244 |
| 223 | Ga0207674_10002309 | 3300026116 | Bacteria | 24153 |
| 224 | Ga0207675_100104321 | 3300026118 | Bacteria | 2672 |
| 225 | Ga0207683_10179708 | 3300026121 | Bacteria | 1918 |
| 226 | Ga0207698_10068293 | 3300026142 | Bacteria | 2806 |
| 227 | Ga0209179_1000633 | 3300027512 | Bacteria | 3733 |
| 228 | Ga0209588_1026970 | 3300027671 | Bacteria | 1826 |
| 229 | Ga0207428_10015926 | 3300027907 | Bacteria | 6484 |
| 230 | Ga0207428_10160081 | 3300027907 | Bacteria | 1710 |
| 231 | Ga0268266_10020714 | 3300028379 | Bacteria | 5605 |
| 232 | Ga0268266_10094291 | 3300028379 | Bacteria | 2627 |
| 233 | Ga0268264_10007444 | 3300028381 | Bacteria | 9137 |
| 234 | Ga0265334_10027700 | 3300028573 | Bacteria | 2281 |
| 235 | Ga0307515_10078976 | 3300028794 | Bacteria | 4318 |
| 236 | Ga0265338_10063587 | 3300028800 | Bacteria | 3216 |
| 237 | Ga0265330_10020797 | 3300031235 | Bacteria | 2998 |
| 238 | Ga0265330_10044970 | 3300031235 | Bacteria | 1948 |
| 239 | Ga0265332_10000024 | 3300031238 | Bacteria | 209663 |
| 240 | Ga0265320_10095073 | 3300031240 | Bacteria | 1377 |
| 241 | Ga0265325_10000039 | 3300031241 | Bacteria | 93014 |
| 242 | Ga0265325_10045215 | 3300031241 | Bacteria | 2289 |
| 243 | Ga0265340_10001019 | 3300031247 | Bacteria | 15981 |
| 244 | Ga0265340_10061622 | 3300031247 | Bacteria | 1794 |
| 245 | Ga0265339_10036439 | 3300031249 | Bacteria | 2753 |
| 246 | Ga0265331_10045951 | 3300031250 | Bacteria | 2107 |
| 247 | Ga0307513_10031402 | 3300031456 | Bacteria | 6016 |
| 248 | Ga0307408_100049715 | 3300031548 | Bacteria | 3012 |
| 249 | Ga0265313_10000522 | 3300031595 | Bacteria | 40272 |
| 250 | Ga0265313_10001740 | 3300031595 | Bacteria | 20008 |
| 251 | Ga0265313_10006264 | 3300031595 | Bacteria | 8479 |
| 252 | Ga0265314_10027454 | 3300031711 | Bacteria | 4262 |
| 253 | Ga0265342_10000866 | 3300031712 | Bacteria | 30217 |
| 254 | Ga0265342_10009117 | 3300031712 | Bacteria | 7029 |
| 255 | Ga0265342_10009921 | 3300031712 | Bacteria | 6659 |
| 256 | Ga0307405_10003576 | 3300031731 | Bacteria | 7177 |
| 257 | Ga0307413_10028287 | 3300031824 | Bacteria | 3120 |
| 258 | Ga0307410_10005404 | 3300031852 | Bacteria | 6757 |
| 259 | Ga0307406_10001441 | 3300031901 | Bacteria | 13157 |
| 260 | Ga0307406_10102174 | 3300031901 | Bacteria | 1955 |
| 261 | Ga0307412_10012673 | 3300031911 | Bacteria | 4920 |
| 262 | Ga0307409_100354081 | 3300031995 | Bacteria | 1386 |
| 263 | Ga0307416_100042136 | 3300032002 | Bacteria | 3561 |
| 264 | Ga0307416_100096228 | 3300032002 | Bacteria | 2559 |
| 265 | Ga0307416_100457163 | 3300032002 | Bacteria | 1331 |
| 266 | Ga0307414_10015498 | 3300032004 | Bacteria | 4601 |
| 267 | Ga0307414_10238809 | 3300032004 | Bacteria | 1503 |
| 268 | Ga0307415_100046549 | 3300032126 | Bacteria | 2914 |
| 269 | Ga0307415_100138643 | 3300032126 | Bacteria | 1854 |
| 270 | Ga0373958_0007352 | 3300034819 | Bacteria | 1752 |
| 271 | Ga0373938_0011460 | 3300034957 | Bacteria | 1649 |
| 272 | Ga0373934_0000181 | 3300035086 | Bacteria | 23031 |
| 273 | Ga0373934_0007531 | 3300035086 | Bacteria | 4041 |
| 274 | Ga0373923_0096086 | 3300035111 | Bacteria | 1301 |
| 275 | Ga0373932_0005780 | 3300035112 | Bacteria | 2913 |
| 276 | Ga0373936_0005520 | 3300035113 | Bacteria | 4772 |
| 277 | Ga0373945_0009031 | 3300035116 | Bacteria | 3257 |
| 278 | Ga0373945_0047533 | 3300035116 | Bacteria | 1570 |
| 279 | Ga0373954_0000484 | 3300035118 | Bacteria | 14925 |
| 280 | Ga0373954_0001302 | 3300035118 | Bacteria | 10041 |
| 281 | Ga0373954_0006497 | 3300035118 | Bacteria | 5099 |
| 282 | Ga0373954_0126137 | 3300035118 | Bacteria | 1244 |
| 283 | Ga0373956_0000230 | 3300035119 | Bacteria | 22178 |
| 284 | Ga0373957_0005517 | 3300035120 | Bacteria | 3923 |
| 285 | Ga0373957_0018188 | 3300035120 | Bacteria | 2457 |
| 286 | Ga0373943_0003579 | 3300035170 | Bacteria | 7068 |
| 287 | Ga0373943_0042792 | 3300035170 | Bacteria | 2196 |
| 288 | Ga0373946_0005136 | 3300035171 | Bacteria | 4718 |
| 289 | Ga0373955_0000983 | 3300035172 | Bacteria | 12101 |
| 290 | Ga0373955_0013434 | 3300035172 | Bacteria | 3962 |
| 291 | Ga0373961_0011600 | 3300035241 | Bacteria | 2189 |
| 292 | Ga0373962_0006082 | 3300035242 | Bacteria | 2918 |
| 293 | Ga0373924_0000772 | 3300035410 | Bacteria | 9945 |
| 294 | Ga0373931_0000995 | 3300035691 | Bacteria | 11966 |
| 295 | Ga0373931_0063275 | 3300035691 | Bacteria | 1999 |
| 296 | Ga0373935_0000013 | 3300035692 | Bacteria | 78986 |
| 297 | Ga0373935_0057427 | 3300035692 | Bacteria | 2483 |
| 298 | Ga0373935_0066943 | 3300035692 | Bacteria | 2308 |
| 299 | Ga0373927_0052552 | 3300035695 | Bacteria | 2636 |
| 300 | Ga0373927_0221991 | 3300035695 | Bacteria | 1241 |
| 301 | Ga0373933_0000550 | 3300035724 | Bacteria | 23385 |
| 302 | Ga0373933_0001422 | 3300035724 | Bacteria | 14036 |
| 303 | Ga0373947_0002476 | 3300035725 | Bacteria | 11109 |
| 304 | Ga0373947_0085047 | 3300035725 | Bacteria | 1964 |
| 305 | Ga0373947_0216430 | 3300035725 | Bacteria | 1258 |
| 306 | Ga0373947_0247881 | 3300035725 | Bacteria | 1177 |
| 307 | Ga0373937_0000018 | 3300036401 | Bacteria | 144056 |
| 308 | Ga0373937_0001239 | 3300036401 | Bacteria | 21457 |
| 309 | Ga0373925_0000896 | 3300037068 | Bacteria | 27189 |
| 310 | Ga0373925_0119643 | 3300037068 | Bacteria | 2043 |
| 311 | Ga0395899_0005212 | 3300037312 | Bacteria | 10109 |
| 312 | Ga0395899_0064694 | 3300037312 | Bacteria | 2688 |
| 313 | Ga0395900_0009382 | 3300037418 | Bacteria | 10032 |
| 314 | Ga0395900_0057991 | 3300037418 | Bacteria | 3986 |
| 315 | Ga0395898_0060800 | 3300037466 | Bacteria | 3670 |
| 316 | Ga0395898_0078361 | 3300037466 | Bacteria | 3188 |
| 317 | Ga0436364_0908210 | 3300037853 | Bacteria | 3290 |
| 318 | Ga0436364_1137908 | 3300037853 | Bacteria | 3127 |
| 319 | Ga0395901_0034031 | 3300038443 | Bacteria | 5261 |
| 320 | Ga0395901_0075344 | 3300038443 | Bacteria | 3520 |
| 321 | Ga0395901_0120069 | 3300038443 | Bacteria | 2762 |
| 322 | Ga0395901_0201832 | 3300038443 | Bacteria | 2084 |
| 323 | Ga0395901_0701831 | 3300038443 | Bacteria | 1009 |
| 324 | Ga0237819_05544 | 3300038705 | Bacteria | 1969 |
| 325 | Ga0436365_0545507 | 3300039437 | Bacteria | 9061 |
| 326 | Ga0436365_0676191 | 3300039437 | Bacteria | 8736 |
| 327 | Ga0436365_0778617 | 3300039437 | Bacteria | 3707 |
| 328 | Ga0436360_0050781 | 3300039438 | Bacteria | 1448 |
| 329 | Ga0436361_0431311 | 3300039447 | Bacteria | 1194 |
| 330 | Ga0436361_0662672 | 3300039447 | Bacteria | 2599 |
| 331 | Ga0436363_0981136 | 3300039450 | Bacteria | 1495 |
| 332 | Ga0436363_1230191 | 3300039450 | Bacteria | 1135 |
| 333 | Ga0436362_0613027 | 3300039453 | Bacteria | 1495 |
| 334 | Ga0466966_0034794 | 3300044684 | Bacteria | 3257 |
| 335 | Ga0466963_0006552 | 3300044694 | Bacteria | 6895 |
| 336 | Ga0466963_0021600 | 3300044694 | Bacteria | 4064 |
| 337 | Ga0466963_0185202 | 3300044694 | Bacteria | 1454 |
| 338 | Ga0466957_0127269 | 3300044842 | Bacteria | 1628 |
| 339 | Ga0466959_0056197 | 3300045049 | Bacteria | 2872 |
| 340 | Ga0451576_0000108 | 3300045051 | Bacteria | 211233 |
| 341 | Ga0466958_0148695 | 3300045836 | Bacteria | 1477 |
| 342 | Ga0466967_0013018 | 3300045976 | Bacteria | 6401 |
| 343 | Ga0495592_0000055 | 3300046454 | Bacteria | 106223 |
| 344 | Ga0495592_0000986 | 3300046454 | Bacteria | 19759 |
| 345 | Ga0495592_0019632 | 3300046454 | Bacteria | 5141 |
| 346 | Ga0495592_0090294 | 3300046454 | Bacteria | 2198 |
| 347 | Ga0495592_0103479 | 3300046454 | Bacteria | 2025 |
| 348 | Ga0495629_0008326 | 3300046459 | Bacteria | 7625 |
| 349 | Ga0495638_0076678 | 3300046460 | Bacteria | 2037 |
| 350 | Ga0495641_0039857 | 3300046461 | Bacteria | 2187 |
| 351 | Ga0495651_0000574 | 3300046462 | Bacteria | 28532 |
| 352 | Ga0495651_0010233 | 3300046462 | Bacteria | 7200 |
| 353 | Ga0495651_0061597 | 3300046462 | Bacteria | 2872 |
| 354 | Ga0495653_0000003 | 3300046463 | Bacteria | 377892 |
| 355 | Ga0495580_0064973 | 3300046472 | Bacteria | 2556 |
| 356 | Ga0495582_0024697 | 3300046473 | Bacteria | 3289 |
| 357 | Ga0495639_0002813 | 3300046475 | Bacteria | 7570 |
| 358 | Ga0495662_0000609 | 3300046476 | Bacteria | 16550 |
| 359 | Ga0495662_0106553 | 3300046476 | Bacteria | 1372 |
| 360 | Ga0495664_0000001 | 3300046477 | Bacteria | 757730 |
