F467091

General Info

Members Datasets Scaffolds Average Seq Length
591 325 565 358

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_16629_c1|nmdc:mga0rr50_16629_c1_1248_2456
Length 402
Sequence LDKRLIAALKRRTETTPRRQTGGRDAMCRARLNAIRRVFSMKRREFLGAAGAGFTASVLAAPALAQSSPEIKWRCTSSFPKSLDTLYGAAEVFAKAVGEATDNRFQIQVFAAGEIVPGLQAADAVGNGTVEMAHTASYYYVGKDPTFAMATAQPFGLNSRMQSAWMHFGGGIDSFNEFYKKYNFLALPAGNTGCQMGGWFRKEIKQPEDLNGLKFRIAGFAGRILQKLGTVPQQLAGGDIYPALEKGTIDAAEWVGPYDDEKLGFQKVAQFYYYPGWWEGGAMLHNFINLEKWQALPKNYQAIIRSASEQAHTWMQAKYDAGNPAALKRLVANGAQLRPFPQPVLEACYKAATDTYGEISAASAEFKKIHDSIMAFRGDQYLWWQVAEYGFDNFMIRQRARG

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
4 2547132512 Azospira oryzae 6a3 Isolate Unclassified
5 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
6 2643221736 Bosea sp. Root483D1 Isolate Unclassified
7 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
8 2841760612 Bosea sp. Tri-49 Isolate Nodule
9 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
10 2844104063 Bosea sp. Tri-39 Isolate Nodule
11 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
12 2851182111 Bosea sp. Tri-44 Isolate Nodule
13 2851246043 Bosea sp. Tri-54 Isolate Nodule
14 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
15 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
165 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
166 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
190 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
222 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
250 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
315 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
316 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
317 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
320 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
324 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
325 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.12
Metatranscriptomes 0
Isolates 2.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 1.35
Rhizoplane 0.85
Rhizosphere 84.77
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000638 3300001979 Bacteria 15126
2 JGI25159J45721_1002032 3300002987 Bacteria 8005
3 JGI25406J46586_10002392 3300003203 Bacteria 8870
4 JGI25153J46596_10006619 3300003215 Bacteria 5835
5 JGI25404J52841_10000386 3300003659 Bacteria 6065
6 Ga0065165_1000218 3300005262 Bacteria 100161
7 Ga0065704_10093776 3300005289 Bacteria 2579
8 Ga0070658_10005001 3300005327 Bacteria 10795
9 Ga0070658_10005554 3300005327 Bacteria 10230
10 Ga0070658_10017407 3300005327 Bacteria 5750
11 Ga0070658_10281067 3300005327 Bacteria 1417
12 Ga0070666_10123734 3300005335 Bacteria 1794
13 Ga0070680_100001108 3300005336 Bacteria 19337
14 Ga0070680_100003405 3300005336 Bacteria 11876
15 Ga0068868_100196902 3300005338 Bacteria 1678
16 Ga0068868_100203183 3300005338 Bacteria 1653
17 Ga0070660_100015257 3300005339 Bacteria 5543
18 Ga0070660_100068474 3300005339 Bacteria 2767
19 Ga0070689_100133228 3300005340 Bacteria 1994
20 Ga0070689_100142701 3300005340 Bacteria 1927
21 Ga0070691_10093064 3300005341 Bacteria 1488
22 Ga0070668_100000766 3300005347 Bacteria 22083
23 Ga0070668_100060258 3300005347 Bacteria 2939
24 Ga0070675_100047938 3300005354 Bacteria 3502
25 Ga0070675_100268608 3300005354 Bacteria 1496
26 Ga0070675_100323947 3300005354 Bacteria 1362
27 Ga0070688_100177535 3300005365 Bacteria 1475
28 Ga0070667_100239869 3300005367 Bacteria 1618
29 Ga0070709_10056242 3300005434 Bacteria 2487
30 Ga0070709_10101581 3300005434 Bacteria 1917
31 Ga0070709_10218905 3300005434 Bacteria 1357
32 Ga0070714_100014985 3300005435 Bacteria 6232
33 Ga0070714_100040203 3300005435 Bacteria 3941
34 Ga0070714_100097401 3300005435 Bacteria 2586
35 Ga0070713_100001555 3300005436 Bacteria 14678
36 Ga0070713_100031411 3300005436 Bacteria 4230
37 Ga0070710_10067082 3300005437 Bacteria 2058
38 Ga0070711_100016017 3300005439 Bacteria 4752
39 Ga0070711_100018729 3300005439 Bacteria 4427
40 Ga0070711_100205342 3300005439 Bacteria 1523
41 Ga0070663_100117437 3300005455 Bacteria 2006
42 Ga0070662_100204957 3300005457 Bacteria 1567
43 Ga0070681_10009265 3300005458 Bacteria 9680
44 Ga0070681_10045176 3300005458 Bacteria 4408
45 Ga0070681_10152140 3300005458 Bacteria 2240
46 Ga0070699_100001182 3300005518 Bacteria 24181
47 Ga0070679_100047946 3300005530 Bacteria 4257
48 Ga0070679_100067237 3300005530 Bacteria 3574
49 Ga0070679_100153515 3300005530 Bacteria 2278
50 Ga0068853_100066065 3300005539 Bacteria 3140
51 Ga0070695_100125940 3300005545 Bacteria 1759
52 Ga0070696_100047064 3300005546 Bacteria 2992
53 Ga0070665_100016716 3300005548 Bacteria 7353
54 Ga0070665_100146937 3300005548 Bacteria 2360
55 Ga0068855_100011086 3300005563 Bacteria 10877
56 Ga0068855_100021711 3300005563 Bacteria 7698
57 Ga0068855_100030635 3300005563 Bacteria 6432
58 Ga0068855_100062035 3300005563 Bacteria 4365
59 Ga0070664_100214447 3300005564 Bacteria 1721
60 Ga0068857_100044064 3300005577 Bacteria 3957
61 Ga0068857_100166180 3300005577 Bacteria 2004
62 Ga0068854_100005953 3300005578 Bacteria 7725
63 Ga0068854_100021941 3300005578 Bacteria 4340
64 Ga0068856_100111390 3300005614 Bacteria 2734
65 Ga0068856_100240808 3300005614 Bacteria 1824
66 Ga0068852_100275492 3300005616 Bacteria 1620
67 Ga0068851_10002111 3300005834 Bacteria 8743
68 Ga0068858_100238476 3300005842 Bacteria 1725
69 Ga0068860_100006084 3300005843 Bacteria 12143
70 Ga0068860_100104011 3300005843 Bacteria 2711
71 Ga0068860_100185815 3300005843 Bacteria 2010
72 Ga0081455_10001801 3300005937 Bacteria 25856
73 Ga0081455_10003377 3300005937 Bacteria 18403
74 Ga0081455_10029006 3300005937 Bacteria 5049
75 Ga0081455_10045312 3300005937 Bacteria 3828
76 Ga0081538_10034440 3300005981 Bacteria 3348
77 Ga0081540_1000008 3300005983 Bacteria 203702
78 Ga0081540_1001504 3300005983 Bacteria 20051
79 Ga0081539_10000101 3300005985 Bacteria 198612
80 Ga0081539_10003832 3300005985 Bacteria 17662
81 Ga0075365_10016973 3300006038 Bacteria 4445
82 Ga0075368_10016573 3300006042 Bacteria 2747
83 Ga0075363_100004780 3300006048 Bacteria 5970
84 Ga0070715_10007530 3300006163 Bacteria 3752
85 Ga0070712_100224077 3300006175 Bacteria 1490
86 Ga0075362_10006572 3300006177 Bacteria 4341
87 Ga0075362_10011334 3300006177 Bacteria 3510
88 Ga0075362_10019885 3300006177 Bacteria 2799
89 Ga0075362_10058980 3300006177 Bacteria 1732
90 Ga0075367_10030264 3300006178 Bacteria 3102
91 Ga0075367_10095334 3300006178 Bacteria 1815
92 Ga0075369_10001445 3300006186 Bacteria 8107
93 Ga0075369_10013806 3300006186 Bacteria 3214
94 Ga0075369_10022060 3300006186 Bacteria 2624
95 Ga0075369_10022961 3300006186 Bacteria 2576
96 Ga0075366_10000552 3300006195 Bacteria 17460
97 Ga0075366_10081187 3300006195 Bacteria 1937
98 Ga0097621_100019769 3300006237 Bacteria 5178
99 Ga0075370_10019433 3300006353 Bacteria 3700
100 Ga0075370_10028419 3300006353 Bacteria 3109
101 Ga0075370_10043877 3300006353 Bacteria 2528
102 Ga0075428_100001096 3300006844 Bacteria 28836
103 Ga0075428_100229121 3300006844 Bacteria 2005
104 Ga0075428_100529850 3300006844 Bacteria 1260
105 Ga0075430_100021252 3300006846 Bacteria 5518
106 Ga0075431_100002284 3300006847 Bacteria 18392
107 Ga0075433_10003438 3300006852 Bacteria 12216
108 Ga0075433_10050303 3300006852 Bacteria 3627
109 Ga0075433_10182893 3300006852 Bacteria 1865
110 Ga0075434_100000268 3300006871 Bacteria 37082
111 Ga0075434_100144742 3300006871 Bacteria 2397
112 Ga0075434_100171033 3300006871 Bacteria 2193
113 Ga0075429_100026528 3300006880 Bacteria 5032
114 Ga0075429_100276051 3300006880 Bacteria 1472
115 Ga0068865_100075257 3300006881 Bacteria 2407
116 Ga0075436_100113703 3300006914 Bacteria 1890
117 Ga0075435_100014848 3300007076 Bacteria 5840
118 Ga0075435_100109420 3300007076 Bacteria 2297
119 Ga0099794_10013479 3300007265 Bacteria 3559
120 Ga0099794_10052267 3300007265 Bacteria 1969
121 Ga0099795_10018985 3300007788 Bacteria 2218
122 Ga0099795_10026446 3300007788 Bacteria 1955
123 Ga0105240_10004293 3300009093 Bacteria 21772
124 Ga0105240_10014218 3300009093 Bacteria 10871
125 Ga0105240_10082544 3300009093 Bacteria 3947
126 Ga0111539_10000835 3300009094 Bacteria 40036
127 Ga0111539_10012926 3300009094 Bacteria 10447
128 Ga0114129_10003226 3300009147 Bacteria 22877
129 Ga0114129_10005100 3300009147 Bacteria 18497
130 Ga0114129_10167375 3300009147 Bacteria 2998
131 Ga0105241_10007599 3300009174 Bacteria 7969
132 Ga0105242_10003626 3300009176 Bacteria 12016