| 361 | Ga0495664_0006073 | 3300046477 | Bacteria | 6663 |
| 362 | Ga0495594_0042136 | 3300046499 | Bacteria | 2500 |
| 363 | Ga0495608_0000012 | 3300046511 | Bacteria | 242758 |
| 364 | Ga0495608_0065000 | 3300046511 | Bacteria | 2390 |
| 365 | Ga0495618_0000012 | 3300046514 | Bacteria | 170881 |
| 366 | Ga0495628_0000003 | 3300046516 | Bacteria | 470339 |
| 367 | Ga0495628_0000543 | 3300046516 | Bacteria | 34700 |
| 368 | Ga0495628_0008478 | 3300046516 | Bacteria | 8813 |
| 369 | Ga0495628_0032842 | 3300046516 | Bacteria | 4186 |
| 370 | Ga0495630_0000188 | 3300046517 | Bacteria | 48229 |
| 371 | Ga0495630_0027942 | 3300046517 | Bacteria | 4190 |
| 372 | Ga0495666_0004396 | 3300046526 | Bacteria | 7122 |
| 373 | Ga0495652_0000001 | 3300046529 | Bacteria | 1045081 |
| 374 | Ga0495652_0017093 | 3300046529 | Bacteria | 6478 |
| 375 | Ga0495652_0134092 | 3300046529 | Bacteria | 1956 |
| 376 | Ga0495665_0004364 | 3300046531 | Bacteria | 7637 |
| 377 | Ga0495640_0000022 | 3300046533 | Bacteria | 101825 |
| 378 | Ga0495640_0073796 | 3300046533 | Bacteria | 2283 |
| 379 | Ga0495640_0082502 | 3300046533 | Bacteria | 2134 |
| 380 | Ga0495587_0000003 | 3300046536 | Bacteria | 424188 |
| 381 | Ga0495587_0027921 | 3300046536 | Bacteria | 3436 |
| 382 | Ga0495645_0000004 | 3300046543 | Bacteria | 532661 |
| 383 | Ga0495645_0000148 | 3300046543 | Bacteria | 48244 |
| 384 | Ga0495667_0000001 | 3300046559 | Bacteria | 834831 |
| 385 | Ga0495667_0021082 | 3300046559 | Bacteria | 4396 |
| 386 | Ga0495634_0000012 | 3300046642 | Bacteria | 131341 |
| 387 | Ga0495635_0000011 | 3300046663 | Bacteria | 240094 |
| 388 | Ga0495657_0000086 | 3300046675 | Bacteria | 81806 |
| 389 | Ga0495657_0024810 | 3300046675 | Bacteria | 4265 |
| 390 | Ga0495599_0000004 | 3300046678 | Bacteria | 316231 |
| 391 | Ga0495599_0000218 | 3300046678 | Bacteria | 36747 |
| 392 | Ga0495599_0014737 | 3300046678 | Bacteria | 4840 |
| 393 | Ga0495599_0017442 | 3300046678 | Bacteria | 4463 |
| 394 | Ga0495623_0000044 | 3300046679 | Bacteria | 77517 |
| 395 | Ga0495646_0000010 | 3300046680 | Bacteria | 195319 |
| 396 | Ga0495647_0004267 | 3300046681 | Bacteria | 4630 |
| 397 | Ga0495658_0021565 | 3300046683 | Bacteria | 3396 |
| 398 | Ga0495613_0038676 | 3300046689 | Bacteria | 3535 |
| 399 | Ga0495613_0136820 | 3300046689 | Bacteria | 1752 |
| 400 | Ga0495624_0013226 | 3300046690 | Bacteria | 5627 |
| 401 | Ga0495624_0076213 | 3300046690 | Bacteria | 2081 |
| 402 | Ga0495600_0000026 | 3300046809 | Bacteria | 91792 |
| 403 | Ga0495604_0000010 | 3300047317 | Bacteria | 312236 |
| 404 | Ga0495604_0021829 | 3300047317 | Bacteria | 5111 |
| 405 | Ga0495674_0000001 | 3300047319 | Bacteria | 778665 |
| 406 | Ga0495674_0097692 | 3300047319 | Bacteria | 2501 |
| 407 | Ga0495680_0000527 | 3300047322 | Bacteria | 43004 |
| 408 | Ga0495680_0223277 | 3300047322 | Bacteria | 1344 |
| 409 | Ga0495675_0000009 | 3300047444 | Bacteria | 154214 |
| 410 | Ga0495675_0013767 | 3300047444 | Bacteria | 5112 |
| 411 | Ga0495684_0000005 | 3300047471 | Bacteria | 291932 |
| 412 | Ga0495593_0003117 | 3300047673 | Bacteria | 9967 |
| 413 | Ga0495602_0000002 | 3300048088 | Bacteria | 422216 |
| 414 | Ga0495602_0143917 | 3300048088 | Bacteria | 1884 |
| 415 | Ga0496100_0019936 | 3300048903 | Bacteria | 4012 |
| 416 | Ga0496104_0018746 | 3300048907 | Bacteria | 6319 |
| 417 | Ga0496104_0034931 | 3300048907 | Bacteria | 4691 |
| 418 | Ga0496105_0040441 | 3300048908 | Bacteria | 3845 |
| 419 | Ga0496107_0105692 | 3300048910 | Bacteria | 2067 |
| 420 | Ga0496126_0010006 | 3300048929 | Bacteria | 10007 |
| 421 | Ga0496126_0216041 | 3300048929 | Bacteria | 1613 |
| 422 | Ga0501031_0035500 | 3300049568 | Bacteria | 3252 |
| 423 | Ga0501032_0005298 | 3300049569 | Bacteria | 9592 |
| 424 | Ga0501034_0000032 | 3300049571 | Bacteria | 243763 |
| 425 | Ga0501034_0004050 | 3300049571 | Bacteria | 16444 |
| 426 | Ga0501034_0017636 | 3300049571 | Bacteria | 7320 |
| 427 | Ga0501034_0035932 | 3300049571 | Bacteria | 5023 |
| 428 | Ga0501034_0038594 | 3300049571 | Bacteria | 4836 |
| 429 | Ga0501034_0064344 | 3300049571 | Bacteria | 3682 |
| 430 | Ga0501034_0088813 | 3300049571 | Bacteria | 3088 |
| 431 | Ga0501034_0298504 | 3300049571 | Bacteria | 1548 |
| 432 | Ga0501034_0468669 | 3300049571 | Bacteria | 1176 |
| 433 | Ga0501036_0005731 | 3300049572 | Bacteria | 10076 |
| 434 | Ga0501036_0008867 | 3300049572 | Bacteria | 8259 |
| 435 | Ga0501036_0304473 | 3300049572 | Bacteria | 1333 |
| 436 | Ga0501037_0016550 | 3300049573 | Bacteria | 5428 |
| 437 | Ga0501038_0042713 | 3300049574 | Bacteria | 3947 |
| 438 | Ga0501039_0009809 | 3300049575 | Bacteria | 7296 |
| 439 | Ga0501039_0144365 | 3300049575 | Bacteria | 1870 |
| 440 | Ga0501039_0185338 | 3300049575 | Bacteria | 1637 |
| 441 | Ga0501040_0044419 | 3300049576 | Bacteria | 3029 |
| 442 | Ga0501040_0193203 | 3300049576 | Bacteria | 1445 |
| 443 | Ga0501043_0010017 | 3300049579 | Bacteria | 7433 |
| 444 | Ga0501043_0044024 | 3300049579 | Bacteria | 3509 |
| 445 | Ga0501043_0140735 | 3300049579 | Bacteria | 1890 |
| 446 | Ga0501043_0201896 | 3300049579 | Bacteria | 1543 |
| 447 | Ga0501046_0021003 | 3300049580 | Bacteria | 5392 |
| 448 | Ga0501046_0049584 | 3300049580 | Bacteria | 3320 |
| 449 | Ga0501047_0000010 | 3300049581 | Bacteria | 429357 |
| 450 | Ga0501047_0017460 | 3300049581 | Bacteria | 6873 |
| 451 | Ga0501047_0033040 | 3300049581 | Bacteria | 4996 |
| 452 | Ga0501047_0061585 | 3300049581 | Bacteria | 3620 |
| 453 | Ga0501047_0076093 | 3300049581 | Bacteria | 3230 |
| 454 | Ga0501047_0092166 | 3300049581 | Bacteria | 2908 |
| 455 | Ga0501048_0000740 | 3300049582 | Bacteria | 23899 |
| 456 | Ga0501048_0004435 | 3300049582 | Bacteria | 10688 |
| 457 | Ga0501067_0096874 | 3300049583 | Bacteria | 1638 |
| 458 | Ga0501068_0015625 | 3300049584 | Bacteria | 4363 |
| 459 | Ga0501069_0011044 | 3300049585 | Bacteria | 4789 |
| 460 | Ga0501069_0013401 | 3300049585 | Bacteria | 4372 |
| 461 | Ga0501069_0051046 | 3300049585 | Bacteria | 2301 |
| 462 | Ga0501069_0075159 | 3300049585 | Bacteria | 1897 |
| 463 | Ga0501069_0098747 | 3300049585 | Bacteria | 1656 |
| 464 | Ga0501069_0110439 | 3300049585 | Bacteria | 1566 |
| 465 | Ga0501070_0000929 | 3300049586 | Bacteria | 26412 |
| 466 | Ga0501070_0004882 | 3300049586 | Bacteria | 11457 |
| 467 | Ga0501070_0024877 | 3300049586 | Bacteria | 5021 |
| 468 | Ga0501070_0025347 | 3300049586 | Bacteria | 4974 |
| 469 | Ga0501070_0040560 | 3300049586 | Bacteria | 3882 |
| 470 | Ga0501070_0056735 | 3300049586 | Bacteria | 3246 |
| 471 | Ga0501070_0084105 | 3300049586 | Bacteria | 2634 |
| 472 | Ga0501071_0166946 | 3300049587 | Bacteria | 1647 |
| 473 | Ga0501072_0137485 | 3300049588 | Bacteria | 1948 |
| 474 | Ga0501072_0163351 | 3300049588 | Bacteria | 1777 |
| 475 | Ga0501073_0035810 | 3300049589 | Bacteria | 3526 |
| 476 | Ga0501074_0004679 | 3300049590 | Bacteria | 9797 |
| 477 | Ga0501074_0017708 | 3300049590 | Bacteria | 5174 |
| 478 | Ga0501074_0025357 | 3300049590 | Bacteria | 4306 |
| 479 | Ga0501074_0077282 | 3300049590 | Bacteria | 2389 |
| 480 | Ga0501075_0271156 | 3300049591 | Bacteria | 1293 |
| 481 | Ga0501076_0018333 | 3300049592 | Bacteria | 5335 |
| 482 | Ga0501077_0063565 | 3300049593 | Bacteria | 2341 |
| 483 | Ga0501079_0003507 | 3300049741 | Bacteria | 11531 |
| 484 | Ga0501079_0026818 | 3300049741 | Bacteria | 4417 |
| 485 | Ga0501079_0077054 | 3300049741 | Bacteria | 2579 |
| 486 | Ga0501079_0104000 | 3300049741 | Bacteria | 2203 |
| 487 | Ga0501080_0014709 | 3300049742 | Bacteria | 7205 |
| 488 | Ga0501080_0033244 | 3300049742 | Bacteria | 4813 |
| 489 | Ga0501080_0062126 | 3300049742 | Bacteria | 3477 |
| 490 | Ga0501080_0071894 | 3300049742 | Bacteria | 3218 |
| 491 | Ga0501080_0088445 | 3300049742 | Bacteria | 2878 |
| 492 | Ga0501080_0097663 | 3300049742 | Bacteria | 2727 |
| 493 | Ga0501080_0182138 | 3300049742 | Bacteria | 1932 |
| 494 | Ga0501080_0268366 | 3300049742 | Bacteria | 1554 |
| 495 | Ga0501083_0006521 | 3300049744 | Bacteria | 8275 |
| 496 | Ga0501035_0030975 | 3300049822 | Bacteria | 4872 |
| 497 | Ga0501035_0051887 | 3300049822 | Bacteria | 3670 |
| 498 | Ga0501035_0052307 | 3300049822 | Bacteria | 3655 |
| 499 | Ga0501044_0002125 | 3300049823 | Bacteria | 22744 |
| 500 | Ga0501044_0007914 | 3300049823 | Bacteria | 11687 |
| 501 | Ga0501044_0020178 | 3300049823 | Bacteria | 7113 |
| 502 | Ga0501044_0044519 | 3300049823 | Bacteria | 4605 |
| 503 | Ga0501044_0057594 | 3300049823 | Bacteria | 3988 |
| 504 | Ga0501044_0161888 | 3300049823 | Bacteria | 2214 |
| 505 | nmdc:mga03683_28905_c2 | 3300050489 | Bacteria | 1872 |
| 506 | nmdc:mga03683_409_c1 | 3300050489 | Bacteria | 12382 |
| 507 | nmdc:mga03683_45668_c1 | 3300050489 | Bacteria | 1814 |
| 508 | nmdc:mga03n38_127610_c1 | 3300050490 | Bacteria | 1257 |
| 509 | nmdc:mga0yw44_1320_c1 | 3300050492 | Bacteria | 9797 |
| 510 | nmdc:mga0yw44_285203_c1 | 3300050492 | Bacteria | 1104 |
| 511 | nmdc:mga0k408_18076_c1 | 3300050493 | Bacteria | 3931 |
| 512 | nmdc:mga0k408_58927_c1 | 3300050493 | Bacteria | 2230 |
| 513 | nmdc:mga0k408_71193_c1 | 3300050493 | Bacteria | 2029 |
| 514 | nmdc:mga06z11_119628_c1 | 3300050494 | Bacteria | 1468 |
| 515 | nmdc:mga06z11_42636_c1 | 3300050494 | Bacteria | 2277 |
| 516 | nmdc:mga07m45_16579_c1 | 3300050496 | Bacteria | 3944 |
| 517 | nmdc:mga05p37_586_c1 | 3300050507 | Bacteria | 40050 |
| 518 | nmdc:mga05p37_9754_c1 | 3300050507 | Bacteria | 11389 |
| 519 | nmdc:mga09592_1648_c1 | 3300050508 | Bacteria | 4880 |
| 520 | nmdc:mga09592_191877_c1 | 3300050508 | Bacteria | 1768 |
| 521 | nmdc:mga0qj67_20412_c1 | 3300050509 | Bacteria | 5072 |
| 522 | nmdc:mga06r32_145164_c1 | 3300050510 | Bacteria | 2350 |
| 523 | nmdc:mga06r32_1924_c1 | 3300050510 | Bacteria | 18506 |
| 524 | nmdc:mga08y16_138544_c1 | 3300050511 | Bacteria | 2530 |
| 525 | nmdc:mga08y16_204258_c1 | 3300050511 | Bacteria | 2047 |
| 526 | nmdc:mga08y16_333847_c1 | 3300050511 | Bacteria | 1559 |
| 527 | nmdc:mga08y16_4668_c1 | 3300050511 | Bacteria | 14271 |
| 528 | nmdc:mga0n895_2979_c1 | 3300050512 | Bacteria | 13434 |
| 529 | nmdc:mga0rr50_16629_c1 | 3300050513 | Bacteria | 4892 |
| 530 | nmdc:mga0rr50_8918_c1 | 3300050513 | Bacteria | 6265 |
| 531 | nmdc:mga08x19_148817_c1 | 3300050514 | Bacteria | 1584 |
| 532 | nmdc:mga0a205_2843_c1 | 3300050515 | Bacteria | 15314 |
| 533 | nmdc:mga0sz30_11620_c2 | 3300050516 | Bacteria | 2589 |
| 534 | nmdc:mga0sz30_581_c1 | 3300050516 | Bacteria | 13764 |
| 535 | Ga0495601_0000003 | 3300053077 | Bacteria | 493642 |
| 536 | Ga0495601_0001647 | 3300053077 | Bacteria | 12329 |
| 537 | Ga0495601_0083838 | 3300053077 | Bacteria | 2047 |
| 538 | Ga0495612_0000009 | 3300053078 | Bacteria | 229858 |
| 539 | Ga0495595_0000011 | 3300053084 | Bacteria | 174945 |
| 540 | Ga0495595_0001373 | 3300053084 | Bacteria | 9454 |
| 541 | Ga0495619_0000009 | 3300053085 | Bacteria | 305595 |
| 542 | Ga0495619_0051636 | 3300053085 | Bacteria | 2717 |
| 543 | Ga0495619_0080844 | 3300053085 | Bacteria | 2187 |
| 544 | Ga0495619_0197561 | 3300053085 | Bacteria | 1392 |
| 545 | Ga0495619_0199452 | 3300053085 | Bacteria | 1385 |
| 546 | Ga0500644_0002367 | 3300053088 | Bacteria | 4738 |
| 547 | Ga0500644_0034055 | 3300053088 | Bacteria | 1641 |
| 548 | Ga0500651_0004891 | 3300053093 | Bacteria | 7573 |
| 549 | Ga0500566_0013814 | 3300053094 | Bacteria | 4751 |
| 550 | Ga0500593_031357 | 3300053117 | Bacteria | 2377 |
| 551 | Ga0500594_0019112 | 3300053118 | Bacteria | 1695 |
| 552 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 553 | Ga0500652_009464 | 3300053131 | Bacteria | 3296 |
| 554 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 555 | Ga0500616_0002343 | 3300053153 | Bacteria | 15954 |
| 556 | Ga0500627_0086686 | 3300053158 | Bacteria | 1399 |
| 557 | Ga0500645_000549 | 3300053730 | Bacteria | 24816 |
| 558 | Ga0501084_0073498 | 3300054114 | Bacteria | 2863 |
| 559 | Ga0501084_0272945 | 3300054114 | Bacteria | 1428 |
| 560 | Ga0501082_0006190 | 3300060353 | Bacteria | 10387 |
| 561 | Ga0501082_0034930 | 3300060353 | Bacteria | 4333 |
| 562 | Ga0501082_0160513 | 3300060353 | Bacteria | 1953 |
| 563 | Ga0501082_0210866 | 3300060353 | Bacteria | 1690 |
| 564 | Ga0530510_0088265 | 3300061734 | Bacteria | 2260 |
| 565 | Ga0530510_0291638 | 3300061734 | Bacteria | 1220 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050492 | nmdc:mga0yw44_285203_c1 | nmdc:mga0yw44_285203_c1_19_1011 | 313 |
| 2 | 3300031238 | Ga0265332_10000024 | Ga0265332_10000024138 | 318 |
| 3 | 3300048903 | Ga0496100_0019936 | Ga0496100_0019936_1114_2205 | 321 |
| 4 | 3300048908 | Ga0496105_0040441 | Ga0496105_0040441_419_1510 | 321 |
| 5 | 3300048910 | Ga0496107_0105692 | Ga0496107_0105692_547_1638 | 321 |
| 6 | 3300005548 | Ga0070665_100016716 | Ga0070665_1000167165 | 327 |
| 7 | 3300028379 | Ga0268266_10020714 | Ga0268266_100207146 | 327 |
| 8 | 3300031250 | Ga0265331_10045951 | Ga0265331_100459511 | 327 |
| 9 | 3300037312 | Ga0395899_0064694 | Ga0395899_0064694_1687_2673 | 328 |
| 10 | 3300038443 | Ga0395901_0701831 | Ga0395901_0701831_11_997 | 328 |
| 11 | 3300031235 | Ga0265330_10044970 | Ga0265330_100449701 | 329 |
| 12 | 3300006038 | Ga0075365_10016973 | Ga0075365_100169734 | 331 |
| 13 | 3300005435 | Ga0070714_100097401 | Ga0070714_1000974013 | 336 |
| 14 | 3300025915 | Ga0207693_10034982 | Ga0207693_100349823 | 336 |
| 15 | 3300014968 | Ga0157379_10244174 | Ga0157379_102441742 | 337 |
| 16 | 3300037312 | Ga0395899_0005212 | Ga0395899_0005212_5131_6219 | 338 |
| 17 | 3300037418 | Ga0395900_0009382 | Ga0395900_0009382_5588_6676 | 338 |
| 18 | 3300038443 | Ga0395901_0075344 | Ga0395901_0075344_165_1253 | 338 |
| 19 | 3300038443 | Ga0395901_0120069 | Ga0395901_0120069_1432_2520 | 338 |
| 20 | 3300049579 | Ga0501043_0044024 | Ga0501043_0044024_1001_2104 | 338 |
| 21 | 3300049579 | Ga0501043_0140735 | Ga0501043_0140735_382_1485 | 338 |
| 22 | 3300049581 | Ga0501047_0092166 | Ga0501047_0092166_425_1528 | 338 |
| 23 | 3300005327 | Ga0070658_10017407 | Ga0070658_100174074 | 339 |
| 24 | 3300005563 | Ga0068855_100011086 | Ga0068855_1000110862 | 339 |
| 25 | 3300005577 | Ga0068857_100166180 | Ga0068857_1001661802 | 339 |
| 26 | 3300009551 | Ga0105238_10041790 | Ga0105238_100417904 | 339 |
| 27 | 3300025909 | Ga0207705_10042643 | Ga0207705_100426431 | 339 |
| 28 | 3300025924 | Ga0207694_10127730 | Ga0207694_101277302 | 339 |
| 29 | 3300025944 | Ga0207661_10071720 | Ga0207661_100717202 | 339 |
| 30 | 3300025949 | Ga0207667_10017786 | Ga0207667_100177863 | 339 |
| 31 | 3300026078 | Ga0207702_10042471 | Ga0207702_100424713 | 339 |
| 32 | 3300031247 | Ga0265340_10001019 | Ga0265340_100010194 | 339 |
| 33 | 3300031595 | Ga0265313_10000522 | Ga0265313_1000052221 | 339 |
| 34 | 3300031712 | Ga0265342_10009117 | Ga0265342_100091176 | 339 |
| 35 | 3300037418 | Ga0395900_0057991 | Ga0395900_0057991_1842_2930 | 339 |
| 36 | 3300037466 | Ga0395898_0060800 | Ga0395898_0060800_395_1483 | 339 |
| 37 | 3300038443 | Ga0395901_0034031 | Ga0395901_0034031_3863_4951 | 339 |
| 38 | 3300005327 | Ga0070658_10005001 | Ga0070658_100050012 | 340 |
| 39 | 3300005435 | Ga0070714_100014985 | Ga0070714_1000149854 | 340 |
| 40 | 3300005530 | Ga0070679_100153515 | Ga0070679_1001535152 | 340 |
| 41 | 3300005563 | Ga0068855_100021711 | Ga0068855_1000217114 | 340 |
| 42 | 3300006852 | Ga0075433_10003438 | Ga0075433_100034389 | 340 |
| 43 | 3300006871 | Ga0075434_100000268 | Ga0075434_10000026812 | 340 |
| 44 | 3300007076 | Ga0075435_100014848 | Ga0075435_1000148485 | 340 |
| 45 | 3300009094 | Ga0111539_10012926 | Ga0111539_100129262 | 340 |
| 46 | 3300013100 | Ga0157373_10073590 | Ga0157373_100735902 | 340 |
| 47 | 3300025912 | Ga0207707_10127850 | Ga0207707_101278502 | 340 |
| 48 | 3300025917 | Ga0207660_10066810 | Ga0207660_100668102 | 340 |
| 49 | 3300025919 | Ga0207657_10027346 | Ga0207657_100273462 | 340 |
| 50 | 3300026078 | Ga0207702_10302256 | Ga0207702_103022561 | 340 |
| 51 | 3300027907 | Ga0207428_10160081 | Ga0207428_101600812 | 340 |
| 52 | 3300031595 | Ga0265313_10006264 | Ga0265313_100062642 | 340 |
| 53 | 3300031712 | Ga0265342_10000866 | Ga0265342_1000086618 | 340 |
| 54 | 3300034819 | Ga0373958_0007352 | Ga0373958_0007352_262_1350 | 340 |
| 55 | 3300034957 | Ga0373938_0011460 | Ga0373938_0011460_210_1298 | 340 |
| 56 | 3300035112 | Ga0373932_0005780 | Ga0373932_0005780_1303_2391 | 340 |
| 57 | 3300035241 | Ga0373961_0011600 | Ga0373961_0011600_109_1197 | 340 |
| 58 | 3300035242 | Ga0373962_0006082 | Ga0373962_0006082_633_1721 | 340 |