133 Ga0105242_10123007 3300009176 Bacteria 2230
134 Ga0105248_10004953 3300009177 Bacteria 14715
135 Ga0105237_10046872 3300009545 Bacteria 4346
136 Ga0105237_10063677 3300009545 Bacteria 3686
137 Ga0105238_10006897 3300009551 Bacteria 11342
138 Ga0105238_10012634 3300009551 Bacteria 8523
139 Ga0105238_10041790 3300009551 Bacteria 4643
140 Ga0105238_10099672 3300009551 Bacteria 2888
141 Ga0105249_10001094 3300009553 Bacteria 24097
142 Ga0099796_10017643 3300010159 Bacteria 2129
143 Ga0105239_10008003 3300010375 Bacteria 12065
144 Ga0157373_10073590 3300013100 Bacteria 2411
145 Ga0157370_10030206 3300013104 Bacteria 5312
146 Ga0157369_10085056 3300013105 Bacteria 3380
147 Ga0157369_10111880 3300013105 Bacteria 2902
148 Ga0157369_10181167 3300013105 Bacteria 2216
149 Ga0157374_10051238 3300013296 Bacteria 3840
150 Ga0163162_10169417 3300013306 Bacteria 2308
151 Ga0157375_10047413 3300013308 Bacteria 4196
152 Ga0157380_10072980 3300014326 Bacteria 2781
153 Ga0157380_10119753 3300014326 Bacteria 2227
154 Ga0157380_10247031 3300014326 Bacteria 1613
155 Ga0182008_10047960 3300014497 Bacteria 2122
156 Ga0157379_10244174 3300014968 Bacteria 1629
157 Ga0157376_10009491 3300014969 Bacteria 7068
158 Ga0157376_10131508 3300014969 Bacteria 2234
159 Ga0157376_10348882 3300014969 Bacteria 1416
160 Ga0163161_10164275 3300017792 Bacteria 1694
161 Ga0213874_10050651 3300021377 Bacteria 1273
162 Ga0213876_10050181 3300021384 Bacteria 2204
163 Ga0209130_1000632 3300025284 Bacteria 33065
164 Ga0209025_1001538 3300025294 Bacteria 29419
165 Ga0209758_1000063 3300025297 Bacteria 315999
166 Ga0207426_1003065 3300025302 Bacteria 9614
167 Ga0207692_10101611 3300025898 Bacteria 1579
168 Ga0207680_10053481 3300025903 Bacteria 2424
169 Ga0207699_10102097 3300025906 Bacteria 1822
170 Ga0207699_10137891 3300025906 Bacteria 1600
171 Ga0207699_10143742 3300025906 Bacteria 1570
172 Ga0207705_10042643 3300025909 Bacteria 3258
173 Ga0207654_10000163 3300025911 Bacteria 42749
174 Ga0207707_10010597 3300025912 Bacteria 8006
175 Ga0207707_10029619 3300025912 Bacteria 4786
176 Ga0207707_10127850 3300025912 Bacteria 2222
177 Ga0207695_10001114 3300025913 Bacteria 46680
178 Ga0207695_10300011 3300025913 Bacteria 1498
179 Ga0207695_10339153 3300025913 Bacteria 1391
180 Ga0207693_10034982 3300025915 Bacteria 3962
181 Ga0207693_10059148 3300025915 Bacteria 3002
182 Ga0207693_10178799 3300025915 Bacteria 1669
183 Ga0207663_10016595 3300025916 Bacteria 4087
184 Ga0207660_10024491 3300025917 Bacteria 4087
185 Ga0207660_10066810 3300025917 Bacteria 2602
186 Ga0207657_10023148 3300025919 Bacteria 5791
187 Ga0207657_10027346 3300025919 Bacteria 5225
188 Ga0207657_10079605 3300025919 Bacteria 2757
189 Ga0207652_10022043 3300025921 Bacteria 5264
190 Ga0207652_10046882 3300025921 Bacteria 3690
191 Ga0207681_10103054 3300025923 Bacteria 2062
192 Ga0207694_10000050 3300025924 Bacteria 159920
193 Ga0207694_10069194 3300025924 Bacteria 2758
194 Ga0207694_10097536 3300025924 Bacteria 2326
195 Ga0207694_10127730 3300025924 Bacteria 2035
196 Ga0207659_10070668 3300025926 Bacteria 2546
197 Ga0207659_10241067 3300025926 Bacteria 1463
198 Ga0207659_10280621 3300025926 Bacteria 1362
199 Ga0207700_10015855 3300025928 Bacteria 4986
200 Ga0207664_10305043 3300025929 Bacteria 1401
201 Ga0207644_10083365 3300025931 Bacteria 2367
202 Ga0207706_10108662 3300025933 Bacteria 2441
203 Ga0207686_10004471 3300025934 Bacteria 7490
204 Ga0207670_10020124 3300025936 Bacteria 4093
205 Ga0207670_10045131 3300025936 Bacteria 2920
206 Ga0207665_10047708 3300025939 Bacteria 2872
207 Ga0207691_10278867 3300025940 Bacteria 1438
208 Ga0207661_10071720 3300025944 Bacteria 2832
209 Ga0207667_10011990 3300025949 Bacteria 10034
210 Ga0207667_10017786 3300025949 Bacteria 7994
211 Ga0207667_10040449 3300025949 Bacteria 4964
212 Ga0207667_10091586 3300025949 Bacteria 3140
213 Ga0207651_10031281 3300025960 Bacteria 3400
214 Ga0207640_10004789 3300025981 Bacteria 7349
215 Ga0207640_10072100 3300025981 Bacteria 2329
216 Ga0207658_10304935 3300025986 Bacteria 1373
217 Ga0207639_10148927 3300026041 Bacteria 1958
218 Ga0207702_10000002 3300026078 Bacteria 491507
219 Ga0207702_10042471 3300026078 Bacteria 3814
220 Ga0207702_10302256 3300026078 Bacteria 1519
221 Ga0207641_10316481 3300026088 Bacteria 1479
222 Ga0207648_10126938 3300026089 Bacteria 2244
223 Ga0207674_10002309 3300026116 Bacteria 24153
224 Ga0207675_100104321 3300026118 Bacteria 2672
225 Ga0207683_10179708 3300026121 Bacteria 1918
226 Ga0207698_10068293 3300026142 Bacteria 2806
227 Ga0209179_1000633 3300027512 Bacteria 3733
228 Ga0209588_1026970 3300027671 Bacteria 1826
229 Ga0207428_10015926 3300027907 Bacteria 6484
230 Ga0207428_10160081 3300027907 Bacteria 1710
231 Ga0268266_10020714 3300028379 Bacteria 5605
232 Ga0268266_10094291 3300028379 Bacteria 2627
233 Ga0268264_10007444 3300028381 Bacteria 9137
234 Ga0265334_10027700 3300028573 Bacteria 2281
235 Ga0307515_10078976 3300028794 Bacteria 4318
236 Ga0265338_10063587 3300028800 Bacteria 3216
237 Ga0265330_10020797 3300031235 Bacteria 2998
238 Ga0265330_10044970 3300031235 Bacteria 1948
239 Ga0265332_10000024 3300031238 Bacteria 209663
240 Ga0265320_10095073 3300031240 Bacteria 1377
241 Ga0265325_10000039 3300031241 Bacteria 93014
242 Ga0265325_10045215 3300031241 Bacteria 2289
243 Ga0265340_10001019 3300031247 Bacteria 15981
244 Ga0265340_10061622 3300031247 Bacteria 1794
245 Ga0265339_10036439 3300031249 Bacteria 2753
246 Ga0265331_10045951 3300031250 Bacteria 2107
247 Ga0307513_10031402 3300031456 Bacteria 6016
248 Ga0307408_100049715 3300031548 Bacteria 3012
249 Ga0265313_10000522 3300031595 Bacteria 40272
250 Ga0265313_10001740 3300031595 Bacteria 20008
251 Ga0265313_10006264 3300031595 Bacteria 8479
252 Ga0265314_10027454 3300031711 Bacteria 4262
253 Ga0265342_10000866 3300031712 Bacteria 30217
254 Ga0265342_10009117 3300031712 Bacteria 7029
255 Ga0265342_10009921 3300031712 Bacteria 6659
256 Ga0307405_10003576 3300031731 Bacteria 7177
257 Ga0307413_10028287 3300031824 Bacteria 3120
258 Ga0307410_10005404 3300031852 Bacteria 6757
259 Ga0307406_10001441 3300031901 Bacteria 13157
260 Ga0307406_10102174 3300031901 Bacteria 1955
261 Ga0307412_10012673 3300031911 Bacteria 4920
262 Ga0307409_100354081 3300031995 Bacteria 1386
263 Ga0307416_100042136 3300032002 Bacteria 3561
264 Ga0307416_100096228 3300032002 Bacteria 2559
265 Ga0307416_100457163 3300032002 Bacteria 1331
266 Ga0307414_10015498 3300032004 Bacteria 4601
267 Ga0307414_10238809 3300032004 Bacteria 1503
268 Ga0307415_100046549 3300032126 Bacteria 2914
269 Ga0307415_100138643 3300032126 Bacteria 1854
270 Ga0373958_0007352 3300034819 Bacteria 1752
271 Ga0373938_0011460 3300034957 Bacteria 1649
272 Ga0373934_0000181 3300035086 Bacteria 23031
273 Ga0373934_0007531 3300035086 Bacteria 4041
274 Ga0373923_0096086 3300035111 Bacteria 1301
275 Ga0373932_0005780 3300035112 Bacteria 2913
276 Ga0373936_0005520 3300035113 Bacteria 4772
277 Ga0373945_0009031 3300035116 Bacteria 3257
278 Ga0373945_0047533 3300035116 Bacteria 1570
279 Ga0373954_0000484 3300035118 Bacteria 14925
280 Ga0373954_0001302 3300035118 Bacteria 10041
281 Ga0373954_0006497 3300035118 Bacteria 5099
282 Ga0373954_0126137 3300035118 Bacteria 1244
283 Ga0373956_0000230 3300035119 Bacteria 22178
284 Ga0373957_0005517 3300035120 Bacteria 3923
285 Ga0373957_0018188 3300035120 Bacteria 2457
286 Ga0373943_0003579 3300035170 Bacteria 7068
287 Ga0373943_0042792 3300035170 Bacteria 2196
288 Ga0373946_0005136 3300035171 Bacteria 4718
289 Ga0373955_0000983 3300035172 Bacteria 12101
290 Ga0373955_0013434 3300035172 Bacteria 3962
291 Ga0373961_0011600 3300035241 Bacteria 2189
292 Ga0373962_0006082 3300035242 Bacteria 2918
293 Ga0373924_0000772 3300035410 Bacteria 9945
294 Ga0373931_0000995 3300035691 Bacteria 11966
295 Ga0373931_0063275 3300035691 Bacteria 1999
296 Ga0373935_0000013 3300035692 Bacteria 78986
297 Ga0373935_0057427 3300035692 Bacteria 2483
298 Ga0373935_0066943 3300035692 Bacteria 2308
299 Ga0373927_0052552 3300035695 Bacteria 2636
300 Ga0373927_0221991 3300035695 Bacteria 1241
301 Ga0373933_0000550 3300035724 Bacteria 23385
302 Ga0373933_0001422 3300035724 Bacteria 14036
303 Ga0373947_0002476 3300035725 Bacteria 11109
304 Ga0373947_0085047 3300035725 Bacteria 1964
305 Ga0373947_0216430 3300035725 Bacteria 1258
306 Ga0373947_0247881 3300035725 Bacteria 1177
307 Ga0373937_0000018 3300036401 Bacteria 144056
308 Ga0373937_0001239 3300036401 Bacteria 21457