| 59 | 3300035691 | Ga0373931_0000995 | Ga0373931_0000995_1072_2160 | 340 |
| 60 | 3300049572 | Ga0501036_0304473 | Ga0501036_0304473_153_1241 | 340 |
| 61 | 3300050511 | nmdc:mga08y16_138544_c1 | nmdc:mga08y16_138544_c1_1102_2190 | 340 |
| 62 | 3300050512 | nmdc:mga0n895_2979_c1 | nmdc:mga0n895_2979_c1_8762_9850 | 340 |
| 63 | 3300050513 | nmdc:mga0rr50_8918_c1 | nmdc:mga0rr50_8918_c1_156_1244 | 340 |
| 64 | 3300050515 | nmdc:mga0a205_2843_c1 | nmdc:mga0a205_2843_c1_9950_11038 | 340 |
| 65 | 3300006844 | Ga0075428_100229121 | Ga0075428_1002291212 | 341 |
| 66 | 3300028800 | Ga0265338_10063587 | Ga0265338_100635872 | 341 |
| 67 | 3300031712 | Ga0265342_10009921 | Ga0265342_100099216 | 341 |
| 68 | 3300037466 | Ga0395898_0078361 | Ga0395898_0078361_157_1359 | 341 |
| 69 | 3300044694 | Ga0466963_0006552 | Ga0466963_0006552_4201_5289 | 341 |
| 70 | 3300045976 | Ga0466967_0013018 | Ga0466967_0013018_5248_6336 | 341 |
| 71 | 3300053088 | Ga0500644_0002367 | Ga0500644_0002367_776_1870 | 341 |
| 72 | 3300053118 | Ga0500594_0019112 | Ga0500594_0019112_39_1127 | 341 |
| 73 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_608744_609832 | 341 |
| 74 | 3300005327 | Ga0070658_10005554 | Ga0070658_100055545 | 342 |
| 75 | 3300005336 | Ga0070680_100001108 | Ga0070680_1000011084 | 342 |
| 76 | 3300005458 | Ga0070681_10045176 | Ga0070681_100451762 | 342 |
| 77 | 3300005530 | Ga0070679_100047946 | Ga0070679_1000479463 | 342 |
| 78 | 3300005563 | Ga0068855_100062035 | Ga0068855_1000620353 | 342 |
| 79 | 3300009093 | Ga0105240_10004293 | Ga0105240_1000429312 | 342 |
| 80 | 3300013105 | Ga0157369_10085056 | Ga0157369_100850563 | 342 |
| 81 | 3300025912 | Ga0207707_10029619 | Ga0207707_100296193 | 342 |
| 82 | 3300025917 | Ga0207660_10024491 | Ga0207660_100244911 | 342 |
| 83 | 3300025921 | Ga0207652_10046882 | Ga0207652_100468823 | 342 |
| 84 | 3300025949 | Ga0207667_10040449 | Ga0207667_100404492 | 342 |
| 85 | 3300049742 | Ga0501080_0268366 | Ga0501080_0268366_51_1151 | 342 |
| 86 | 3300060353 | Ga0501082_0160513 | Ga0501082_0160513_588_1709 | 342 |
| 87 | 3300005518 | Ga0070699_100001182 | Ga0070699_1000011826 | 344 |
| 88 | 3300039437 | Ga0436365_0545507 | Ga0436365_0545507_5873_6961 | 344 |
| 89 | 3300005327 | Ga0070658_10281067 | Ga0070658_102810672 | 345 |
| 90 | 3300005434 | Ga0070709_10218905 | Ga0070709_102189051 | 345 |
| 91 | 3300005937 | Ga0081455_10001801 | Ga0081455_100018016 | 345 |
| 92 | 3300009093 | Ga0105240_10082544 | Ga0105240_100825442 | 345 |
| 93 | 3300009147 | Ga0114129_10003226 | Ga0114129_1000322611 | 345 |
| 94 | 3300009551 | Ga0105238_10099672 | Ga0105238_100996722 | 345 |
| 95 | 3300025913 | Ga0207695_10300011 | Ga0207695_103000111 | 345 |
| 96 | 3300025924 | Ga0207694_10069194 | Ga0207694_100691942 | 345 |
| 97 | 3300039450 | Ga0436363_1230191 | Ga0436363_1230191_15_1103 | 345 |
| 98 | 3300006178 | Ga0075367_10030264 | Ga0075367_100302642 | 346 |
| 99 | 3300006195 | Ga0075366_10000552 | Ga0075366_100005524 | 346 |
| 100 | 3300035692 | Ga0373935_0066943 | Ga0373935_0066943_960_2066 | 346 |
| 101 | 3300035695 | Ga0373927_0052552 | Ga0373927_0052552_671_1825 | 346 |
| 102 | 3300045051 | Ga0451576_0000108 | Ga0451576_0000108_14557_15636 | 346 |
| 103 | 3300049742 | Ga0501080_0062126 | Ga0501080_0062126_1475_2536 | 346 |
| 104 | 3300050494 | nmdc:mga06z11_42636_c1 | nmdc:mga06z11_42636_c1_1027_2115 | 346 |
| 105 | 3300050507 | nmdc:mga05p37_9754_c1 | nmdc:mga05p37_9754_c1_9719_10810 | 346 |
| 106 | 3300050511 | nmdc:mga08y16_333847_c1 | nmdc:mga08y16_333847_c1_329_1426 | 346 |
| 107 | 3300053131 | Ga0500652_009464 | Ga0500652_009464_1841_2929 | 346 |
| 108 | 3300053730 | Ga0500645_000549 | Ga0500645_000549_17448_18536 | 346 |
| 109 | iso_pu_bacteria | 2547132512 | 2548849093 | 346 |
| 110 | 3300005336 | Ga0070680_100003405 | Ga0070680_1000034052 | 347 |
| 111 | 3300005339 | Ga0070660_100068474 | Ga0070660_1000684742 | 347 |
| 112 | 3300005435 | Ga0070714_100040203 | Ga0070714_1000402034 | 347 |
| 113 | 3300005436 | Ga0070713_100031411 | Ga0070713_1000314113 | 347 |
| 114 | 3300005439 | Ga0070711_100016017 | Ga0070711_1000160172 | 347 |
| 115 | 3300005458 | Ga0070681_10009265 | Ga0070681_100092659 | 347 |
| 116 | 3300005564 | Ga0070664_100214447 | Ga0070664_1002144472 | 347 |
| 117 | 3300006880 | Ga0075429_100276051 | Ga0075429_1002760512 | 347 |
| 118 | 3300014497 | Ga0182008_10047960 | Ga0182008_100479602 | 347 |
| 119 | 3300025906 | Ga0207699_10137891 | Ga0207699_101378911 | 347 |
| 120 | 3300025912 | Ga0207707_10010597 | Ga0207707_100105975 | 347 |
| 121 | 3300025919 | Ga0207657_10079605 | Ga0207657_100796052 | 347 |
| 122 | 3300025921 | Ga0207652_10022043 | Ga0207652_100220432 | 347 |
| 123 | 3300025931 | Ga0207644_10083365 | Ga0207644_100833651 | 347 |
| 124 | 3300025933 | Ga0207706_10108662 | Ga0207706_101086622 | 347 |
| 125 | 3300031235 | Ga0265330_10020797 | Ga0265330_100207972 | 347 |
| 126 | 3300031247 | Ga0265340_10061622 | Ga0265340_100616221 | 347 |
| 127 | 3300031249 | Ga0265339_10036439 | Ga0265339_100364392 | 347 |
| 128 | 3300044684 | Ga0466966_0034794 | Ga0466966_0034794_1764_2897 | 347 |
| 129 | 3300044842 | Ga0466957_0127269 | Ga0466957_0127269_183_1271 | 347 |
| 130 | 3300045049 | Ga0466959_0056197 | Ga0466959_0056197_165_1298 | 347 |
| 131 | 3300045836 | Ga0466958_0148695 | Ga0466958_0148695_160_1293 | 347 |
| 132 | 3300048929 | Ga0496126_0216041 | Ga0496126_0216041_250_1374 | 347 |
| 133 | 3300049568 | Ga0501031_0035500 | Ga0501031_0035500_465_1592 | 347 |
| 134 | 3300049569 | Ga0501032_0005298 | Ga0501032_0005298_4250_5377 | 347 |
| 135 | 3300049571 | Ga0501034_0064344 | Ga0501034_0064344_1587_2675 | 347 |
| 136 | 3300049571 | Ga0501034_0088813 | Ga0501034_0088813_1717_2844 | 347 |
| 137 | 3300049571 | Ga0501034_0468669 | Ga0501034_0468669_67_1152 | 347 |
| 138 | 3300049572 | Ga0501036_0008867 | Ga0501036_0008867_897_2024 | 347 |
| 139 | 3300049574 | Ga0501038_0042713 | Ga0501038_0042713_2258_3385 | 347 |
| 140 | 3300049575 | Ga0501039_0009809 | Ga0501039_0009809_6139_7266 | 347 |
| 141 | 3300049580 | Ga0501046_0021003 | Ga0501046_0021003_2504_3631 | 347 |
| 142 | 3300049581 | Ga0501047_0061585 | Ga0501047_0061585_2477_3604 | 347 |
| 143 | 3300049582 | Ga0501048_0004435 | Ga0501048_0004435_1707_2834 | 347 |
| 144 | 3300049584 | Ga0501068_0015625 | Ga0501068_0015625_2374_3501 | 347 |
| 145 | 3300049585 | Ga0501069_0013401 | Ga0501069_0013401_2331_3458 | 347 |
| 146 | 3300049586 | Ga0501070_0056735 | Ga0501070_0056735_2103_3230 | 347 |
| 147 | 3300049589 | Ga0501073_0035810 | Ga0501073_0035810_17_1144 | 347 |
| 148 | 3300049590 | Ga0501074_0017708 | Ga0501074_0017708_1708_2835 | 347 |
| 149 | 3300049741 | Ga0501079_0003507 | Ga0501079_0003507_10094_11185 | 347 |
| 150 | 3300049741 | Ga0501079_0077054 | Ga0501079_0077054_1210_2337 | 347 |
| 151 | 3300049742 | Ga0501080_0014709 | Ga0501080_0014709_3286_4413 | 347 |
| 152 | 3300049822 | Ga0501035_0051887 | Ga0501035_0051887_2103_3230 | 347 |
| 153 | 3300049823 | Ga0501044_0002125 | Ga0501044_0002125_15400_16590 | 347 |
| 154 | 3300060353 | Ga0501082_0034930 | Ga0501082_0034930_464_1591 | 347 |
| 155 | 3300006871 | Ga0075434_100171033 | Ga0075434_1001710332 | 348 |
| 156 | 3300014326 | Ga0157380_10247031 | Ga0157380_102470312 | 348 |
| 157 | 3300014969 | Ga0157376_10131508 | Ga0157376_101315082 | 348 |
| 158 | 3300048907 | Ga0496104_0018746 | Ga0496104_0018746_643_1746 | 348 |
| 159 | 3300049571 | Ga0501034_0000032 | Ga0501034_0000032_86799_87887 | 348 |
| 160 | 3300049571 | Ga0501034_0004050 | Ga0501034_0004050_7870_8961 | 348 |
| 161 | 3300049571 | Ga0501034_0017636 | Ga0501034_0017636_1846_2937 | 348 |
| 162 | 3300049571 | Ga0501034_0035932 | Ga0501034_0035932_3072_4268 | 348 |
| 163 | 3300049571 | Ga0501034_0038594 | Ga0501034_0038594_2811_3899 | 348 |
| 164 | 3300049572 | Ga0501036_0005731 | Ga0501036_0005731_1108_2199 | 348 |
| 165 | 3300049573 | Ga0501037_0016550 | Ga0501037_0016550_1109_2197 | 348 |
| 166 | 3300049575 | Ga0501039_0144365 | Ga0501039_0144365_360_1451 | 348 |
| 167 | 3300049575 | Ga0501039_0185338 | Ga0501039_0185338_39_1196 | 348 |
| 168 | 3300049576 | Ga0501040_0193203 | Ga0501040_0193203_208_1296 | 348 |
| 169 | 3300049579 | Ga0501043_0010017 | Ga0501043_0010017_1294_2385 | 348 |
| 170 | 3300049580 | Ga0501046_0049584 | Ga0501046_0049584_280_1371 | 348 |
| 171 | 3300049581 | Ga0501047_0000010 | Ga0501047_0000010_424741_425832 | 348 |
| 172 | 3300049582 | Ga0501048_0000740 | Ga0501048_0000740_1058_2149 | 348 |
| 173 | 3300049585 | Ga0501069_0051046 | Ga0501069_0051046_708_1796 | 348 |
| 174 | 3300049585 | Ga0501069_0110439 | Ga0501069_0110439_426_1514 | 348 |
| 175 | 3300049586 | Ga0501070_0000929 | Ga0501070_0000929_501_1589 | 348 |
| 176 | 3300049586 | Ga0501070_0004882 | Ga0501070_0004882_569_1660 | 348 |
| 177 | 3300049590 | Ga0501074_0004679 | Ga0501074_0004679_7842_8933 | 348 |
| 178 | 3300049742 | Ga0501080_0088445 | Ga0501080_0088445_519_1607 | 348 |
| 179 | 3300049744 | Ga0501083_0006521 | Ga0501083_0006521_2389_3546 | 348 |
| 180 | 3300049823 | Ga0501044_0007914 | Ga0501044_0007914_4737_5828 | 348 |
| 181 | 3300049823 | Ga0501044_0044519 | Ga0501044_0044519_3197_4285 | 348 |
| 182 | 3300049823 | Ga0501044_0057594 | Ga0501044_0057594_1353_2444 | 348 |
| 183 | 3300053093 | Ga0500651_0004891 | Ga0500651_0004891_1680_2768 | 348 |
| 184 | 3300053094 | Ga0500566_0013814 | Ga0500566_0013814_1571_2659 | 348 |
| 185 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_544346_545434 | 348 |
| 186 | 3300060353 | Ga0501082_0006190 | Ga0501082_0006190_6960_8117 | 348 |
| 187 | 3300060353 | Ga0501082_0210866 | Ga0501082_0210866_442_1530 | 348 |
| 188 | 3300061734 | Ga0530510_0088265 | Ga0530510_0088265_515_1627 | 348 |
| 189 | 3300005548 | Ga0070665_100146937 | Ga0070665_1001469372 | 349 |
| 190 | 3300006852 | Ga0075433_10050303 | Ga0075433_100503034 | 349 |
| 191 | 3300025294 | Ga0209025_1001538 | Ga0209025_10015382 | 349 |
| 192 | 3300026088 | Ga0207641_10316481 | Ga0207641_103164812 | 349 |
| 193 | 3300028379 | Ga0268266_10094291 | Ga0268266_100942913 | 349 |
| 194 | 3300031548 | Ga0307408_100049715 | Ga0307408_1000497152 | 349 |
| 195 | 3300031731 | Ga0307405_10003576 | Ga0307405_100035763 | 349 |
| 196 | 3300031852 | Ga0307410_10005404 | Ga0307410_100054042 | 349 |
| 197 | 3300031901 | Ga0307406_10001441 | Ga0307406_1000144110 | 349 |
| 198 | 3300031911 | Ga0307412_10012673 | Ga0307412_100126732 | 349 |
| 199 | 3300032002 | Ga0307416_100096228 | Ga0307416_1000962282 | 349 |
| 200 | 3300032004 | Ga0307414_10015498 | Ga0307414_100154982 | 349 |
| 201 | 3300032126 | Ga0307415_100046549 | Ga0307415_1000465492 | 349 |
| 202 | 3300039453 | Ga0436362_0613027 | Ga0436362_0613027_330_1439 | 349 |
| 203 | 3300049586 | Ga0501070_0084105 | Ga0501070_0084105_1433_2539 | 349 |
| 204 | 3300049742 | Ga0501080_0033244 | Ga0501080_0033244_3057_4163 | 349 |
| 205 | 3300049823 | Ga0501044_0161888 | Ga0501044_0161888_228_1316 | 349 |
| 206 | 3300050510 | nmdc:mga06r32_145164_c1 | nmdc:mga06r32_145164_c1_946_2058 | 349 |
| 207 | 3300053085 | Ga0495619_0197561 | Ga0495619_0197561_47_1144 | 349 |
| 208 | iso_pu_bacteria | 2643221547 | 2643756788 | 349 |
| 209 | 3300003203 | JGI25406J46586_10002392 | JGI25406J46586_100023922 | 350 |
| 210 | 3300005439 | Ga0070711_100205342 | Ga0070711_1002053421 | 350 |
| 211 | 3300005614 | Ga0068856_100111390 | Ga0068856_1001113902 | 350 |
| 212 | 3300005985 | Ga0081539_10000101 | Ga0081539_1000010184 | 350 |
| 213 | 3300009551 | Ga0105238_10041790 | Ga0105238_100417902 | 350 |
| 214 | 3300013104 | Ga0157370_10030206 | Ga0157370_100302062 | 350 |
| 215 | 3300013105 | Ga0157369_10111880 | Ga0157369_101118802 | 350 |
| 216 | 3300025923 | Ga0207681_10103054 | Ga0207681_101030543 | 350 |
| 217 | 3300025924 | Ga0207694_10097536 | Ga0207694_100975362 | 350 |
| 218 | 3300027512 | Ga0209179_1000633 | Ga0209179_10006332 | 350 |
| 219 | 3300039450 | Ga0436363_0981136 | Ga0436363_0981136_197_1285 | 350 |
| 220 | 3300049576 | Ga0501040_0044419 | Ga0501040_0044419_933_2045 | 350 |
| 221 | 3300049588 | Ga0501072_0137485 | Ga0501072_0137485_816_1928 | 350 |
| 222 | 3300049590 | Ga0501074_0077282 | Ga0501074_0077282_859_1971 | 350 |
| 223 | 3300049592 | Ga0501076_0018333 | Ga0501076_0018333_3527_4639 | 350 |
| 224 | 3300049593 | Ga0501077_0063565 | Ga0501077_0063565_736_1848 | 350 |
| 225 | 3300049741 | Ga0501079_0026818 | Ga0501079_0026818_2524_3636 | 350 |
| 226 | 3300049742 | Ga0501080_0071894 | Ga0501080_0071894_1488_2600 | 350 |
| 227 | 3300050490 | nmdc:mga03n38_127610_c1 | nmdc:mga03n38_127610_c1_28_1128 | 350 |
| 228 | 3300050493 | nmdc:mga0k408_18076_c1 | nmdc:mga0k408_18076_c1_116_1216 | 350 |
| 229 | 3300053153 | Ga0500616_0002343 | Ga0500616_0002343_20_1102 | 350 |
| 230 | 3300054114 | Ga0501084_0073498 | Ga0501084_0073498_806_1918 | 350 |
| 231 | iso_pu_bacteria | 2643221736 | 2644744711 | 350 |
| 232 | iso_pu_bacteria | 2894817345 | 2894818511 | 350 |
| 233 | 3300005327 | Ga0070658_10005554 | Ga0070658_100055547 | 351 |
| 234 | 3300005336 | Ga0070680_100001108 | Ga0070680_1000011082 | 351 |
| 235 | 3300005339 | Ga0070660_100015257 | Ga0070660_1000152574 | 351 |
| 236 | 3300005340 | Ga0070689_100142701 | Ga0070689_1001427012 | 351 |
| 237 | 3300005341 | Ga0070691_10093064 | Ga0070691_100930642 | 351 |
| 238 | 3300005578 | Ga0068854_100021941 | Ga0068854_1000219412 | 351 |
| 239 | 3300005937 | Ga0081455_10003377 | Ga0081455_100033777 | 351 |
| 240 | 3300005937 | Ga0081455_10029006 | Ga0081455_100290065 | 351 |
| 241 | 3300005983 | Ga0081540_1001504 | Ga0081540_100150413 | 351 |
| 242 | 3300009093 | Ga0105240_10004293 | Ga0105240_1000429314 | 351 |
| 243 | 3300013105 | Ga0157369_10181167 | Ga0157369_101811672 | 351 |
| 244 | 3300025913 | Ga0207695_10339153 | Ga0207695_103391531 | 351 |
| 245 | 3300025917 | Ga0207660_10024491 | Ga0207660_100244913 | 351 |
| 246 | 3300025919 | Ga0207657_10023148 | Ga0207657_100231483 | 351 |
| 247 | 3300025949 | Ga0207667_10091586 | Ga0207667_100915861 | 351 |
| 248 | 3300025981 | Ga0207640_10072100 | Ga0207640_100721001 | 351 |
| 249 | 3300026089 | Ga0207648_10126938 | Ga0207648_101269382 | 351 |
| 250 | 3300049581 | Ga0501047_0076093 | Ga0501047_0076093_756_1880 | 351 |
| 251 | 3300049586 | Ga0501070_0024877 | Ga0501070_0024877_469_1593 | 351 |
| 252 | 3300049590 | Ga0501074_0025357 | Ga0501074_0025357_2855_3979 | 351 |
| 253 | 3300049742 | Ga0501080_0097663 | Ga0501080_0097663_1326_2450 | 351 |
| 254 | 3300049823 | Ga0501044_0020178 | Ga0501044_0020178_3448_4572 | 351 |
| 255 | 3300050508 | nmdc:mga09592_191877_c1 | nmdc:mga09592_191877_c1_495_1583 | 351 |
| 256 | iso_pu_bacteria | 2511231221 | 2512033551 | 351 |
| 257 | iso_pu_bacteria | 2513237087 | 2513591536 | 351 |
| 258 | iso_pu_bacteria | 2513237145 | 2513920428 | 351 |
| 259 | iso_pu_bacteria | 2828305725 | 2828308249 | 351 |
| 260 | iso_pu_bacteria | 2841760612 | 2841762987 | 351 |
| 261 | iso_pu_bacteria | 2842333319 | 2842333976 | 351 |
| 262 | iso_pu_bacteria | 2844104063 | 2844109143 | 351 |
| 263 | iso_pu_bacteria | 2848858292 | 2848862903 | 351 |
| 264 | iso_pu_bacteria | 2851182111 | 2851182272 | 351 |
| 265 | iso_pu_bacteria | 2851246043 | 2851251250 | 351 |
| 266 | iso_pu_bacteria | 2897803580 | 2897805641 | 351 |
| 267 | iso_pu_bacteria | 8054002106 | 8054004803 | 351 |
| 268 | iso_pu_bacteria | 8057529695 | 8057535003 | 351 |
| 269 | 3300005340 | Ga0070689_100133228 | Ga0070689_1001332281 | 352 |
| 270 | 3300005434 | Ga0070709_10056242 | Ga0070709_100562422 | 352 |
| 271 | 3300005843 | Ga0068860_100104011 | Ga0068860_1001040112 | 352 |
| 272 | 3300005843 | Ga0068860_100185815 | Ga0068860_1001858152 | 352 |
| 273 | 3300005981 | Ga0081538_10034440 | Ga0081538_100344402 | 352 |
| 274 | 3300005985 | Ga0081539_10003832 | Ga0081539_1000383210 | 352 |
| 275 | 3300006177 | Ga0075362_10011334 | Ga0075362_100113341 | 352 |
| 276 | 3300006177 | Ga0075362_10058980 | Ga0075362_100589802 | 352 |
| 277 | 3300006178 | Ga0075367_10095334 | Ga0075367_100953342 | 352 |
| 278 | 3300006186 | Ga0075369_10001445 | Ga0075369_100014453 | 352 |
| 279 | 3300006186 | Ga0075369_10013806 | Ga0075369_100138063 | 352 |
| 280 | 3300006186 | Ga0075369_10022060 | Ga0075369_100220602 | 352 |
| 281 | 3300006353 | Ga0075370_10028419 | Ga0075370_100284193 | 352 |
| 282 | 3300006353 | Ga0075370_10043877 | Ga0075370_100438773 | 352 |
| 283 | 3300006844 | Ga0075428_100529850 | Ga0075428_1005298501 | 352 |
| 284 | 3300007265 | Ga0099794_10052267 | Ga0099794_100522673 | 352 |