309 Ga0373925_0000896 3300037068 Bacteria 27189
310 Ga0373925_0119643 3300037068 Bacteria 2043
311 Ga0395899_0005212 3300037312 Bacteria 10109
312 Ga0395899_0064694 3300037312 Bacteria 2688
313 Ga0395900_0009382 3300037418 Bacteria 10032
314 Ga0395900_0057991 3300037418 Bacteria 3986
315 Ga0395898_0060800 3300037466 Bacteria 3670
316 Ga0395898_0078361 3300037466 Bacteria 3188
317 Ga0436364_0908210 3300037853 Bacteria 3290
318 Ga0436364_1137908 3300037853 Bacteria 3127
319 Ga0395901_0034031 3300038443 Bacteria 5261
320 Ga0395901_0075344 3300038443 Bacteria 3520
321 Ga0395901_0120069 3300038443 Bacteria 2762
322 Ga0395901_0201832 3300038443 Bacteria 2084
323 Ga0395901_0701831 3300038443 Bacteria 1009
324 Ga0237819_05544 3300038705 Bacteria 1969
325 Ga0436365_0545507 3300039437 Bacteria 9061
326 Ga0436365_0676191 3300039437 Bacteria 8736
327 Ga0436365_0778617 3300039437 Bacteria 3707
328 Ga0436360_0050781 3300039438 Bacteria 1448
329 Ga0436361_0431311 3300039447 Bacteria 1194
330 Ga0436361_0662672 3300039447 Bacteria 2599
331 Ga0436363_0981136 3300039450 Bacteria 1495
332 Ga0436363_1230191 3300039450 Bacteria 1135
333 Ga0436362_0613027 3300039453 Bacteria 1495
334 Ga0466966_0034794 3300044684 Bacteria 3257
335 Ga0466963_0006552 3300044694 Bacteria 6895
336 Ga0466963_0021600 3300044694 Bacteria 4064
337 Ga0466963_0185202 3300044694 Bacteria 1454
338 Ga0466957_0127269 3300044842 Bacteria 1628
339 Ga0466959_0056197 3300045049 Bacteria 2872
340 Ga0451576_0000108 3300045051 Bacteria 211233
341 Ga0466958_0148695 3300045836 Bacteria 1477
342 Ga0466967_0013018 3300045976 Bacteria 6401
343 Ga0495592_0000055 3300046454 Bacteria 106223
344 Ga0495592_0000986 3300046454 Bacteria 19759
345 Ga0495592_0019632 3300046454 Bacteria 5141
346 Ga0495592_0090294 3300046454 Bacteria 2198
347 Ga0495592_0103479 3300046454 Bacteria 2025
348 Ga0495629_0008326 3300046459 Bacteria 7625
349 Ga0495638_0076678 3300046460 Bacteria 2037
350 Ga0495641_0039857 3300046461 Bacteria 2187
351 Ga0495651_0000574 3300046462 Bacteria 28532
352 Ga0495651_0010233 3300046462 Bacteria 7200
353 Ga0495651_0061597 3300046462 Bacteria 2872
354 Ga0495653_0000003 3300046463 Bacteria 377892
355 Ga0495580_0064973 3300046472 Bacteria 2556
356 Ga0495582_0024697 3300046473 Bacteria 3289
357 Ga0495639_0002813 3300046475 Bacteria 7570
358 Ga0495662_0000609 3300046476 Bacteria 16550
359 Ga0495662_0106553 3300046476 Bacteria 1372
360 Ga0495664_0000001 3300046477 Bacteria 757730
361 Ga0495664_0006073 3300046477 Bacteria 6663
362 Ga0495594_0042136 3300046499 Bacteria 2500
363 Ga0495608_0000012 3300046511 Bacteria 242758
364 Ga0495608_0065000 3300046511 Bacteria 2390
365 Ga0495618_0000012 3300046514 Bacteria 170881
366 Ga0495628_0000003 3300046516 Bacteria 470339
367 Ga0495628_0000543 3300046516 Bacteria 34700
368 Ga0495628_0008478 3300046516 Bacteria 8813
369 Ga0495628_0032842 3300046516 Bacteria 4186
370 Ga0495630_0000188 3300046517 Bacteria 48229
371 Ga0495630_0027942 3300046517 Bacteria 4190
372 Ga0495666_0004396 3300046526 Bacteria 7122
373 Ga0495652_0000001 3300046529 Bacteria 1045081
374 Ga0495652_0017093 3300046529 Bacteria 6478
375 Ga0495652_0134092 3300046529 Bacteria 1956
376 Ga0495665_0004364 3300046531 Bacteria 7637
377 Ga0495640_0000022 3300046533 Bacteria 101825
378 Ga0495640_0073796 3300046533 Bacteria 2283
379 Ga0495640_0082502 3300046533 Bacteria 2134
380 Ga0495587_0000003 3300046536 Bacteria 424188
381 Ga0495587_0027921 3300046536 Bacteria 3436
382 Ga0495645_0000004 3300046543 Bacteria 532661
383 Ga0495645_0000148 3300046543 Bacteria 48244
384 Ga0495667_0000001 3300046559 Bacteria 834831
385 Ga0495667_0021082 3300046559 Bacteria 4396
386 Ga0495634_0000012 3300046642 Bacteria 131341
387 Ga0495635_0000011 3300046663 Bacteria 240094
388 Ga0495657_0000086 3300046675 Bacteria 81806
389 Ga0495657_0024810 3300046675 Bacteria 4265
390 Ga0495599_0000004 3300046678 Bacteria 316231
391 Ga0495599_0000218 3300046678 Bacteria 36747
392 Ga0495599_0014737 3300046678 Bacteria 4840
393 Ga0495599_0017442 3300046678 Bacteria 4463
394 Ga0495623_0000044 3300046679 Bacteria 77517
395 Ga0495646_0000010 3300046680 Bacteria 195319
396 Ga0495647_0004267 3300046681 Bacteria 4630
397 Ga0495658_0021565 3300046683 Bacteria 3396
398 Ga0495613_0038676 3300046689 Bacteria 3535
399 Ga0495613_0136820 3300046689 Bacteria 1752
400 Ga0495624_0013226 3300046690 Bacteria 5627
401 Ga0495624_0076213 3300046690 Bacteria 2081
402 Ga0495600_0000026 3300046809 Bacteria 91792
403 Ga0495604_0000010 3300047317 Bacteria 312236
404 Ga0495604_0021829 3300047317 Bacteria 5111
405 Ga0495674_0000001 3300047319 Bacteria 778665
406 Ga0495674_0097692 3300047319 Bacteria 2501
407 Ga0495680_0000527 3300047322 Bacteria 43004
408 Ga0495680_0223277 3300047322 Bacteria 1344
409 Ga0495675_0000009 3300047444 Bacteria 154214
410 Ga0495675_0013767 3300047444 Bacteria 5112
411 Ga0495684_0000005 3300047471 Bacteria 291932
412 Ga0495593_0003117 3300047673 Bacteria 9967
413 Ga0495602_0000002 3300048088 Bacteria 422216
414 Ga0495602_0143917 3300048088 Bacteria 1884
415 Ga0496100_0019936 3300048903 Bacteria 4012
416 Ga0496104_0018746 3300048907 Bacteria 6319
417 Ga0496104_0034931 3300048907 Bacteria 4691
418 Ga0496105_0040441 3300048908 Bacteria 3845
419 Ga0496107_0105692 3300048910 Bacteria 2067
420 Ga0496126_0010006 3300048929 Bacteria 10007
421 Ga0496126_0216041 3300048929 Bacteria 1613
422 Ga0501031_0035500 3300049568 Bacteria 3252
423 Ga0501032_0005298 3300049569 Bacteria 9592
424 Ga0501034_0000032 3300049571 Bacteria 243763
425 Ga0501034_0004050 3300049571 Bacteria 16444
426 Ga0501034_0017636 3300049571 Bacteria 7320
427 Ga0501034_0035932 3300049571 Bacteria 5023
428 Ga0501034_0038594 3300049571 Bacteria 4836
429 Ga0501034_0064344 3300049571 Bacteria 3682
430 Ga0501034_0088813 3300049571 Bacteria 3088
431 Ga0501034_0298504 3300049571 Bacteria 1548
432 Ga0501034_0468669 3300049571 Bacteria 1176
433 Ga0501036_0005731 3300049572 Bacteria 10076
434 Ga0501036_0008867 3300049572 Bacteria 8259
435 Ga0501036_0304473 3300049572 Bacteria 1333
436 Ga0501037_0016550 3300049573 Bacteria 5428
437 Ga0501038_0042713 3300049574 Bacteria 3947
438 Ga0501039_0009809 3300049575 Bacteria 7296
439 Ga0501039_0144365 3300049575 Bacteria 1870
440 Ga0501039_0185338 3300049575 Bacteria 1637
441 Ga0501040_0044419 3300049576 Bacteria 3029
442 Ga0501040_0193203 3300049576 Bacteria 1445
443 Ga0501043_0010017 3300049579 Bacteria 7433
444 Ga0501043_0044024 3300049579 Bacteria 3509
445 Ga0501043_0140735 3300049579 Bacteria 1890
446 Ga0501043_0201896 3300049579 Bacteria 1543
447 Ga0501046_0021003 3300049580 Bacteria 5392
448 Ga0501046_0049584 3300049580 Bacteria 3320
449 Ga0501047_0000010 3300049581 Bacteria 429357
450 Ga0501047_0017460 3300049581 Bacteria 6873
451 Ga0501047_0033040 3300049581 Bacteria 4996
452 Ga0501047_0061585 3300049581 Bacteria 3620
453 Ga0501047_0076093 3300049581 Bacteria 3230
454 Ga0501047_0092166 3300049581 Bacteria 2908
455 Ga0501048_0000740 3300049582 Bacteria 23899
456 Ga0501048_0004435 3300049582 Bacteria 10688
457 Ga0501067_0096874 3300049583 Bacteria 1638
458 Ga0501068_0015625 3300049584 Bacteria 4363
459 Ga0501069_0011044 3300049585 Bacteria 4789
460 Ga0501069_0013401 3300049585 Bacteria 4372
461 Ga0501069_0051046 3300049585 Bacteria 2301
462 Ga0501069_0075159 3300049585 Bacteria 1897
463 Ga0501069_0098747 3300049585 Bacteria 1656
464 Ga0501069_0110439 3300049585 Bacteria 1566
465 Ga0501070_0000929 3300049586 Bacteria 26412
466 Ga0501070_0004882 3300049586 Bacteria 11457
467 Ga0501070_0024877 3300049586 Bacteria 5021
468 Ga0501070_0025347 3300049586 Bacteria 4974
469 Ga0501070_0040560 3300049586 Bacteria 3882
470 Ga0501070_0056735 3300049586 Bacteria 3246
471 Ga0501070_0084105 3300049586 Bacteria 2634
472 Ga0501071_0166946 3300049587 Bacteria 1647
473 Ga0501072_0137485 3300049588 Bacteria 1948
474 Ga0501072_0163351 3300049588 Bacteria 1777
475 Ga0501073_0035810 3300049589 Bacteria 3526
476 Ga0501074_0004679 3300049590 Bacteria 9797
477 Ga0501074_0017708 3300049590 Bacteria 5174
478 Ga0501074_0025357 3300049590 Bacteria 4306
479 Ga0501074_0077282 3300049590 Bacteria 2389
480 Ga0501075_0271156 3300049591 Bacteria 1293
481 Ga0501076_0018333 3300049592 Bacteria 5335
482 Ga0501077_0063565 3300049593 Bacteria 2341
483 Ga0501079_0003507 3300049741 Bacteria 11531
484 Ga0501079_0026818 3300049741 Bacteria 4417
485 Ga0501079_0077054 3300049741 Bacteria 2579