| 285 | 3300021384 | Ga0213876_10050181 | Ga0213876_100501812 | 352 |
| 286 | 3300025936 | Ga0207670_10045131 | Ga0207670_100451313 | 352 |
| 287 | 3300028573 | Ga0265334_10027700 | Ga0265334_100277003 | 352 |
| 288 | 3300028794 | Ga0307515_10078976 | Ga0307515_100789764 | 352 |
| 289 | 3300032002 | Ga0307416_100457163 | Ga0307416_1004571631 | 352 |
| 290 | 3300035116 | Ga0373945_0047533 | Ga0373945_0047533_101_1192 | 352 |
| 291 | 3300035692 | Ga0373935_0057427 | Ga0373935_0057427_138_1229 | 352 |
| 292 | 3300038443 | Ga0395901_0201832 | Ga0395901_0201832_898_2064 | 352 |
| 293 | 3300039437 | Ga0436365_0676191 | Ga0436365_0676191_4520_5611 | 352 |
| 294 | 3300039447 | Ga0436361_0431311 | Ga0436361_0431311_88_1179 | 352 |
| 295 | 3300049585 | Ga0501069_0011044 | Ga0501069_0011044_2886_3977 | 352 |
| 296 | 3300050489 | nmdc:mga03683_28905_c2 | nmdc:mga03683_28905_c2_92_1180 | 352 |
| 297 | 3300050489 | nmdc:mga03683_45668_c1 | nmdc:mga03683_45668_c1_80_1168 | 352 |
| 298 | 3300050492 | nmdc:mga0yw44_1320_c1 | nmdc:mga0yw44_1320_c1_4850_5938 | 352 |
| 299 | 3300050493 | nmdc:mga0k408_71193_c1 | nmdc:mga0k408_71193_c1_793_1893 | 352 |
| 300 | 3300050494 | nmdc:mga06z11_119628_c1 | nmdc:mga06z11_119628_c1_208_1296 | 352 |
| 301 | 3300050516 | nmdc:mga0sz30_11620_c2 | nmdc:mga0sz30_11620_c2_385_1473 | 352 |
| 302 | 3300050516 | nmdc:mga0sz30_581_c1 | nmdc:mga0sz30_581_c1_742_1830 | 352 |
| 303 | 3300005338 | Ga0068868_100196902 | Ga0068868_1001969021 | 353 |
| 304 | 3300005354 | Ga0070675_100047938 | Ga0070675_1000479383 | 353 |
| 305 | 3300005842 | Ga0068858_100238476 | Ga0068858_1002384761 | 353 |
| 306 | 3300005843 | Ga0068860_100006084 | Ga0068860_1000060842 | 353 |
| 307 | 3300006237 | Ga0097621_100019769 | Ga0097621_1000197694 | 353 |
| 308 | 3300006881 | Ga0068865_100075257 | Ga0068865_1000752572 | 353 |
| 309 | 3300009176 | Ga0105242_10003626 | Ga0105242_100036267 | 353 |
| 310 | 3300009177 | Ga0105248_10004953 | Ga0105248_1000495314 | 353 |
| 311 | 3300013296 | Ga0157374_10051238 | Ga0157374_100512383 | 353 |
| 312 | 3300013306 | Ga0163162_10169417 | Ga0163162_101694172 | 353 |
| 313 | 3300013308 | Ga0157375_10047413 | Ga0157375_100474134 | 353 |
| 314 | 3300014326 | Ga0157380_10119753 | Ga0157380_101197533 | 353 |
| 315 | 3300014969 | Ga0157376_10009491 | Ga0157376_100094917 | 353 |
| 316 | 3300025926 | Ga0207659_10070668 | Ga0207659_100706682 | 353 |
| 317 | 3300025934 | Ga0207686_10004471 | Ga0207686_100044716 | 353 |
| 318 | 3300025936 | Ga0207670_10020124 | Ga0207670_100201242 | 353 |
| 319 | 3300025960 | Ga0207651_10031281 | Ga0207651_100312812 | 353 |
| 320 | 3300028381 | Ga0268264_10007444 | Ga0268264_100074442 | 353 |
| 321 | 3300039437 | Ga0436365_0778617 | Ga0436365_0778617_559_1683 | 353 |
| 322 | 3300039438 | Ga0436360_0050781 | Ga0436360_0050781_90_1223 | 353 |
| 323 | 3300046454 | Ga0495592_0090294 | Ga0495592_0090294_987_2081 | 353 |
| 324 | 3300046462 | Ga0495651_0061597 | Ga0495651_0061597_775_1869 | 353 |
| 325 | 3300046511 | Ga0495608_0065000 | Ga0495608_0065000_444_1538 | 353 |
| 326 | 3300046536 | Ga0495587_0027921 | Ga0495587_0027921_1312_2406 | 353 |
| 327 | 3300046559 | Ga0495667_0021082 | Ga0495667_0021082_3131_4225 | 353 |
| 328 | 3300046675 | Ga0495657_0024810 | Ga0495657_0024810_77_1171 | 353 |
| 329 | 3300046678 | Ga0495599_0017442 | Ga0495599_0017442_3006_4100 | 353 |
| 330 | 3300048088 | Ga0495602_0143917 | Ga0495602_0143917_772_1866 | 353 |
| 331 | 3300053085 | Ga0495619_0199452 | Ga0495619_0199452_148_1242 | 353 |
| 332 | 3300002987 | JGI25159J45721_1002032 | JGI25159J45721_10020328 | 354 |
| 333 | 3300005262 | Ga0065165_1000218 | Ga0065165_100021898 | 354 |
| 334 | 3300005335 | Ga0070666_10123734 | Ga0070666_101237342 | 354 |
| 335 | 3300005338 | Ga0068868_100203183 | Ga0068868_1002031832 | 354 |
| 336 | 3300005354 | Ga0070675_100268608 | Ga0070675_1002686082 | 354 |
| 337 | 3300005365 | Ga0070688_100177535 | Ga0070688_1001775351 | 354 |
| 338 | 3300005367 | Ga0070667_100239869 | Ga0070667_1002398692 | 354 |
| 339 | 3300005458 | Ga0070681_10152140 | Ga0070681_101521402 | 354 |
| 340 | 3300005530 | Ga0070679_100067237 | Ga0070679_1000672372 | 354 |
| 341 | 3300007265 | Ga0099794_10013479 | Ga0099794_100134793 | 354 |
| 342 | 3300007788 | Ga0099795_10018985 | Ga0099795_100189852 | 354 |
| 343 | 3300010159 | Ga0099796_10017643 | Ga0099796_100176432 | 354 |
| 344 | 3300025284 | Ga0209130_1000632 | Ga0209130_100063222 | 354 |
| 345 | 3300025302 | Ga0207426_1003065 | Ga0207426_10030655 | 354 |
| 346 | 3300025903 | Ga0207680_10053481 | Ga0207680_100534813 | 354 |
| 347 | 3300025926 | Ga0207659_10241067 | Ga0207659_102410672 | 354 |
| 348 | 3300025940 | Ga0207691_10278867 | Ga0207691_102788672 | 354 |
| 349 | 3300025986 | Ga0207658_10304935 | Ga0207658_103049351 | 354 |
| 350 | 3300026118 | Ga0207675_100104321 | Ga0207675_1001043213 | 354 |
| 351 | 3300026121 | Ga0207683_10179708 | Ga0207683_101797082 | 354 |
| 352 | 3300027671 | Ga0209588_1026970 | Ga0209588_10269702 | 354 |
| 353 | 3300035086 | Ga0373934_0000181 | Ga0373934_0000181_3925_5034 | 354 |
| 354 | 3300035086 | Ga0373934_0007531 | Ga0373934_0007531_242_1351 | 354 |
| 355 | 3300035111 | Ga0373923_0096086 | Ga0373923_0096086_119_1228 | 354 |
| 356 | 3300035118 | Ga0373954_0000484 | Ga0373954_0000484_12051_13166 | 354 |
| 357 | 3300035118 | Ga0373954_0001302 | Ga0373954_0001302_3175_4284 | 354 |
| 358 | 3300035118 | Ga0373954_0126137 | Ga0373954_0126137_34_1143 | 354 |
| 359 | 3300035119 | Ga0373956_0000230 | Ga0373956_0000230_19090_20199 | 354 |
| 360 | 3300035120 | Ga0373957_0005517 | Ga0373957_0005517_1850_2959 | 354 |
| 361 | 3300035120 | Ga0373957_0018188 | Ga0373957_0018188_954_2063 | 354 |
| 362 | 3300035170 | Ga0373943_0042792 | Ga0373943_0042792_160_1269 | 354 |
| 363 | 3300035172 | Ga0373955_0013434 | Ga0373955_0013434_2755_3864 | 354 |
| 364 | 3300035724 | Ga0373933_0000550 | Ga0373933_0000550_20473_21582 | 354 |
| 365 | 3300035725 | Ga0373947_0085047 | Ga0373947_0085047_368_1477 | 354 |
| 366 | 3300036401 | Ga0373937_0001239 | Ga0373937_0001239_2144_3253 | 354 |
| 367 | 3300037068 | Ga0373925_0119643 | Ga0373925_0119643_906_2015 | 354 |
| 368 | 3300038705 | Ga0237819_05544 | Ga0237819_05544_757_1896 | 354 |
| 369 | 3300044694 | Ga0466963_0021600 | Ga0466963_0021600_538_1623 | 354 |
| 370 | 3300046454 | Ga0495592_0000986 | Ga0495592_0000986_3204_4313 | 354 |
| 371 | 3300046454 | Ga0495592_0019632 | Ga0495592_0019632_659_1768 | 354 |
| 372 | 3300046454 | Ga0495592_0103479 | Ga0495592_0103479_752_1861 | 354 |
| 373 | 3300046460 | Ga0495638_0076678 | Ga0495638_0076678_144_1229 | 354 |
| 374 | 3300046461 | Ga0495641_0039857 | Ga0495641_0039857_711_1820 | 354 |
| 375 | 3300046462 | Ga0495651_0000574 | Ga0495651_0000574_23766_24875 | 354 |
| 376 | 3300046462 | Ga0495651_0010233 | Ga0495651_0010233_4683_5792 | 354 |
| 377 | 3300046472 | Ga0495580_0064973 | Ga0495580_0064973_1075_2184 | 354 |
| 378 | 3300046473 | Ga0495582_0024697 | Ga0495582_0024697_1414_2523 | 354 |
| 379 | 3300046475 | Ga0495639_0002813 | Ga0495639_0002813_3360_4469 | 354 |
| 380 | 3300046476 | Ga0495662_0106553 | Ga0495662_0106553_119_1228 | 354 |
| 381 | 3300046477 | Ga0495664_0006073 | Ga0495664_0006073_2976_4085 | 354 |
| 382 | 3300046499 | Ga0495594_0042136 | Ga0495594_0042136_489_1598 | 354 |
| 383 | 3300046516 | Ga0495628_0000543 | Ga0495628_0000543_18716_19825 | 354 |
| 384 | 3300046516 | Ga0495628_0008478 | Ga0495628_0008478_6958_8067 | 354 |
| 385 | 3300046516 | Ga0495628_0032842 | Ga0495628_0032842_71_1180 | 354 |
| 386 | 3300046517 | Ga0495630_0027942 | Ga0495630_0027942_2877_3986 | 354 |
| 387 | 3300046526 | Ga0495666_0004396 | Ga0495666_0004396_5514_6623 | 354 |
| 388 | 3300046529 | Ga0495652_0017093 | Ga0495652_0017093_1645_2754 | 354 |
| 389 | 3300046529 | Ga0495652_0134092 | Ga0495652_0134092_756_1865 | 354 |
| 390 | 3300046531 | Ga0495665_0004364 | Ga0495665_0004364_5569_6678 | 354 |
| 391 | 3300046533 | Ga0495640_0082502 | Ga0495640_0082502_681_1790 | 354 |
| 392 | 3300046543 | Ga0495645_0000148 | Ga0495645_0000148_22374_23483 | 354 |
| 393 | 3300046678 | Ga0495599_0000218 | Ga0495599_0000218_18940_20049 | 354 |
| 394 | 3300046678 | Ga0495599_0014737 | Ga0495599_0014737_3549_4658 | 354 |
| 395 | 3300046681 | Ga0495647_0004267 | Ga0495647_0004267_557_1666 | 354 |
| 396 | 3300046683 | Ga0495658_0021565 | Ga0495658_0021565_1829_2938 | 354 |
| 397 | 3300046689 | Ga0495613_0038676 | Ga0495613_0038676_70_1179 | 354 |
| 398 | 3300046690 | Ga0495624_0013226 | Ga0495624_0013226_3194_4303 | 354 |
| 399 | 3300047317 | Ga0495604_0021829 | Ga0495604_0021829_1850_2959 | 354 |
| 400 | 3300047319 | Ga0495674_0097692 | Ga0495674_0097692_362_1471 | 354 |
| 401 | 3300047322 | Ga0495680_0223277 | Ga0495680_0223277_22_1131 | 354 |
| 402 | 3300047444 | Ga0495675_0013767 | Ga0495675_0013767_3221_4330 | 354 |
| 403 | 3300050496 | nmdc:mga07m45_16579_c1 | nmdc:mga07m45_16579_c1_2495_3580 | 354 |
| 404 | 3300053077 | Ga0495601_0001647 | Ga0495601_0001647_7800_8909 | 354 |
| 405 | 3300053077 | Ga0495601_0083838 | Ga0495601_0083838_871_1980 | 354 |
| 406 | 3300053084 | Ga0495595_0001373 | Ga0495595_0001373_3853_4962 | 354 |
| 407 | 3300053085 | Ga0495619_0080844 | Ga0495619_0080844_819_1928 | 354 |
| 408 | 3300053093 | Ga0500651_0004891 | Ga0500651_0004891_2992_4077 | 354 |
| 409 | 3300053094 | Ga0500566_0013814 | Ga0500566_0013814_260_1348 | 354 |
| 410 | 3300053117 | Ga0500593_031357 | Ga0500593_031357_682_1770 | 354 |
| 411 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_543035_544123 | 354 |
| 412 | 3300053730 | Ga0500645_000549 | Ga0500645_000549_18761_19846 | 354 |
| 413 | 3300001979 | JGI24740J21852_10000638 | JGI24740J21852_1000063814 | 355 |
| 414 | 3300003215 | JGI25153J46596_10006619 | JGI25153J46596_100066192 | 355 |
| 415 | 3300003659 | JGI25404J52841_10000386 | JGI25404J52841_100003863 | 355 |
| 416 | 3300005289 | Ga0065704_10093776 | Ga0065704_100937762 | 355 |
| 417 | 3300005347 | Ga0070668_100000766 | Ga0070668_10000076612 | 355 |
| 418 | 3300005347 | Ga0070668_100060258 | Ga0070668_1000602582 | 355 |
| 419 | 3300005354 | Ga0070675_100323947 | Ga0070675_1003239472 | 355 |
| 420 | 3300005434 | Ga0070709_10101581 | Ga0070709_101015812 | 355 |
| 421 | 3300005436 | Ga0070713_100001555 | Ga0070713_1000015554 | 355 |
| 422 | 3300005437 | Ga0070710_10067082 | Ga0070710_100670822 | 355 |
| 423 | 3300005439 | Ga0070711_100018729 | Ga0070711_1000187293 | 355 |
| 424 | 3300005455 | Ga0070663_100117437 | Ga0070663_1001174372 | 355 |
| 425 | 3300005457 | Ga0070662_100204957 | Ga0070662_1002049572 | 355 |
| 426 | 3300005539 | Ga0068853_100066065 | Ga0068853_1000660653 | 355 |
| 427 | 3300005545 | Ga0070695_100125940 | Ga0070695_1001259401 | 355 |
| 428 | 3300005546 | Ga0070696_100047064 | Ga0070696_1000470642 | 355 |
| 429 | 3300005563 | Ga0068855_100030635 | Ga0068855_1000306356 | 355 |
| 430 | 3300005577 | Ga0068857_100044064 | Ga0068857_1000440642 | 355 |
| 431 | 3300005578 | Ga0068854_100005953 | Ga0068854_1000059534 | 355 |
| 432 | 3300005614 | Ga0068856_100240808 | Ga0068856_1002408082 | 355 |
| 433 | 3300005616 | Ga0068852_100275492 | Ga0068852_1002754922 | 355 |
| 434 | 3300005834 | Ga0068851_10002111 | Ga0068851_100021118 | 355 |
| 435 | 3300005937 | Ga0081455_10045312 | Ga0081455_100453122 | 355 |
| 436 | 3300005983 | Ga0081540_1000008 | Ga0081540_100000830 | 355 |
| 437 | 3300006042 | Ga0075368_10016573 | Ga0075368_100165732 | 355 |
| 438 | 3300006048 | Ga0075363_100004780 | Ga0075363_1000047804 | 355 |
| 439 | 3300006163 | Ga0070715_10007530 | Ga0070715_100075303 | 355 |
| 440 | 3300006175 | Ga0070712_100224077 | Ga0070712_1002240772 | 355 |
| 441 | 3300006177 | Ga0075362_10006572 | Ga0075362_100065722 | 355 |
| 442 | 3300006177 | Ga0075362_10019885 | Ga0075362_100198852 | 355 |
| 443 | 3300006186 | Ga0075369_10022961 | Ga0075369_100229612 | 355 |
| 444 | 3300006195 | Ga0075366_10081187 | Ga0075366_100811873 | 355 |
| 445 | 3300006353 | Ga0075370_10019433 | Ga0075370_100194333 | 355 |
| 446 | 3300006844 | Ga0075428_100001096 | Ga0075428_10000109618 | 355 |
| 447 | 3300006846 | Ga0075430_100021252 | Ga0075430_1000212524 | 355 |
| 448 | 3300006847 | Ga0075431_100002284 | Ga0075431_1000022843 | 355 |
| 449 | 3300006852 | Ga0075433_10182893 | Ga0075433_101828932 | 355 |
| 450 | 3300006871 | Ga0075434_100144742 | Ga0075434_1001447422 | 355 |
| 451 | 3300006880 | Ga0075429_100026528 | Ga0075429_1000265282 | 355 |
| 452 | 3300006914 | Ga0075436_100113703 | Ga0075436_1001137032 | 355 |
| 453 | 3300007076 | Ga0075435_100109420 | Ga0075435_1001094202 | 355 |
| 454 | 3300007788 | Ga0099795_10026446 | Ga0099795_100264462 | 355 |
| 455 | 3300009093 | Ga0105240_10014218 | Ga0105240_100142187 | 355 |
| 456 | 3300009094 | Ga0111539_10000835 | Ga0111539_1000083515 | 355 |
| 457 | 3300009147 | Ga0114129_10005100 | Ga0114129_1000510015 | 355 |
| 458 | 3300009147 | Ga0114129_10167375 | Ga0114129_101673752 | 355 |
| 459 | 3300009174 | Ga0105241_10007599 | Ga0105241_100075996 | 355 |
| 460 | 3300009176 | Ga0105242_10123007 | Ga0105242_101230071 | 355 |
| 461 | 3300009545 | Ga0105237_10046872 | Ga0105237_100468723 | 355 |
| 462 | 3300009545 | Ga0105237_10063677 | Ga0105237_100636772 | 355 |
| 463 | 3300009551 | Ga0105238_10006897 | Ga0105238_100068977 | 355 |
| 464 | 3300009551 | Ga0105238_10012634 | Ga0105238_100126343 | 355 |
| 465 | 3300009553 | Ga0105249_10001094 | Ga0105249_100010944 | 355 |
| 466 | 3300010375 | Ga0105239_10008003 | Ga0105239_100080036 | 355 |
| 467 | 3300014326 | Ga0157380_10072980 | Ga0157380_100729802 | 355 |
| 468 | 3300014969 | Ga0157376_10348882 | Ga0157376_103488822 | 355 |
| 469 | 3300017792 | Ga0163161_10164275 | Ga0163161_101642751 | 355 |
| 470 | 3300021377 | Ga0213874_10050651 | Ga0213874_100506512 | 355 |
| 471 | 3300025297 | Ga0209758_1000063 | Ga0209758_1000063212 | 355 |
| 472 | 3300025898 | Ga0207692_10101611 | Ga0207692_101016112 | 355 |
| 473 | 3300025906 | Ga0207699_10102097 | Ga0207699_101020972 | 355 |
| 474 | 3300025906 | Ga0207699_10143742 | Ga0207699_101437422 | 355 |
| 475 | 3300025911 | Ga0207654_10000163 | Ga0207654_100001639 | 355 |
| 476 | 3300025913 | Ga0207695_10001114 | Ga0207695_1000111412 | 355 |
| 477 | 3300025915 | Ga0207693_10059148 | Ga0207693_100591482 | 355 |
| 478 | 3300025915 | Ga0207693_10178799 | Ga0207693_101787992 | 355 |
| 479 | 3300025916 | Ga0207663_10016595 | Ga0207663_100165953 | 355 |
| 480 | 3300025924 | Ga0207694_10000050 | Ga0207694_1000005059 | 355 |
| 481 | 3300025926 | Ga0207659_10280621 | Ga0207659_102806212 | 355 |
| 482 | 3300025928 | Ga0207700_10015855 | Ga0207700_100158552 | 355 |
| 483 | 3300025929 | Ga0207664_10305043 | Ga0207664_103050431 | 355 |
| 484 | 3300025939 | Ga0207665_10047708 | Ga0207665_100477082 | 355 |
| 485 | 3300025949 | Ga0207667_10011990 | Ga0207667_100119904 | 355 |
| 486 | 3300025981 | Ga0207640_10004789 | Ga0207640_100047894 | 355 |
| 487 | 3300026041 | Ga0207639_10148927 | Ga0207639_101489272 | 355 |
| 488 | 3300026078 | Ga0207702_10000002 | Ga0207702_10000002169 | 355 |
| 489 | 3300026116 | Ga0207674_10002309 | Ga0207674_100023094 | 355 |
| 490 | 3300026142 | Ga0207698_10068293 | Ga0207698_100682932 | 355 |
| 491 | 3300027907 | Ga0207428_10015926 | Ga0207428_100159263 | 355 |
| 492 | 3300031240 | Ga0265320_10095073 | Ga0265320_100950731 | 355 |
| 493 | 3300031241 | Ga0265325_10000039 | Ga0265325_1000003971 | 355 |
| 494 | 3300031241 | Ga0265325_10045215 | Ga0265325_100452151 | 355 |
| 495 | 3300031456 | Ga0307513_10031402 | Ga0307513_100314023 | 355 |
| 496 | 3300031595 | Ga0265313_10001740 | Ga0265313_1000174015 | 355 |
| 497 | 3300031711 | Ga0265314_10027454 | Ga0265314_100274545 | 355 |
| 498 | 3300031824 | Ga0307413_10028287 | Ga0307413_100282872 | 355 |
| 499 | 3300031901 | Ga0307406_10102174 | Ga0307406_101021742 | 355 |
| 500 | 3300031995 | Ga0307409_100354081 | Ga0307409_1003540812 | 355 |
| 501 | 3300032002 | Ga0307416_100042136 | Ga0307416_1000421362 | 355 |
| 502 | 3300032004 | Ga0307414_10238809 | Ga0307414_102388091 | 355 |
| 503 | 3300032126 | Ga0307415_100138643 | Ga0307415_1001386431 | 355 |
| 504 | 3300035113 | Ga0373936_0005520 | Ga0373936_0005520_559_1647 | 355 |
| 505 | 3300035116 | Ga0373945_0009031 | Ga0373945_0009031_869_1957 | 355 |
| 506 | 3300035118 | Ga0373954_0006497 | Ga0373954_0006497_1893_2981 | 355 |
| 507 | 3300035170 | Ga0373943_0003579 | Ga0373943_0003579_2391_3479 | 355 |
| 508 | 3300035171 | Ga0373946_0005136 | Ga0373946_0005136_3358_4446 | 355 |
| 509 | 3300035172 | Ga0373955_0000983 | Ga0373955_0000983_5806_6894 | 355 |