486 Ga0501079_0104000 3300049741 Bacteria 2203
487 Ga0501080_0014709 3300049742 Bacteria 7205
488 Ga0501080_0033244 3300049742 Bacteria 4813
489 Ga0501080_0062126 3300049742 Bacteria 3477
490 Ga0501080_0071894 3300049742 Bacteria 3218
491 Ga0501080_0088445 3300049742 Bacteria 2878
492 Ga0501080_0097663 3300049742 Bacteria 2727
493 Ga0501080_0182138 3300049742 Bacteria 1932
494 Ga0501080_0268366 3300049742 Bacteria 1554
495 Ga0501083_0006521 3300049744 Bacteria 8275
496 Ga0501035_0030975 3300049822 Bacteria 4872
497 Ga0501035_0051887 3300049822 Bacteria 3670
498 Ga0501035_0052307 3300049822 Bacteria 3655
499 Ga0501044_0002125 3300049823 Bacteria 22744
500 Ga0501044_0007914 3300049823 Bacteria 11687
501 Ga0501044_0020178 3300049823 Bacteria 7113
502 Ga0501044_0044519 3300049823 Bacteria 4605
503 Ga0501044_0057594 3300049823 Bacteria 3988
504 Ga0501044_0161888 3300049823 Bacteria 2214
505 nmdc:mga03683_28905_c2 3300050489 Bacteria 1872
506 nmdc:mga03683_409_c1 3300050489 Bacteria 12382
507 nmdc:mga03683_45668_c1 3300050489 Bacteria 1814
508 nmdc:mga03n38_127610_c1 3300050490 Bacteria 1257
509 nmdc:mga0yw44_1320_c1 3300050492 Bacteria 9797
510 nmdc:mga0yw44_285203_c1 3300050492 Bacteria 1104
511 nmdc:mga0k408_18076_c1 3300050493 Bacteria 3931
512 nmdc:mga0k408_58927_c1 3300050493 Bacteria 2230
513 nmdc:mga0k408_71193_c1 3300050493 Bacteria 2029
514 nmdc:mga06z11_119628_c1 3300050494 Bacteria 1468
515 nmdc:mga06z11_42636_c1 3300050494 Bacteria 2277
516 nmdc:mga07m45_16579_c1 3300050496 Bacteria 3944
517 nmdc:mga05p37_586_c1 3300050507 Bacteria 40050
518 nmdc:mga05p37_9754_c1 3300050507 Bacteria 11389
519 nmdc:mga09592_1648_c1 3300050508 Bacteria 4880
520 nmdc:mga09592_191877_c1 3300050508 Bacteria 1768
521 nmdc:mga0qj67_20412_c1 3300050509 Bacteria 5072
522 nmdc:mga06r32_145164_c1 3300050510 Bacteria 2350
523 nmdc:mga06r32_1924_c1 3300050510 Bacteria 18506
524 nmdc:mga08y16_138544_c1 3300050511 Bacteria 2530
525 nmdc:mga08y16_204258_c1 3300050511 Bacteria 2047
526 nmdc:mga08y16_333847_c1 3300050511 Bacteria 1559
527 nmdc:mga08y16_4668_c1 3300050511 Bacteria 14271
528 nmdc:mga0n895_2979_c1 3300050512 Bacteria 13434
529 nmdc:mga0rr50_16629_c1 3300050513 Bacteria 4892
530 nmdc:mga0rr50_8918_c1 3300050513 Bacteria 6265
531 nmdc:mga08x19_148817_c1 3300050514 Bacteria 1584
532 nmdc:mga0a205_2843_c1 3300050515 Bacteria 15314
533 nmdc:mga0sz30_11620_c2 3300050516 Bacteria 2589
534 nmdc:mga0sz30_581_c1 3300050516 Bacteria 13764
535 Ga0495601_0000003 3300053077 Bacteria 493642
536 Ga0495601_0001647 3300053077 Bacteria 12329
537 Ga0495601_0083838 3300053077 Bacteria 2047
538 Ga0495612_0000009 3300053078 Bacteria 229858
539 Ga0495595_0000011 3300053084 Bacteria 174945
540 Ga0495595_0001373 3300053084 Bacteria 9454
541 Ga0495619_0000009 3300053085 Bacteria 305595
542 Ga0495619_0051636 3300053085 Bacteria 2717
543 Ga0495619_0080844 3300053085 Bacteria 2187
544 Ga0495619_0197561 3300053085 Bacteria 1392
545 Ga0495619_0199452 3300053085 Bacteria 1385
546 Ga0500644_0002367 3300053088 Bacteria 4738
547 Ga0500644_0034055 3300053088 Bacteria 1641
548 Ga0500651_0004891 3300053093 Bacteria 7573
549 Ga0500566_0013814 3300053094 Bacteria 4751
550 Ga0500593_031357 3300053117 Bacteria 2377
551 Ga0500594_0019112 3300053118 Bacteria 1695
552 Ga0500595_000002 3300053119 Bacteria 1074388
553 Ga0500652_009464 3300053131 Bacteria 3296
554 Ga0500616_0000002 3300053153 Bacteria 1611257
555 Ga0500616_0002343 3300053153 Bacteria 15954
556 Ga0500627_0086686 3300053158 Bacteria 1399
557 Ga0500645_000549 3300053730 Bacteria 24816
558 Ga0501084_0073498 3300054114 Bacteria 2863
559 Ga0501084_0272945 3300054114 Bacteria 1428
560 Ga0501082_0006190 3300060353 Bacteria 10387
561 Ga0501082_0034930 3300060353 Bacteria 4333
562 Ga0501082_0160513 3300060353 Bacteria 1953
563 Ga0501082_0210866 3300060353 Bacteria 1690
564 Ga0530510_0088265 3300061734 Bacteria 2260
565 Ga0530510_0291638 3300061734 Bacteria 1220

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_285203_c1 nmdc:mga0yw44_285203_c1_19_1011 313
2 3300031238 Ga0265332_10000024 Ga0265332_10000024138 318
3 3300048903 Ga0496100_0019936 Ga0496100_0019936_1114_2205 321
4 3300048908 Ga0496105_0040441 Ga0496105_0040441_419_1510 321
5 3300048910 Ga0496107_0105692 Ga0496107_0105692_547_1638 321
6 3300005548 Ga0070665_100016716 Ga0070665_1000167165 327
7 3300028379 Ga0268266_10020714 Ga0268266_100207146 327
8 3300031250 Ga0265331_10045951 Ga0265331_100459511 327
9 3300037312 Ga0395899_0064694 Ga0395899_0064694_1687_2673 328
10 3300038443 Ga0395901_0701831 Ga0395901_0701831_11_997 328
11 3300031235 Ga0265330_10044970 Ga0265330_100449701 329
12 3300006038 Ga0075365_10016973 Ga0075365_100169734 331
13 3300005435 Ga0070714_100097401 Ga0070714_1000974013 336
14 3300025915 Ga0207693_10034982 Ga0207693_100349823 336
15 3300014968 Ga0157379_10244174 Ga0157379_102441742 337
16 3300037312 Ga0395899_0005212 Ga0395899_0005212_5131_6219 338
17 3300037418 Ga0395900_0009382 Ga0395900_0009382_5588_6676 338
18 3300038443 Ga0395901_0075344 Ga0395901_0075344_165_1253 338
19 3300038443 Ga0395901_0120069 Ga0395901_0120069_1432_2520 338
20 3300049579 Ga0501043_0044024 Ga0501043_0044024_1001_2104 338
21 3300049579 Ga0501043_0140735 Ga0501043_0140735_382_1485 338
22 3300049581 Ga0501047_0092166 Ga0501047_0092166_425_1528 338
23 3300005327 Ga0070658_10017407 Ga0070658_100174074 339
24 3300005563 Ga0068855_100011086 Ga0068855_1000110862 339
25 3300005577 Ga0068857_100166180 Ga0068857_1001661802 339
26 3300009551 Ga0105238_10041790 Ga0105238_100417904 339
27 3300025909 Ga0207705_10042643 Ga0207705_100426431 339
28 3300025924 Ga0207694_10127730 Ga0207694_101277302 339
29 3300025944 Ga0207661_10071720 Ga0207661_100717202 339
30 3300025949 Ga0207667_10017786 Ga0207667_100177863 339
31 3300026078 Ga0207702_10042471 Ga0207702_100424713 339
32 3300031247 Ga0265340_10001019 Ga0265340_100010194 339
33 3300031595 Ga0265313_10000522 Ga0265313_1000052221 339
34 3300031712 Ga0265342_10009117 Ga0265342_100091176 339
35 3300037418 Ga0395900_0057991 Ga0395900_0057991_1842_2930 339
36 3300037466 Ga0395898_0060800 Ga0395898_0060800_395_1483 339
37 3300038443 Ga0395901_0034031 Ga0395901_0034031_3863_4951 339
38 3300005327 Ga0070658_10005001 Ga0070658_100050012 340
39 3300005435 Ga0070714_100014985 Ga0070714_1000149854 340
40 3300005530 Ga0070679_100153515 Ga0070679_1001535152 340
41 3300005563 Ga0068855_100021711 Ga0068855_1000217114 340
42 3300006852 Ga0075433_10003438 Ga0075433_100034389 340
43 3300006871 Ga0075434_100000268 Ga0075434_10000026812 340
44 3300007076 Ga0075435_100014848 Ga0075435_1000148485 340
45 3300009094 Ga0111539_10012926 Ga0111539_100129262 340
46 3300013100 Ga0157373_10073590 Ga0157373_100735902 340
47 3300025912 Ga0207707_10127850 Ga0207707_101278502 340
48 3300025917 Ga0207660_10066810 Ga0207660_100668102 340
49 3300025919 Ga0207657_10027346 Ga0207657_100273462 340
50 3300026078 Ga0207702_10302256 Ga0207702_103022561 340
51 3300027907 Ga0207428_10160081 Ga0207428_101600812 340
52 3300031595 Ga0265313_10006264 Ga0265313_100062642 340
53 3300031712 Ga0265342_10000866 Ga0265342_1000086618 340
54 3300034819 Ga0373958_0007352 Ga0373958_0007352_262_1350 340
55 3300034957 Ga0373938_0011460 Ga0373938_0011460_210_1298 340
56 3300035112 Ga0373932_0005780 Ga0373932_0005780_1303_2391 340
57 3300035241 Ga0373961_0011600 Ga0373961_0011600_109_1197 340
58 3300035242 Ga0373962_0006082 Ga0373962_0006082_633_1721 340
59 3300035691 Ga0373931_0000995 Ga0373931_0000995_1072_2160 340
60 3300049572 Ga0501036_0304473 Ga0501036_0304473_153_1241 340
61 3300050511 nmdc:mga08y16_138544_c1 nmdc:mga08y16_138544_c1_1102_2190 340
62 3300050512 nmdc:mga0n895_2979_c1 nmdc:mga0n895_2979_c1_8762_9850 340
63 3300050513 nmdc:mga0rr50_8918_c1 nmdc:mga0rr50_8918_c1_156_1244 340
64 3300050515 nmdc:mga0a205_2843_c1 nmdc:mga0a205_2843_c1_9950_11038 340
65 3300006844 Ga0075428_100229121 Ga0075428_1002291212 341
66 3300028800 Ga0265338_10063587 Ga0265338_100635872 341
67 3300031712 Ga0265342_10009921 Ga0265342_100099216 341
68 3300037466 Ga0395898_0078361 Ga0395898_0078361_157_1359 341
69 3300044694 Ga0466963_0006552 Ga0466963_0006552_4201_5289 341
70 3300045976 Ga0466967_0013018 Ga0466967_0013018_5248_6336 341
71 3300053088 Ga0500644_0002367 Ga0500644_0002367_776_1870 341
72 3300053118 Ga0500594_0019112 Ga0500594_0019112_39_1127 341
73 3300053153 Ga0500616_0000002 Ga0500616_0000002_608744_609832 341
74 3300005327 Ga0070658_10005554 Ga0070658_100055545 342
75 3300005336 Ga0070680_100001108 Ga0070680_1000011084 342
76 3300005458 Ga0070681_10045176 Ga0070681_100451762 342
77 3300005530 Ga0070679_100047946 Ga0070679_1000479463 342
78 3300005563 Ga0068855_100062035 Ga0068855_1000620353 342
79 3300009093 Ga0105240_10004293 Ga0105240_1000429312 342
80 3300013105 Ga0157369_10085056 Ga0157369_100850563 342
81 3300025912 Ga0207707_10029619 Ga0207707_100296193 342
82 3300025917 Ga0207660_10024491 Ga0207660_100244911 342
83 3300025921 Ga0207652_10046882 Ga0207652_100468823 342
84 3300025949 Ga0207667_10040449 Ga0207667_100404492 342
85 3300049742 Ga0501080_0268366 Ga0501080_0268366_51_1151 342
86 3300060353 Ga0501082_0160513 Ga0501082_0160513_588_1709 342
87 3300005518 Ga0070699_100001182 Ga0070699_1000011826 344
88 3300039437 Ga0436365_0545507 Ga0436365_0545507_5873_6961 344
89 3300005327 Ga0070658_10281067 Ga0070658_102810672 345
90 3300005434 Ga0070709_10218905 Ga0070709_102189051 345
91 3300005937 Ga0081455_10001801 Ga0081455_100018016 345
92 3300009093 Ga0105240_10082544 Ga0105240_100825442 345
93 3300009147 Ga0114129_10003226 Ga0114129_1000322611 345
94 3300009551 Ga0105238_10099672 Ga0105238_100996722 345
95 3300025913 Ga0207695_10300011 Ga0207695_103000111 345
96 3300025924 Ga0207694_10069194 Ga0207694_100691942 345
97 3300039450 Ga0436363_1230191 Ga0436363_1230191_15_1103 345
98 3300006178 Ga0075367_10030264 Ga0075367_100302642 346
99 3300006195 Ga0075366_10000552 Ga0075366_100005524 346
100 3300035692 Ga0373935_0066943 Ga0373935_0066943_960_2066 346
101 3300035695 Ga0373927_0052552 Ga0373927_0052552_671_1825 346
102 3300045051 Ga0451576_0000108 Ga0451576_0000108_14557_15636 346
103 3300049742 Ga0501080_0062126 Ga0501080_0062126_1475_2536 346
104 3300050494 nmdc:mga06z11_42636_c1 nmdc:mga06z11_42636_c1_1027_2115 346
105 3300050507 nmdc:mga05p37_9754_c1 nmdc:mga05p37_9754_c1_9719_10810 346
106 3300050511 nmdc:mga08y16_333847_c1 nmdc:mga08y16_333847_c1_329_1426 346
107 3300053131 Ga0500652_009464 Ga0500652_009464_1841_2929 346
108 3300053730 Ga0500645_000549 Ga0500645_000549_17448_18536 346
109 iso_pu_bacteria 2547132512 2548849093 346
110 3300005336 Ga0070680_100003405 Ga0070680_1000034052 347
111 3300005339 Ga0070660_100068474 Ga0070660_1000684742 347
112 3300005435 Ga0070714_100040203 Ga0070714_1000402034 347
113 3300005436 Ga0070713_100031411 Ga0070713_1000314113 347
114 3300005439 Ga0070711_100016017 Ga0070711_1000160172 347
115 3300005458 Ga0070681_10009265 Ga0070681_100092659 347
116 3300005564 Ga0070664_100214447 Ga0070664_1002144472 347
117 3300006880 Ga0075429_100276051 Ga0075429_1002760512 347
118 3300014497 Ga0182008_10047960 Ga0182008_100479602 347
119 3300025906 Ga0207699_10137891 Ga0207699_101378911 347
120 3300025912 Ga0207707_10010597 Ga0207707_100105975 347
121 3300025919 Ga0207657_10079605 Ga0207657_100796052 347
122 3300025921 Ga0207652_10022043 Ga0207652_100220432 347
123 3300025931 Ga0207644_10083365 Ga0207644_100833651 347
124 3300025933 Ga0207706_10108662 Ga0207706_101086622 347
125 3300031235 Ga0265330_10020797 Ga0265330_100207972 347
126 3300031247 Ga0265340_10061622 Ga0265340_100616221 347
127 3300031249 Ga0265339_10036439 Ga0265339_100364392 347
128 3300044684 Ga0466966_0034794 Ga0466966_0034794_1764_2897 347
129 3300044842 Ga0466957_0127269 Ga0466957_0127269_183_1271 347
130 3300045049 Ga0466959_0056197 Ga0466959_0056197_165_1298 347
131 3300045836 Ga0466958_0148695 Ga0466958_0148695_160_1293 347
132 3300048929 Ga0496126_0216041 Ga0496126_0216041_250_1374 347
133 3300049568 Ga0501031_0035500 Ga0501031_0035500_465_1592 347
134 3300049569 Ga0501032_0005298 Ga0501032_0005298_4250_5377 347
135 3300049571 Ga0501034_0064344 Ga0501034_0064344_1587_2675 347
136 3300049571 Ga0501034_0088813 Ga0501034_0088813_1717_2844 347
137 3300049571 Ga0501034_0468669 Ga0501034_0468669_67_1152 347
138 3300049572 Ga0501036_0008867 Ga0501036_0008867_897_2024 347
139 3300049574 Ga0501038_0042713 Ga0501038_0042713_2258_3385 347
140 3300049575 Ga0501039_0009809 Ga0501039_0009809_6139_7266 347
141 3300049580 Ga0501046_0021003 Ga0501046_0021003_2504_3631 347
142 3300049581 Ga0501047_0061585 Ga0501047_0061585_2477_3604 347
143 3300049582 Ga0501048_0004435 Ga0501048_0004435_1707_2834 347
144 3300049584 Ga0501068_0015625 Ga0501068_0015625_2374_3501 347
145 3300049585 Ga0501069_0013401 Ga0501069_0013401_2331_3458 347
146 3300049586 Ga0501070_0056735 Ga0501070_0056735_2103_3230 347
147 3300049589 Ga0501073_0035810 Ga0501073_0035810_17_1144 347
148 3300049590 Ga0501074_0017708 Ga0501074_0017708_1708_2835 347
149 3300049741 Ga0501079_0003507 Ga0501079_0003507_10094_11185 347
150 3300049741 Ga0501079_0077054 Ga0501079_0077054_1210_2337 347
151 3300049742 Ga0501080_0014709 Ga0501080_0014709_3286_4413 347
152 3300049822 Ga0501035_0051887 Ga0501035_0051887_2103_3230 347
153 3300049823 Ga0501044_0002125 Ga0501044_0002125_15400_16590 347
154 3300060353 Ga0501082_0034930 Ga0501082_0034930_464_1591 347
155 3300006871 Ga0075434_100171033 Ga0075434_1001710332 348
156 3300014326 Ga0157380_10247031 Ga0157380_102470312 348
157 3300014969 Ga0157376_10131508 Ga0157376_101315082 348
158 3300048907 Ga0496104_0018746 Ga0496104_0018746_643_1746 348
159 3300049571 Ga0501034_0000032 Ga0501034_0000032_86799_87887 348
160 3300049571 Ga0501034_0004050 Ga0501034_0004050_7870_8961 348
161 3300049571 Ga0501034_0017636 Ga0501034_0017636_1846_2937 348
162 3300049571 Ga0501034_0035932 Ga0501034_0035932_3072_4268 348
163 3300049571 Ga0501034_0038594 Ga0501034_0038594_2811_3899 348
164 3300049572 Ga0501036_0005731 Ga0501036_0005731_1108_2199 348
165 3300049573 Ga0501037_0016550 Ga0501037_0016550_1109_2197 348
166 3300049575 Ga0501039_0144365 Ga0501039_0144365_360_1451 348
167 3300049575 Ga0501039_0185338 Ga0501039_0185338_39_1196 348
168 3300049576 Ga0501040_0193203 Ga0501040_0193203_208_1296 348
169 3300049579 Ga0501043_0010017 Ga0501043_0010017_1294_2385 348
170 3300049580 Ga0501046_0049584 Ga0501046_0049584_280_1371 348
171 3300049581 Ga0501047_0000010 Ga0501047_0000010_424741_425832 348
172 3300049582 Ga0501048_0000740 Ga0501048_0000740_1058_2149 348
173 3300049585 Ga0501069_0051046 Ga0501069_0051046_708_1796 348
174 3300049585 Ga0501069_0110439 Ga0501069_0110439_426_1514 348
175 3300049586 Ga0501070_0000929 Ga0501070_0000929_501_1589 348
176 3300049586 Ga0501070_0004882 Ga0501070_0004882_569_1660 348
177 3300049590 Ga0501074_0004679 Ga0501074_0004679_7842_8933 348
178 3300049742 Ga0501080_0088445 Ga0501080_0088445_519_1607 348
179 3300049744 Ga0501083_0006521 Ga0501083_0006521_2389_3546 348
180 3300049823 Ga0501044_0007914 Ga0501044_0007914_4737_5828 348
181 3300049823 Ga0501044_0044519 Ga0501044_0044519_3197_4285 348
182 3300049823 Ga0501044_0057594 Ga0501044_0057594_1353_2444 348
183 3300053093 Ga0500651_0004891 Ga0500651_0004891_1680_2768 348
184 3300053094 Ga0500566_0013814 Ga0500566_0013814_1571_2659 348
185 3300053119 Ga0500595_000002 Ga0500595_000002_544346_545434 348
186 3300060353 Ga0501082_0006190 Ga0501082_0006190_6960_8117 348
187 3300060353 Ga0501082_0210866 Ga0501082_0210866_442_1530 348
188 3300061734 Ga0530510_0088265 Ga0530510_0088265_515_1627 348
189 3300005548 Ga0070665_100146937 Ga0070665_1001469372 349
190 3300006852 Ga0075433_10050303 Ga0075433_100503034 349
191 3300025294 Ga0209025_1001538 Ga0209025_10015382 349
192 3300026088 Ga0207641_10316481 Ga0207641_103164812 349
193 3300028379 Ga0268266_10094291 Ga0268266_100942913 349
194 3300031548 Ga0307408_100049715 Ga0307408_1000497152 349
195 3300031731 Ga0307405_10003576 Ga0307405_100035763 349
196 3300031852 Ga0307410_10005404 Ga0307410_100054042 349
197 3300031901 Ga0307406_10001441 Ga0307406_1000144110 349
198 3300031911 Ga0307412_10012673 Ga0307412_100126732 349
199 3300032002 Ga0307416_100096228 Ga0307416_1000962282 349
200 3300032004 Ga0307414_10015498 Ga0307414_100154982 349
201 3300032126 Ga0307415_100046549 Ga0307415_1000465492 349
202 3300039453 Ga0436362_0613027 Ga0436362_0613027_330_1439 349
203 3300049586 Ga0501070_0084105 Ga0501070_0084105_1433_2539 349
204 3300049742 Ga0501080_0033244 Ga0501080_0033244_3057_4163 349
205 3300049823 Ga0501044_0161888 Ga0501044_0161888_228_1316 349
206 3300050510 nmdc:mga06r32_145164_c1 nmdc:mga06r32_145164_c1_946_2058 349
207 3300053085 Ga0495619_0197561 Ga0495619_0197561_47_1144 349
208 iso_pu_bacteria 2643221547 2643756788 349
209 3300003203 JGI25406J46586_10002392 JGI25406J46586_100023922 350
210 3300005439 Ga0070711_100205342 Ga0070711_1002053421 350
211 3300005614 Ga0068856_100111390 Ga0068856_1001113902 350
212 3300005985 Ga0081539_10000101 Ga0081539_1000010184 350
213 3300009551 Ga0105238_10041790 Ga0105238_100417902 350
214 3300013104 Ga0157370_10030206 Ga0157370_100302062 350
215 3300013105 Ga0157369_10111880 Ga0157369_101118802 350
216 3300025923 Ga0207681_10103054 Ga0207681_101030543 350
217 3300025924 Ga0207694_10097536 Ga0207694_100975362 350
218 3300027512 Ga0209179_1000633 Ga0209179_10006332 350
219 3300039450 Ga0436363_0981136 Ga0436363_0981136_197_1285 350
220 3300049576 Ga0501040_0044419 Ga0501040_0044419_933_2045 350
221 3300049588 Ga0501072_0137485 Ga0501072_0137485_816_1928 350
222 3300049590 Ga0501074_0077282 Ga0501074_0077282_859_1971 350
223 3300049592 Ga0501076_0018333 Ga0501076_0018333_3527_4639 350
224 3300049593 Ga0501077_0063565 Ga0501077_0063565_736_1848 350
225 3300049741 Ga0501079_0026818 Ga0501079_0026818_2524_3636 350
226 3300049742 Ga0501080_0071894 Ga0501080_0071894_1488_2600 350
227 3300050490 nmdc:mga03n38_127610_c1 nmdc:mga03n38_127610_c1_28_1128 350
228 3300050493 nmdc:mga0k408_18076_c1 nmdc:mga0k408_18076_c1_116_1216 350
229 3300053153 Ga0500616_0002343 Ga0500616_0002343_20_1102 350
230 3300054114 Ga0501084_0073498 Ga0501084_0073498_806_1918 350
231 iso_pu_bacteria 2643221736 2644744711 350
232 iso_pu_bacteria 2894817345 2894818511 350
233 3300005327 Ga0070658_10005554 Ga0070658_100055547 351
234 3300005336 Ga0070680_100001108 Ga0070680_1000011082 351
235 3300005339 Ga0070660_100015257 Ga0070660_1000152574 351
236 3300005340 Ga0070689_100142701 Ga0070689_1001427012 351
237 3300005341 Ga0070691_10093064 Ga0070691_100930642 351
238 3300005578 Ga0068854_100021941 Ga0068854_1000219412 351
239 3300005937 Ga0081455_10003377 Ga0081455_100033777 351
240 3300005937 Ga0081455_10029006 Ga0081455_100290065 351
241 3300005983 Ga0081540_1001504 Ga0081540_100150413 351
242 3300009093 Ga0105240_10004293 Ga0105240_1000429314 351
243 3300013105 Ga0157369_10181167 Ga0157369_101811672 351
244 3300025913 Ga0207695_10339153 Ga0207695_103391531 351
245 3300025917 Ga0207660_10024491 Ga0207660_100244913 351
246 3300025919 Ga0207657_10023148 Ga0207657_100231483 351
247 3300025949 Ga0207667_10091586 Ga0207667_100915861 351
248 3300025981 Ga0207640_10072100 Ga0207640_100721001 351
249 3300026089 Ga0207648_10126938 Ga0207648_101269382 351
250 3300049581 Ga0501047_0076093 Ga0501047_0076093_756_1880 351
251 3300049586 Ga0501070_0024877 Ga0501070_0024877_469_1593 351
252 3300049590 Ga0501074_0025357 Ga0501074_0025357_2855_3979 351
253 3300049742 Ga0501080_0097663 Ga0501080_0097663_1326_2450 351
254 3300049823 Ga0501044_0020178 Ga0501044_0020178_3448_4572 351
255 3300050508 nmdc:mga09592_191877_c1 nmdc:mga09592_191877_c1_495_1583 351
256 iso_pu_bacteria 2511231221 2512033551 351
257 iso_pu_bacteria 2513237087 2513591536 351
258 iso_pu_bacteria 2513237145 2513920428 351
259 iso_pu_bacteria 2828305725 2828308249 351
260 iso_pu_bacteria 2841760612 2841762987 351
261 iso_pu_bacteria 2842333319 2842333976 351
262 iso_pu_bacteria 2844104063 2844109143 351
263 iso_pu_bacteria 2848858292 2848862903 351
264 iso_pu_bacteria 2851182111 2851182272 351
265 iso_pu_bacteria 2851246043 2851251250 351
266 iso_pu_bacteria 2897803580 2897805641 351
267 iso_pu_bacteria 8054002106 8054004803 351
268 iso_pu_bacteria 8057529695 8057535003 351
269 3300005340 Ga0070689_100133228 Ga0070689_1001332281 352
270 3300005434 Ga0070709_10056242 Ga0070709_100562422 352
271 3300005843 Ga0068860_100104011 Ga0068860_1001040112 352
272 3300005843 Ga0068860_100185815 Ga0068860_1001858152 352
273 3300005981 Ga0081538_10034440 Ga0081538_100344402 352
274 3300005985 Ga0081539_10003832 Ga0081539_1000383210 352
275 3300006177 Ga0075362_10011334 Ga0075362_100113341 352
276 3300006177 Ga0075362_10058980 Ga0075362_100589802 352
277 3300006178 Ga0075367_10095334 Ga0075367_100953342 352
278 3300006186 Ga0075369_10001445 Ga0075369_100014453 352
279 3300006186 Ga0075369_10013806 Ga0075369_100138063 352
280 3300006186 Ga0075369_10022060 Ga0075369_100220602 352
281 3300006353 Ga0075370_10028419 Ga0075370_100284193 352
282 3300006353 Ga0075370_10043877 Ga0075370_100438773 352
283 3300006844 Ga0075428_100529850 Ga0075428_1005298501 352
284 3300007265 Ga0099794_10052267 Ga0099794_100522673 352
285 3300021384 Ga0213876_10050181 Ga0213876_100501812 352
286 3300025936 Ga0207670_10045131 Ga0207670_100451313 352
287 3300028573 Ga0265334_10027700 Ga0265334_100277003 352
288 3300028794 Ga0307515_10078976 Ga0307515_100789764 352
289 3300032002 Ga0307416_100457163 Ga0307416_1004571631 352
290 3300035116 Ga0373945_0047533 Ga0373945_0047533_101_1192 352
291 3300035692 Ga0373935_0057427 Ga0373935_0057427_138_1229 352
292 3300038443 Ga0395901_0201832 Ga0395901_0201832_898_2064 352
293 3300039437 Ga0436365_0676191 Ga0436365_0676191_4520_5611 352
294 3300039447 Ga0436361_0431311 Ga0436361_0431311_88_1179 352
295 3300049585 Ga0501069_0011044 Ga0501069_0011044_2886_3977 352
296 3300050489 nmdc:mga03683_28905_c2 nmdc:mga03683_28905_c2_92_1180 352
297 3300050489 nmdc:mga03683_45668_c1 nmdc:mga03683_45668_c1_80_1168 352
298 3300050492 nmdc:mga0yw44_1320_c1 nmdc:mga0yw44_1320_c1_4850_5938 352
299 3300050493 nmdc:mga0k408_71193_c1 nmdc:mga0k408_71193_c1_793_1893 352
300 3300050494 nmdc:mga06z11_119628_c1 nmdc:mga06z11_119628_c1_208_1296 352
301 3300050516 nmdc:mga0sz30_11620_c2 nmdc:mga0sz30_11620_c2_385_1473 352
302 3300050516 nmdc:mga0sz30_581_c1 nmdc:mga0sz30_581_c1_742_1830 352
303 3300005338 Ga0068868_100196902 Ga0068868_1001969021 353
304 3300005354 Ga0070675_100047938 Ga0070675_1000479383 353
305 3300005842 Ga0068858_100238476 Ga0068858_1002384761 353
306 3300005843 Ga0068860_100006084 Ga0068860_1000060842 353
307 3300006237 Ga0097621_100019769 Ga0097621_1000197694 353
308 3300006881 Ga0068865_100075257 Ga0068865_1000752572 353
309 3300009176 Ga0105242_10003626 Ga0105242_100036267 353
310 3300009177 Ga0105248_10004953 Ga0105248_1000495314 353
311 3300013296 Ga0157374_10051238 Ga0157374_100512383 353
312 3300013306 Ga0163162_10169417 Ga0163162_101694172 353
313 3300013308 Ga0157375_10047413 Ga0157375_100474134 353
314 3300014326 Ga0157380_10119753 Ga0157380_101197533 353
315 3300014969 Ga0157376_10009491 Ga0157376_100094917 353
316 3300025926 Ga0207659_10070668 Ga0207659_100706682 353
317 3300025934 Ga0207686_10004471 Ga0207686_100044716 353
318 3300025936 Ga0207670_10020124 Ga0207670_100201242 353
319 3300025960 Ga0207651_10031281 Ga0207651_100312812 353
320 3300028381 Ga0268264_10007444 Ga0268264_100074442 353
321 3300039437 Ga0436365_0778617 Ga0436365_0778617_559_1683 353
322 3300039438 Ga0436360_0050781 Ga0436360_0050781_90_1223 353
323 3300046454 Ga0495592_0090294 Ga0495592_0090294_987_2081 353
324 3300046462 Ga0495651_0061597 Ga0495651_0061597_775_1869 353
325 3300046511 Ga0495608_0065000 Ga0495608_0065000_444_1538 353
326 3300046536 Ga0495587_0027921 Ga0495587_0027921_1312_2406 353
327 3300046559 Ga0495667_0021082 Ga0495667_0021082_3131_4225 353
328 3300046675 Ga0495657_0024810 Ga0495657_0024810_77_1171 353
329 3300046678 Ga0495599_0017442 Ga0495599_0017442_3006_4100 353
330 3300048088 Ga0495602_0143917 Ga0495602_0143917_772_1866 353
331 3300053085 Ga0495619_0199452 Ga0495619_0199452_148_1242 353
332 3300002987 JGI25159J45721_1002032 JGI25159J45721_10020328 354
333 3300005262 Ga0065165_1000218 Ga0065165_100021898 354
334 3300005335 Ga0070666_10123734 Ga0070666_101237342 354
335 3300005338 Ga0068868_100203183 Ga0068868_1002031832 354
336 3300005354 Ga0070675_100268608 Ga0070675_1002686082 354
337 3300005365 Ga0070688_100177535 Ga0070688_1001775351 354
338 3300005367 Ga0070667_100239869 Ga0070667_1002398692 354
339 3300005458 Ga0070681_10152140 Ga0070681_101521402 354
340 3300005530 Ga0070679_100067237 Ga0070679_1000672372 354
341 3300007265 Ga0099794_10013479 Ga0099794_100134793 354
342 3300007788 Ga0099795_10018985 Ga0099795_100189852 354
343 3300010159 Ga0099796_10017643 Ga0099796_100176432 354
344 3300025284 Ga0209130_1000632 Ga0209130_100063222 354
345 3300025302 Ga0207426_1003065 Ga0207426_10030655 354
346 3300025903 Ga0207680_10053481 Ga0207680_100534813 354
347 3300025926 Ga0207659_10241067 Ga0207659_102410672 354
348 3300025940 Ga0207691_10278867 Ga0207691_102788672 354
349 3300025986 Ga0207658_10304935 Ga0207658_103049351 354
350 3300026118 Ga0207675_100104321 Ga0207675_1001043213 354
351 3300026121 Ga0207683_10179708 Ga0207683_101797082 354
352 3300027671 Ga0209588_1026970 Ga0209588_10269702 354
353 3300035086 Ga0373934_0000181 Ga0373934_0000181_3925_5034 354
354 3300035086 Ga0373934_0007531 Ga0373934_0007531_242_1351 354
355 3300035111 Ga0373923_0096086 Ga0373923_0096086_119_1228 354
356 3300035118 Ga0373954_0000484 Ga0373954_0000484_12051_13166 354
357 3300035118 Ga0373954_0001302 Ga0373954_0001302_3175_4284 354
358 3300035118 Ga0373954_0126137 Ga0373954_0126137_34_1143 354
359 3300035119 Ga0373956_0000230 Ga0373956_0000230_19090_20199 354
360 3300035120 Ga0373957_0005517 Ga0373957_0005517_1850_2959 354
361 3300035120 Ga0373957_0018188 Ga0373957_0018188_954_2063 354
362 3300035170 Ga0373943_0042792 Ga0373943_0042792_160_1269 354
363 3300035172 Ga0373955_0013434 Ga0373955_0013434_2755_3864 354
364 3300035724 Ga0373933_0000550 Ga0373933_0000550_20473_21582 354
365 3300035725 Ga0373947_0085047 Ga0373947_0085047_368_1477 354
366 3300036401 Ga0373937_0001239 Ga0373937_0001239_2144_3253 354
367 3300037068 Ga0373925_0119643 Ga0373925_0119643_906_2015 354
368 3300038705 Ga0237819_05544 Ga0237819_05544_757_1896 354
369 3300044694 Ga0466963_0021600 Ga0466963_0021600_538_1623 354
370 3300046454 Ga0495592_0000986 Ga0495592_0000986_3204_4313 354
371 3300046454 Ga0495592_0019632 Ga0495592_0019632_659_1768 354
372 3300046454 Ga0495592_0103479 Ga0495592_0103479_752_1861 354
373 3300046460 Ga0495638_0076678 Ga0495638_0076678_144_1229 354
374 3300046461 Ga0495641_0039857 Ga0495641_0039857_711_1820 354
375 3300046462 Ga0495651_0000574 Ga0495651_0000574_23766_24875 354
376 3300046462 Ga0495651_0010233 Ga0495651_0010233_4683_5792 354
377 3300046472 Ga0495580_0064973 Ga0495580_0064973_1075_2184 354
378 3300046473 Ga0495582_0024697 Ga0495582_0024697_1414_2523 354
379 3300046475 Ga0495639_0002813 Ga0495639_0002813_3360_4469 354
380 3300046476 Ga0495662_0106553 Ga0495662_0106553_119_1228 354
381 3300046477 Ga0495664_0006073 Ga0495664_0006073_2976_4085 354
382 3300046499 Ga0495594_0042136 Ga0495594_0042136_489_1598 354
383 3300046516 Ga0495628_0000543 Ga0495628_0000543_18716_19825 354
384 3300046516 Ga0495628_0008478 Ga0495628_0008478_6958_8067 354
385 3300046516 Ga0495628_0032842 Ga0495628_0032842_71_1180 354
386 3300046517 Ga0495630_0027942 Ga0495630_0027942_2877_3986 354
387 3300046526 Ga0495666_0004396 Ga0495666_0004396_5514_6623 354
388 3300046529 Ga0495652_0017093 Ga0495652_0017093_1645_2754 354
389 3300046529 Ga0495652_0134092 Ga0495652_0134092_756_1865 354
390 3300046531 Ga0495665_0004364 Ga0495665_0004364_5569_6678 354
391 3300046533 Ga0495640_0082502 Ga0495640_0082502_681_1790 354
392 3300046543 Ga0495645_0000148 Ga0495645_0000148_22374_23483 354
393 3300046678 Ga0495599_0000218 Ga0495599_0000218_18940_20049 354
394 3300046678 Ga0495599_0014737 Ga0495599_0014737_3549_4658 354
395 3300046681 Ga0495647_0004267 Ga0495647_0004267_557_1666 354
396 3300046683 Ga0495658_0021565 Ga0495658_0021565_1829_2938 354
397 3300046689 Ga0495613_0038676 Ga0495613_0038676_70_1179 354
398 3300046690 Ga0495624_0013226 Ga0495624_0013226_3194_4303 354
399 3300047317 Ga0495604_0021829 Ga0495604_0021829_1850_2959 354
400 3300047319 Ga0495674_0097692 Ga0495674_0097692_362_1471 354
401 3300047322 Ga0495680_0223277 Ga0495680_0223277_22_1131 354
402 3300047444 Ga0495675_0013767 Ga0495675_0013767_3221_4330 354
403 3300050496 nmdc:mga07m45_16579_c1 nmdc:mga07m45_16579_c1_2495_3580 354
404 3300053077 Ga0495601_0001647 Ga0495601_0001647_7800_8909 354
405 3300053077 Ga0495601_0083838 Ga0495601_0083838_871_1980 354
406 3300053084 Ga0495595_0001373 Ga0495595_0001373_3853_4962 354
407 3300053085 Ga0495619_0080844 Ga0495619_0080844_819_1928 354
408 3300053093 Ga0500651_0004891 Ga0500651_0004891_2992_4077 354
409 3300053094 Ga0500566_0013814 Ga0500566_0013814_260_1348 354
410 3300053117 Ga0500593_031357 Ga0500593_031357_682_1770 354
411 3300053119 Ga0500595_000002 Ga0500595_000002_543035_544123 354
412 3300053730 Ga0500645_000549 Ga0500645_000549_18761_19846 354
413 3300001979 JGI24740J21852_10000638 JGI24740J21852_1000063814 355
414 3300003215 JGI25153J46596_10006619 JGI25153J46596_100066192 355
415 3300003659 JGI25404J52841_10000386 JGI25404J52841_100003863 355
416 3300005289 Ga0065704_10093776 Ga0065704_100937762 355
417 3300005347 Ga0070668_100000766 Ga0070668_10000076612 355
418 3300005347 Ga0070668_100060258 Ga0070668_1000602582 355
419 3300005354 Ga0070675_100323947 Ga0070675_1003239472 355
420 3300005434 Ga0070709_10101581 Ga0070709_101015812 355
421 3300005436 Ga0070713_100001555 Ga0070713_1000015554 355
422 3300005437 Ga0070710_10067082 Ga0070710_100670822 355
423 3300005439 Ga0070711_100018729 Ga0070711_1000187293 355
424 3300005455 Ga0070663_100117437 Ga0070663_1001174372 355
425 3300005457 Ga0070662_100204957 Ga0070662_1002049572 355
426 3300005539 Ga0068853_100066065 Ga0068853_1000660653 355
427 3300005545 Ga0070695_100125940 Ga0070695_1001259401 355
428 3300005546 Ga0070696_100047064 Ga0070696_1000470642 355
429 3300005563 Ga0068855_100030635 Ga0068855_1000306356 355
430 3300005577 Ga0068857_100044064 Ga0068857_1000440642 355
431 3300005578 Ga0068854_100005953 Ga0068854_1000059534 355
432 3300005614 Ga0068856_100240808 Ga0068856_1002408082 355
433 3300005616 Ga0068852_100275492 Ga0068852_1002754922 355
434 3300005834 Ga0068851_10002111 Ga0068851_100021118 355
435 3300005937 Ga0081455_10045312 Ga0081455_100453122 355
436 3300005983 Ga0081540_1000008 Ga0081540_100000830 355
437 3300006042 Ga0075368_10016573 Ga0075368_100165732 355
438 3300006048 Ga0075363_100004780 Ga0075363_1000047804 355
439 3300006163 Ga0070715_10007530 Ga0070715_100075303 355
440 3300006175 Ga0070712_100224077 Ga0070712_1002240772 355
441 3300006177 Ga0075362_10006572 Ga0075362_100065722 355
442 3300006177 Ga0075362_10019885 Ga0075362_100198852 355
443 3300006186 Ga0075369_10022961 Ga0075369_100229612 355
444 3300006195 Ga0075366_10081187 Ga0075366_100811873 355
445 3300006353 Ga0075370_10019433 Ga0075370_100194333 355
446 3300006844 Ga0075428_100001096 Ga0075428_10000109618 355
447 3300006846 Ga0075430_100021252 Ga0075430_1000212524 355
448 3300006847 Ga0075431_100002284 Ga0075431_1000022843 355
449 3300006852 Ga0075433_10182893 Ga0075433_101828932 355
450 3300006871 Ga0075434_100144742 Ga0075434_1001447422 355
451 3300006880 Ga0075429_100026528 Ga0075429_1000265282 355
452 3300006914 Ga0075436_100113703 Ga0075436_1001137032 355
453 3300007076 Ga0075435_100109420 Ga0075435_1001094202 355
454 3300007788 Ga0099795_10026446 Ga0099795_100264462 355
455 3300009093 Ga0105240_10014218 Ga0105240_100142187 355
456 3300009094 Ga0111539_10000835 Ga0111539_1000083515 355
457 3300009147 Ga0114129_10005100 Ga0114129_1000510015 355
458 3300009147 Ga0114129_10167375 Ga0114129_101673752 355
459 3300009174 Ga0105241_10007599 Ga0105241_100075996 355
460 3300009176 Ga0105242_10123007 Ga0105242_101230071 355
461 3300009545 Ga0105237_10046872 Ga0105237_100468723 355
462 3300009545 Ga0105237_10063677 Ga0105237_100636772 355
463 3300009551 Ga0105238_10006897 Ga0105238_100068977 355
464 3300009551 Ga0105238_10012634 Ga0105238_100126343 355
465 3300009553 Ga0105249_10001094 Ga0105249_100010944 355
466 3300010375 Ga0105239_10008003 Ga0105239_100080036 355
467 3300014326 Ga0157380_10072980 Ga0157380_100729802 355
468 3300014969 Ga0157376_10348882 Ga0157376_103488822 355
469 3300017792 Ga0163161_10164275 Ga0163161_101642751 355
470 3300021377 Ga0213874_10050651 Ga0213874_100506512 355
471 3300025297 Ga0209758_1000063 Ga0209758_1000063212 355
472 3300025898 Ga0207692_10101611 Ga0207692_101016112 355
473 3300025906 Ga0207699_10102097 Ga0207699_101020972 355
474 3300025906 Ga0207699_10143742 Ga0207699_101437422 355
475 3300025911 Ga0207654_10000163 Ga0207654_100001639 355
476 3300025913 Ga0207695_10001114 Ga0207695_1000111412 355
477 3300025915 Ga0207693_10059148 Ga0207693_100591482 355
478 3300025915 Ga0207693_10178799 Ga0207693_101787992 355
479 3300025916 Ga0207663_10016595 Ga0207663_100165953 355
480 3300025924 Ga0207694_10000050 Ga0207694_1000005059 355
481 3300025926 Ga0207659_10280621 Ga0207659_102806212 355
482 3300025928 Ga0207700_10015855 Ga0207700_100158552 355
483 3300025929 Ga0207664_10305043 Ga0207664_103050431 355
484 3300025939 Ga0207665_10047708 Ga0207665_100477082 355
485 3300025949 Ga0207667_10011990 Ga0207667_100119904 355
486 3300025981 Ga0207640_10004789 Ga0207640_100047894 355
487 3300026041 Ga0207639_10148927 Ga0207639_101489272 355
488 3300026078 Ga0207702_10000002 Ga0207702_10000002169 355
489 3300026116 Ga0207674_10002309 Ga0207674_100023094 355
490 3300026142 Ga0207698_10068293 Ga0207698_100682932 355
491 3300027907 Ga0207428_10015926 Ga0207428_100159263 355
492 3300031240 Ga0265320_10095073 Ga0265320_100950731 355
493 3300031241 Ga0265325_10000039 Ga0265325_1000003971 355
494 3300031241 Ga0265325_10045215 Ga0265325_100452151 355
495 3300031456 Ga0307513_10031402 Ga0307513_100314023 355
496 3300031595 Ga0265313_10001740 Ga0265313_1000174015 355
497 3300031711 Ga0265314_10027454 Ga0265314_100274545 355
498 3300031824 Ga0307413_10028287 Ga0307413_100282872 355
499 3300031901 Ga0307406_10102174 Ga0307406_101021742 355
500 3300031995 Ga0307409_100354081 Ga0307409_1003540812 355
501 3300032002 Ga0307416_100042136 Ga0307416_1000421362 355
502 3300032004 Ga0307414_10238809 Ga0307414_102388091 355
503 3300032126 Ga0307415_100138643 Ga0307415_1001386431 355
504 3300035113 Ga0373936_0005520 Ga0373936_0005520_559_1647 355
505 3300035116 Ga0373945_0009031 Ga0373945_0009031_869_1957 355
506 3300035118 Ga0373954_0006497 Ga0373954_0006497_1893_2981 355
507 3300035170 Ga0373943_0003579 Ga0373943_0003579_2391_3479 355
508 3300035171 Ga0373946_0005136 Ga0373946_0005136_3358_4446 355
509 3300035172 Ga0373955_0000983 Ga0373955_0000983_5806_6894 355
510 3300035410 Ga0373924_0000772 Ga0373924_0000772_5753_6841 355
511 3300035691 Ga0373931_0063275 Ga0373931_0063275_404_1513 355
512 3300035692 Ga0373935_0000013 Ga0373935_0000013_65575_66663 355
513 3300035695 Ga0373927_0221991 Ga0373927_0221991_62_1150 355
514 3300035724 Ga0373933_0001422 Ga0373933_0001422_7191_8279 355
515 3300035725 Ga0373947_0002476 Ga0373947_0002476_2187_3275 355
516 3300035725 Ga0373947_0216430 Ga0373947_0216430_153_1244 355
517 3300035725 Ga0373947_0247881 Ga0373947_0247881_51_1157 355
518 3300036401 Ga0373937_0000018 Ga0373937_0000018_109281_110369 355
519 3300037068 Ga0373925_0000896 Ga0373925_0000896_25449_26537 355
520 3300037853 Ga0436364_0908210 Ga0436364_0908210_1739_2827 355
521 3300037853 Ga0436364_1137908 Ga0436364_1137908_172_1296 355
522 3300039447 Ga0436361_0662672 Ga0436361_0662672_1172_2260 355
523 3300044694 Ga0466963_0185202 Ga0466963_0185202_239_1327 355
524 3300046454 Ga0495592_0000055 Ga0495592_0000055_69260_70348 355
525 3300046459 Ga0495629_0008326 Ga0495629_0008326_3196_4284 355
526 3300046463 Ga0495653_0000003 Ga0495653_0000003_209127_210215 355
527 3300046476 Ga0495662_0000609 Ga0495662_0000609_5816_6904 355
528 3300046477 Ga0495664_0000001 Ga0495664_0000001_540417_541505 355
529 3300046511 Ga0495608_0000012 Ga0495608_0000012_25447_26535 355
530 3300046514 Ga0495618_0000012 Ga0495618_0000012_109669_110757 355
531 3300046516 Ga0495628_0000003 Ga0495628_0000003_371601_372689 355
532 3300046517 Ga0495630_0000188 Ga0495630_0000188_25136_26224 355
533 3300046529 Ga0495652_0000001 Ga0495652_0000001_285660_286748 355
534 3300046533 Ga0495640_0000022 Ga0495640_0000022_29650_30738 355
535 3300046533 Ga0495640_0073796 Ga0495640_0073796_804_1910 355
536 3300046536 Ga0495587_0000003 Ga0495587_0000003_206751_207839 355
537 3300046543 Ga0495645_0000004 Ga0495645_0000004_433923_435011 355
538 3300046559 Ga0495667_0000001 Ga0495667_0000001_125460_126548 355
539 3300046642 Ga0495634_0000012 Ga0495634_0000012_67884_68972 355
540 3300046663 Ga0495635_0000011 Ga0495635_0000011_167919_169007 355
541 3300046675 Ga0495657_0000086 Ga0495657_0000086_65137_66225 355
542 3300046678 Ga0495599_0000004 Ga0495599_0000004_170174_171262 355
543 3300046679 Ga0495623_0000044 Ga0495623_0000044_63325_64413 355
544 3300046680 Ga0495646_0000010 Ga0495646_0000010_168755_169843 355
545 3300046689 Ga0495613_0136820 Ga0495613_0136820_416_1504 355
546 3300046690 Ga0495624_0076213 Ga0495624_0076213_516_1604 355
547 3300046809 Ga0495600_0000026 Ga0495600_0000026_25472_26560 355
548 3300047317 Ga0495604_0000010 Ga0495604_0000010_25471_26559 355
549 3300047319 Ga0495674_0000001 Ga0495674_0000001_740354_741442 355
550 3300047322 Ga0495680_0000527 Ga0495680_0000527_7597_8685 355
551 3300047444 Ga0495675_0000009 Ga0495675_0000009_38261_39349 355
552 3300047471 Ga0495684_0000005 Ga0495684_0000005_84201_85289 355
553 3300047673 Ga0495593_0003117 Ga0495593_0003117_7736_8824 355
554 3300048088 Ga0495602_0000002 Ga0495602_0000002_283897_284985 355
555 3300048907 Ga0496104_0034931 Ga0496104_0034931_3467_4555 355
556 3300048929 Ga0496126_0010006 Ga0496126_0010006_6384_7472 355
557 3300049571 Ga0501034_0298504 Ga0501034_0298504_449_1537 355
558 3300049579 Ga0501043_0201896 Ga0501043_0201896_389_1477 355
559 3300049581 Ga0501047_0017460 Ga0501047_0017460_5342_6430 355
560 3300049581 Ga0501047_0033040 Ga0501047_0033040_2985_4073 355
561 3300049583 Ga0501067_0096874 Ga0501067_0096874_202_1290 355
562 3300049585 Ga0501069_0075159 Ga0501069_0075159_287_1375 355
563 3300049585 Ga0501069_0098747 Ga0501069_0098747_557_1645 355
564 3300049586 Ga0501070_0025347 Ga0501070_0025347_2181_3269 355
565 3300049586 Ga0501070_0040560 Ga0501070_0040560_443_1531 355
566 3300049587 Ga0501071_0166946 Ga0501071_0166946_15_1103 355
567 3300049588 Ga0501072_0163351 Ga0501072_0163351_132_1220 355
568 3300049591 Ga0501075_0271156 Ga0501075_0271156_180_1268 355
569 3300049741 Ga0501079_0104000 Ga0501079_0104000_56_1144 355
570 3300049742 Ga0501080_0182138 Ga0501080_0182138_471_1559 355
571 3300049822 Ga0501035_0030975 Ga0501035_0030975_1465_2553 355
572 3300049822 Ga0501035_0052307 Ga0501035_0052307_390_1478 355
573 3300050489 nmdc:mga03683_409_c1 nmdc:mga03683_409_c1_10378_11484 355
574 3300050493 nmdc:mga0k408_58927_c1 nmdc:mga0k408_58927_c1_1062_2150 355
575 3300050507 nmdc:mga05p37_586_c1 nmdc:mga05p37_586_c1_14704_15792 355
576 3300050508 nmdc:mga09592_1648_c1 nmdc:mga09592_1648_c1_1177_2265 355
577 3300050509 nmdc:mga0qj67_20412_c1 nmdc:mga0qj67_20412_c1_2818_3906 355
578 3300050510 nmdc:mga06r32_1924_c1 nmdc:mga06r32_1924_c1_2700_3788 355
579 3300050511 nmdc:mga08y16_204258_c1 nmdc:mga08y16_204258_c1_270_1379 355
580 3300050511 nmdc:mga08y16_4668_c1 nmdc:mga08y16_4668_c1_10567_11655 355
581 3300050513 nmdc:mga0rr50_16629_c1 nmdc:mga0rr50_16629_c1_1248_2456 355
582 3300050514 nmdc:mga08x19_148817_c1 nmdc:mga08x19_148817_c1_268_1371 355
583 3300053077 Ga0495601_0000003 Ga0495601_0000003_285786_286874 355
584 3300053078 Ga0495612_0000009 Ga0495612_0000009_216225_217313 355
585 3300053084 Ga0495595_0000011 Ga0495595_0000011_7984_9072 355
586 3300053085 Ga0495619_0000009 Ga0495619_0000009_206857_207945 355
587 3300053085 Ga0495619_0051636 Ga0495619_0051636_1089_2180 355
588 3300053088 Ga0500644_0034055 Ga0500644_0034055_492_1592 355
589 3300053158 Ga0500627_0086686 Ga0500627_0086686_300_1388 355
590 3300054114 Ga0501084_0272945 Ga0501084_0272945_163_1251 355
591 3300061734 Ga0530510_0291638 Ga0530510_0291638_20_1108 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

76

363

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hzl-assembly1.cif.gz_A crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms 0.9666 24 355
4pet-assembly1.cif.gz_B crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate 0.9661 23 346
4yzz-assembly1.cif.gz_A crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site 0.9598 21 354
2hzl-assembly1.cif.gz_A crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms 0.9581 24 355
7ug8-assembly1.cif.gz_A crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium 0.9546 20 346
ID Description Score Start End Superfamily
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9828 24 350 3.40.190.170
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9711 21 351 3.40.190.170
2hzkC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.9691 24 350 3.40.190.170
4yzzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7 0.958 21 351 3.40.190.170
4petB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9439 148 314 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A658ABT6-F1-model_v4 deleted 0.9905 23 350
AF-A0A0D7EEV2-F1-model_v4 ABC transporter substrate-binding protein 0.9797 24 355 GO:0015849
GO:0031317
GO:0043177
GO:0046872
GO:0055085
AF-A0A0D7EEV2-F1-model_v4 ABC transporter substrate-binding protein 0.9768 24 355 GO:0015849
GO:0031317
GO:0043177
GO:0046872
GO:0055085
AF-A0A3N5FTX4-F1-model_v4 ABC transporter substrate-binding protein 0.9766 42 348 GO:0055085
AF-A0A537VVV0-F1-model_v4 ABC transporter substrate-binding protein 0.9745 66 350 GO:0055085

Feature Viewer

pLDDT pTM Quality
93.29 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map