| 510 | 3300035410 | Ga0373924_0000772 | Ga0373924_0000772_5753_6841 | 355 |
| 511 | 3300035691 | Ga0373931_0063275 | Ga0373931_0063275_404_1513 | 355 |
| 512 | 3300035692 | Ga0373935_0000013 | Ga0373935_0000013_65575_66663 | 355 |
| 513 | 3300035695 | Ga0373927_0221991 | Ga0373927_0221991_62_1150 | 355 |
| 514 | 3300035724 | Ga0373933_0001422 | Ga0373933_0001422_7191_8279 | 355 |
| 515 | 3300035725 | Ga0373947_0002476 | Ga0373947_0002476_2187_3275 | 355 |
| 516 | 3300035725 | Ga0373947_0216430 | Ga0373947_0216430_153_1244 | 355 |
| 517 | 3300035725 | Ga0373947_0247881 | Ga0373947_0247881_51_1157 | 355 |
| 518 | 3300036401 | Ga0373937_0000018 | Ga0373937_0000018_109281_110369 | 355 |
| 519 | 3300037068 | Ga0373925_0000896 | Ga0373925_0000896_25449_26537 | 355 |
| 520 | 3300037853 | Ga0436364_0908210 | Ga0436364_0908210_1739_2827 | 355 |
| 521 | 3300037853 | Ga0436364_1137908 | Ga0436364_1137908_172_1296 | 355 |
| 522 | 3300039447 | Ga0436361_0662672 | Ga0436361_0662672_1172_2260 | 355 |
| 523 | 3300044694 | Ga0466963_0185202 | Ga0466963_0185202_239_1327 | 355 |
| 524 | 3300046454 | Ga0495592_0000055 | Ga0495592_0000055_69260_70348 | 355 |
| 525 | 3300046459 | Ga0495629_0008326 | Ga0495629_0008326_3196_4284 | 355 |
| 526 | 3300046463 | Ga0495653_0000003 | Ga0495653_0000003_209127_210215 | 355 |
| 527 | 3300046476 | Ga0495662_0000609 | Ga0495662_0000609_5816_6904 | 355 |
| 528 | 3300046477 | Ga0495664_0000001 | Ga0495664_0000001_540417_541505 | 355 |
| 529 | 3300046511 | Ga0495608_0000012 | Ga0495608_0000012_25447_26535 | 355 |
| 530 | 3300046514 | Ga0495618_0000012 | Ga0495618_0000012_109669_110757 | 355 |
| 531 | 3300046516 | Ga0495628_0000003 | Ga0495628_0000003_371601_372689 | 355 |
| 532 | 3300046517 | Ga0495630_0000188 | Ga0495630_0000188_25136_26224 | 355 |
| 533 | 3300046529 | Ga0495652_0000001 | Ga0495652_0000001_285660_286748 | 355 |
| 534 | 3300046533 | Ga0495640_0000022 | Ga0495640_0000022_29650_30738 | 355 |
| 535 | 3300046533 | Ga0495640_0073796 | Ga0495640_0073796_804_1910 | 355 |
| 536 | 3300046536 | Ga0495587_0000003 | Ga0495587_0000003_206751_207839 | 355 |
| 537 | 3300046543 | Ga0495645_0000004 | Ga0495645_0000004_433923_435011 | 355 |
| 538 | 3300046559 | Ga0495667_0000001 | Ga0495667_0000001_125460_126548 | 355 |
| 539 | 3300046642 | Ga0495634_0000012 | Ga0495634_0000012_67884_68972 | 355 |
| 540 | 3300046663 | Ga0495635_0000011 | Ga0495635_0000011_167919_169007 | 355 |
| 541 | 3300046675 | Ga0495657_0000086 | Ga0495657_0000086_65137_66225 | 355 |
| 542 | 3300046678 | Ga0495599_0000004 | Ga0495599_0000004_170174_171262 | 355 |
| 543 | 3300046679 | Ga0495623_0000044 | Ga0495623_0000044_63325_64413 | 355 |
| 544 | 3300046680 | Ga0495646_0000010 | Ga0495646_0000010_168755_169843 | 355 |
| 545 | 3300046689 | Ga0495613_0136820 | Ga0495613_0136820_416_1504 | 355 |
| 546 | 3300046690 | Ga0495624_0076213 | Ga0495624_0076213_516_1604 | 355 |
| 547 | 3300046809 | Ga0495600_0000026 | Ga0495600_0000026_25472_26560 | 355 |
| 548 | 3300047317 | Ga0495604_0000010 | Ga0495604_0000010_25471_26559 | 355 |
| 549 | 3300047319 | Ga0495674_0000001 | Ga0495674_0000001_740354_741442 | 355 |
| 550 | 3300047322 | Ga0495680_0000527 | Ga0495680_0000527_7597_8685 | 355 |
| 551 | 3300047444 | Ga0495675_0000009 | Ga0495675_0000009_38261_39349 | 355 |
| 552 | 3300047471 | Ga0495684_0000005 | Ga0495684_0000005_84201_85289 | 355 |
| 553 | 3300047673 | Ga0495593_0003117 | Ga0495593_0003117_7736_8824 | 355 |
| 554 | 3300048088 | Ga0495602_0000002 | Ga0495602_0000002_283897_284985 | 355 |
| 555 | 3300048907 | Ga0496104_0034931 | Ga0496104_0034931_3467_4555 | 355 |
| 556 | 3300048929 | Ga0496126_0010006 | Ga0496126_0010006_6384_7472 | 355 |
| 557 | 3300049571 | Ga0501034_0298504 | Ga0501034_0298504_449_1537 | 355 |
| 558 | 3300049579 | Ga0501043_0201896 | Ga0501043_0201896_389_1477 | 355 |
| 559 | 3300049581 | Ga0501047_0017460 | Ga0501047_0017460_5342_6430 | 355 |
| 560 | 3300049581 | Ga0501047_0033040 | Ga0501047_0033040_2985_4073 | 355 |
| 561 | 3300049583 | Ga0501067_0096874 | Ga0501067_0096874_202_1290 | 355 |
| 562 | 3300049585 | Ga0501069_0075159 | Ga0501069_0075159_287_1375 | 355 |
| 563 | 3300049585 | Ga0501069_0098747 | Ga0501069_0098747_557_1645 | 355 |
| 564 | 3300049586 | Ga0501070_0025347 | Ga0501070_0025347_2181_3269 | 355 |
| 565 | 3300049586 | Ga0501070_0040560 | Ga0501070_0040560_443_1531 | 355 |
| 566 | 3300049587 | Ga0501071_0166946 | Ga0501071_0166946_15_1103 | 355 |
| 567 | 3300049588 | Ga0501072_0163351 | Ga0501072_0163351_132_1220 | 355 |
| 568 | 3300049591 | Ga0501075_0271156 | Ga0501075_0271156_180_1268 | 355 |
| 569 | 3300049741 | Ga0501079_0104000 | Ga0501079_0104000_56_1144 | 355 |
| 570 | 3300049742 | Ga0501080_0182138 | Ga0501080_0182138_471_1559 | 355 |
| 571 | 3300049822 | Ga0501035_0030975 | Ga0501035_0030975_1465_2553 | 355 |
| 572 | 3300049822 | Ga0501035_0052307 | Ga0501035_0052307_390_1478 | 355 |
| 573 | 3300050489 | nmdc:mga03683_409_c1 | nmdc:mga03683_409_c1_10378_11484 | 355 |
| 574 | 3300050493 | nmdc:mga0k408_58927_c1 | nmdc:mga0k408_58927_c1_1062_2150 | 355 |
| 575 | 3300050507 | nmdc:mga05p37_586_c1 | nmdc:mga05p37_586_c1_14704_15792 | 355 |
| 576 | 3300050508 | nmdc:mga09592_1648_c1 | nmdc:mga09592_1648_c1_1177_2265 | 355 |
| 577 | 3300050509 | nmdc:mga0qj67_20412_c1 | nmdc:mga0qj67_20412_c1_2818_3906 | 355 |
| 578 | 3300050510 | nmdc:mga06r32_1924_c1 | nmdc:mga06r32_1924_c1_2700_3788 | 355 |
| 579 | 3300050511 | nmdc:mga08y16_204258_c1 | nmdc:mga08y16_204258_c1_270_1379 | 355 |
| 580 | 3300050511 | nmdc:mga08y16_4668_c1 | nmdc:mga08y16_4668_c1_10567_11655 | 355 |
| 581 | 3300050513 | nmdc:mga0rr50_16629_c1 | nmdc:mga0rr50_16629_c1_1248_2456 | 355 |
| 582 | 3300050514 | nmdc:mga08x19_148817_c1 | nmdc:mga08x19_148817_c1_268_1371 | 355 |
| 583 | 3300053077 | Ga0495601_0000003 | Ga0495601_0000003_285786_286874 | 355 |
| 584 | 3300053078 | Ga0495612_0000009 | Ga0495612_0000009_216225_217313 | 355 |
| 585 | 3300053084 | Ga0495595_0000011 | Ga0495595_0000011_7984_9072 | 355 |
| 586 | 3300053085 | Ga0495619_0000009 | Ga0495619_0000009_206857_207945 | 355 |
| 587 | 3300053085 | Ga0495619_0051636 | Ga0495619_0051636_1089_2180 | 355 |
| 588 | 3300053088 | Ga0500644_0034055 | Ga0500644_0034055_492_1592 | 355 |
| 589 | 3300053158 | Ga0500627_0086686 | Ga0500627_0086686_300_1388 | 355 |
| 590 | 3300054114 | Ga0501084_0272945 | Ga0501084_0272945_163_1251 | 355 |
| 591 | 3300061734 | Ga0530510_0291638 | Ga0530510_0291638_20_1108 | 355 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hzl-assembly1.cif.gz_A | crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms | 0.9666 | 24 | 355 |
| 4pet-assembly1.cif.gz_B | crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate | 0.9661 | 23 | 346 |
| 4yzz-assembly1.cif.gz_A | crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site | 0.9598 | 21 | 354 |
| 2hzl-assembly1.cif.gz_A | crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms | 0.9581 | 24 | 355 |
| 7ug8-assembly1.cif.gz_A | crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium | 0.9546 | 20 | 346 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2hzkC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9828 | 24 | 350 | 3.40.190.170 |
| 4yzzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9711 | 21 | 351 | 3.40.190.170 |
| 2hzkC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.9691 | 24 | 350 | 3.40.190.170 |
| 4yzzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 | 0.958 | 21 | 351 | 3.40.190.170 |
| 4petB02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9439 | 148 | 314 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658ABT6-F1-model_v4 | deleted | 0.9905 | 23 | 350 |
|
| AF-A0A0D7EEV2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9797 | 24 | 355 |
GO:0015849
GO:0031317 GO:0043177 GO:0046872 GO:0055085 |
| AF-A0A0D7EEV2-F1-model_v4 | ABC transporter substrate-binding protein | 0.9768 | 24 | 355 |
GO:0015849
GO:0031317 GO:0043177 GO:0046872 GO:0055085 |
| AF-A0A3N5FTX4-F1-model_v4 | ABC transporter substrate-binding protein | 0.9766 | 42 | 348 |
GO:0055085
|
| AF-A0A537VVV0-F1-model_v4 | ABC transporter substrate-binding protein | 0.9745 | 66 | 350 |
GO:0055085
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar