F465778

General Info

Members Datasets Scaffolds Average Seq Length
578 290 563 186

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_38443_c1|nmdc:mga0k408_38443_c1_930_1601
Length 205
Sequence MGPPYRVRRIDAKNTEPLAVRLRLTISARETKAGWDVEIPAAEELAPDGDSPFAKLESELEKLRNEVLYAQAETQNVRRRLEKEKTDASAYAATGFARDILSVADNLSRALAAIPAELRDDERLKPMLTGIEMTAKEVDSVFQRHGITKIESLGEKLDPNKHQAMIELPHADAEPGTVIQEMQTGYMIKDRLLRPALVGVAKAAE

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
6 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
7 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
8 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
9 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
10 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
11 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
12 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
13 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
14 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
15 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
16 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
17 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
23 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
26 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
160 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
161 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
181 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
184 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
185 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
188 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
192 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
193 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
194 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
200 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
204 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
224 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
229 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
234 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
235 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
236 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
237 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
238 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
248 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
249 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
250 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
251 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
252 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
253 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
254 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
255 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
256 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
257 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
258 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
259 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
260 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
261 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
262 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
263 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
272 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
273 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
274 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
275 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
276 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
277 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
278 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
279 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
280 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
281 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
285 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
286 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
287 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
288 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
289 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 0.52
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.5
Nodule 0.35
Rhizoplane 3.46
Rhizosphere 85.29
Stem 0
Stem Tuber 0.17
Unclassified 6.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2913204 2162886006 Bacteria 1630
2 SwRhRL2b_contig_825531 2162886007 Bacteria 5071
3 JGI24736J21556_1002149 3300001904 Bacteria 3499
4 JGI24752J21851_1001927 3300001976 Bacteria 2768
5 JGI24740J21852_10051343 3300001979 Bacteria 1181
6 JGI24739J22299_10006795 3300001989 Bacteria 4307
7 JGI24739J22299_10014945 3300001989 Bacteria 2823
8 JGI24750J21931_1000005 3300002070 Bacteria 25499
9 JGI24748J21848_1000076 3300002074 Bacteria 33018
10 JGI24748J21848_1007851 3300002074 Bacteria 1253
11 JGI24738J21930_10007634 3300002075 Bacteria 2486
12 JGI24738J21930_10028381 3300002075 Bacteria 1145
13 JGI24749J21850_1000308 3300002076 Bacteria 7478
14 JGI24749J21850_1000500 3300002076 Bacteria 5791
15 JGI24034J26672_10000071 3300002239 Bacteria 27336
16 JGI24751J29686_10000062 3300002459 Bacteria 61661
17 JGI25405J52794_10003563 3300003911 Bacteria 2740
18 Ga0065704_10072521 3300005289 Bacteria 8381
19 Ga0065704_10074425 3300005289 Bacteria 6280
20 Ga0065704_10337971 3300005289 Bacteria 828
21 Ga0065707_10082140 3300005295 Bacteria 21029
22 Ga0065707_10118337 3300005295 Bacteria 2188
23 Ga0065707_10194496 3300005295 Bacteria 1343
24 Ga0065707_10261697 3300005295 Bacteria 1095
25 Ga0065707_10349174 3300005295 Bacteria 921
26 Ga0070658_10052276 3300005327 Bacteria 3313
27 Ga0070658_10058565 3300005327 Bacteria 3136
28 Ga0070658_10384334 3300005327 Bacteria 1205
29 Ga0070658_10486868 3300005327 Bacteria 1065
30 Ga0070658_10545156 3300005327 Bacteria 1004
31 Ga0070683_101180038 3300005329 Bacteria 736
32 Ga0070690_100000110 3300005330 Bacteria 42574
33 Ga0070670_100000005 3300005331 Bacteria 351569
34 Ga0070670_100000125 3300005331 Bacteria 71778
35 Ga0070670_100000485 3300005331 Bacteria 31957
36 Ga0070670_100062683 3300005331 Bacteria 3192
37 Ga0068869_100166460 3300005334 Bacteria 1719
38 Ga0068869_100961131 3300005334 Bacteria 742
39 Ga0070666_10000069 3300005335 Bacteria 75768
40 Ga0070666_10074476 3300005335 Bacteria 2314
41 Ga0070666_10090554 3300005335 Bacteria 2101
42 Ga0070682_100517156 3300005337 Bacteria 928
43 Ga0070660_100004439 3300005339 Bacteria 9693
44 Ga0070689_100008265 3300005340 Bacteria 7324
45 Ga0070661_100058315 3300005344 Bacteria 2829
46 Ga0070692_10119308 3300005345 Bacteria 1469
47 Ga0070668_100000020 3300005347 Bacteria 98203
48 Ga0070668_100000123 3300005347 Bacteria 48192
49 Ga0070668_100144786 3300005347 Bacteria 1917
50 Ga0070669_100000060 3300005353 Bacteria 108287
51 Ga0070669_100000167 3300005353 Bacteria 57589
52 Ga0070669_100000446 3300005353 Bacteria 31546
53 Ga0070669_100109448 3300005353 Bacteria 2095
54 Ga0070669_100168762 3300005353 Bacteria 1705
55 Ga0070669_100366093 3300005353 Bacteria 1173
56 Ga0070669_100660560 3300005353 Bacteria 880
57 Ga0070671_100000232 3300005355 Bacteria 37343
58 Ga0070671_100000854 3300005355 Bacteria 22207
59 Ga0070671_100013374 3300005355 Bacteria 6616
60 Ga0070688_100033833 3300005365 Bacteria 3091
61 Ga0070659_100010748 3300005366 Bacteria 6746
62 Ga0070659_100181465 3300005366 Bacteria 1728
63 Ga0070659_101128428 3300005366 Bacteria 692
64 Ga0070667_100000016 3300005367 Bacteria 237028
65 Ga0070667_100000055 3300005367 Bacteria 151072
66 Ga0070667_100001008 3300005367 Bacteria 25807
67 Ga0070667_100001092 3300005367 Bacteria 24859
68 Ga0070667_100004644 3300005367 Bacteria 11532
69 Ga0070667_100009037 3300005367 Bacteria 8248
70 Ga0070663_100008392 3300005455 Bacteria 6350
71 Ga0070663_100039658 3300005455 Bacteria 3293
72 Ga0070662_100000817 3300005457 Bacteria 19185
73 Ga0070662_100013295 3300005457 Bacteria 5476
74 Ga0070662_100359362 3300005457 Bacteria 1195
75 Ga0070662_100564757 3300005457 Bacteria 954
76 Ga0070685_10000036 3300005466 Bacteria 80641
77 Ga0070679_100024783 3300005530 Bacteria 5880
78 Ga0070679_100044501 3300005530 Bacteria 4422
79 Ga0070679_100302595 3300005530 Bacteria 1550
80 Ga0070679_101056373 3300005530 Bacteria 756
81 Ga0070684_100127559 3300005535 Bacteria 2293
82 Ga0070684_100172175 3300005535 Bacteria 1966
83 Ga0070684_100455453 3300005535 Bacteria 1183
84 Ga0070697_100454502 3300005536 Bacteria 1116
85 Ga0068853_100094743 3300005539 Bacteria 2631
86 Ga0070672_100336696 3300005543 Bacteria 1284
87 Ga0070686_100000045 3300005544 Bacteria 101988
88 Ga0070696_100034529 3300005546 Bacteria 3479
89 Ga0070693_100854388 3300005547 Bacteria 679
90 Ga0070665_100000042 3300005548 Bacteria 292582
91 Ga0070665_100032131 3300005548 Bacteria 5283
92 Ga0070665_100143060 3300005548 Bacteria 2395
93 Ga0070665_100633637 3300005548 Bacteria 1082
94 Ga0068855_100040201 3300005563 Bacteria 5551
95 Ga0068855_100220777 3300005563 Bacteria 2125
96 Ga0068855_101045957 3300005563 Bacteria 856
97 Ga0070664_100009011 3300005564 Bacteria 8095
98 Ga0070664_100017908 3300005564 Bacteria 5816
99 Ga0070664_100023442 3300005564 Bacteria 5099
100 Ga0068857_100015922 3300005577 Bacteria 6583
101 Ga0068857_100040794 3300005577 Bacteria 4115
102 Ga0068857_100153186 3300005577 Bacteria 2089
103 Ga0068857_100230774 3300005577 Bacteria 1693
104 Ga0068857_100368729 3300005577 Bacteria 1332
105 Ga0068857_100414504 3300005577 Bacteria 1255
106 Ga0068854_100024805 3300005578 Bacteria 4110
107 Ga0068854_100069986 3300005578 Bacteria 2563
108 Ga0068854_101158285 3300005578 Bacteria 691
109 Ga0068856_100028832 3300005614 Bacteria 5423
110 Ga0068852_100214782 3300005616 Bacteria 1827
111 Ga0068852_100563564 3300005616 Bacteria 1140
112 Ga0068859_100006686 3300005617 Bacteria 11707
113 Ga0068859_100008241 3300005617 Bacteria 10570
114 Ga0068859_100011875 3300005617 Bacteria 8750
115 Ga0068859_100020546 3300005617 Bacteria 6625
116 Ga0068859_100049269 3300005617 Bacteria 4230
117 Ga0068859_100174343 3300005617 Bacteria 2232
118 Ga0068864_100000011 3300005618 Bacteria 350056
119 Ga0068864_100000098 3300005618 Bacteria 85661
120 Ga0068864_100144324 3300005618 Bacteria 2150
121 Ga0068864_101275641 3300005618 Bacteria 734
122 Ga0068861_100001207 3300005719 Bacteria 16096
123 Ga0068861_100033153 3300005719 Bacteria 3808
124 Ga0068851_10176315 3300005834 Bacteria 1182
125 Ga0068863_100000020 3300005841 Bacteria 198519
126 Ga0068863_100000127 3300005841 Bacteria 80572
127 Ga0068863_100000239 3300005841 Bacteria 58509
128 Ga0068863_100003798 3300005841 Bacteria 14933
129 Ga0068863_100009580 3300005841 Bacteria 9448
130 Ga0068863_100033855 3300005841 Bacteria 4868
131 Ga0068863_100055314 3300005841 Bacteria 3758
132 Ga0068863_100336600 3300005841 Bacteria 1468
133 Ga0068863_101492118 3300005841 Bacteria 684
134 Ga0068858_100000186 3300005842 Bacteria 65965
135 Ga0068858_100002824 3300005842 Bacteria 17456
136 Ga0068858_100584889 3300005842 Bacteria 1082
137 Ga0068860_100000090 3300005843 Bacteria 151520
138 Ga0068860_100000182 3300005843 Bacteria 100888
139 Ga0068860_100000361 3300005843 Bacteria 60231
140 Ga0068860_100008972 3300005843 Bacteria 9962
141 Ga0068860_100846840 3300005843 Bacteria 929
142 Ga0068860_100964053 3300005843 Bacteria 870
143 Ga0068862_100000104 3300005844 Bacteria 100182
144 Ga0068862_100000133 3300005844 Bacteria 86113
145 Ga0068862_100000173 3300005844 Bacteria 71977
146 Ga0068862_100000308 3300005844 Bacteria 53687
147 Ga0068862_100001485 3300005844 Bacteria 21504
148 Ga0068862_100017371 3300005844 Bacteria 5991
149 Ga0068862_100464363 3300005844 Bacteria 1195
150 Ga0068862_100804380 3300005844 Bacteria 918
151 Ga0081455_10000215 3300005937 Bacteria 73808
152 Ga0075366_10006964 3300006195 Bacteria 6224
153 Ga0075366_10023197 3300006195 Bacteria 3614
154 Ga0075366_10160977 3300006195 Bacteria 1360
155 Ga0075430_100045853 3300006846 Bacteria 3692
156 Ga0097620_100006686 3300006931 Bacteria 11707
157 Ga0097620_100008240 3300006931 Bacteria 10570
158 Ga0097620_100011875 3300006931 Bacteria 8750
159 Ga0097620_100020546 3300006931 Bacteria 6625
160 Ga0097620_100049271 3300006931 Bacteria 4230
161 Ga0097620_100174356 3300006931 Bacteria 2232
162 Ga0079104_1036089 3300006946 Bacteria 1189
163 Ga0075435_100152084 3300007076 Bacteria 1946
164 Ga0105251_10003406 3300009011 Bacteria 11537
165 Ga0105240_10004567 3300009093 Bacteria 20996
166 Ga0111539_10208209 3300009094 Bacteria 2279
167 Ga0111539_10646309 3300009094 Bacteria 1232
168 Ga0105247_10010996 3300009101 Bacteria 5462
169 Ga0105247_10023891 3300009101 Bacteria 3683
170 Ga0105247_10088598 3300009101 Bacteria 1961
171 Ga0114129_10703605 3300009147 Bacteria 1298
172 Ga0105241_10486379 3300009174 Bacteria 1098
173 Ga0105248_10000229 3300009177 Bacteria 64280
174 Ga0105248_10001403 3300009177 Bacteria 26914
175 Ga0105248_10043322 3300009177 Bacteria 5046
176 Ga0105248_10129926 3300009177 Bacteria 2842
177 Ga0105248_10701699 3300009177 Bacteria 1142
178 Ga0105237_10122940 3300009545 Bacteria 2589
179 Ga0105238_10884917 3300009551 Bacteria 911
180 Ga0105238_10939420 3300009551 Bacteria 884
181 Ga0105249_10000012 3300009553 Bacteria 292640
182 Ga0105249_10000037 3300009553 Bacteria 197428
183 Ga0105249_10000116 3300009553 Bacteria 108394
184 Ga0105239_10802317 3300010375 Bacteria 1078
185 Ga0105246_10001236 3300011119 Bacteria 14986
186 Ga0105246_10004297 3300011119 Bacteria 8665
187 Ga0157326_1000645 3300012513 Bacteria 4090
188 Ga0157373_10069845 3300013100 Bacteria 2483
189 Ga0157373_10116382 3300013100 Bacteria 1879
190 Ga0157373_10194420 3300013100 Bacteria 1430
191 Ga0157371_10008038 3300013102 Bacteria 8442
192 Ga0157371_10025049 3300013102 Bacteria 4353
193 Ga0157371_10184628 3300013102 Bacteria 1492
194 Ga0157371_10470661 3300013102 Bacteria 925
195 Ga0157370_10008050 3300013104 Bacteria 11412
196 Ga0157370_10573978 3300013104 Bacteria 1033
197 Ga0157370_10785974 3300013104 Bacteria 866
198 Ga0157369_10064214 3300013105 Bacteria 3954
199 Ga0157369_10249505 3300013105 Bacteria 1852
200 Ga0157378_10020993 3300013297 Bacteria 5746
201 Ga0163162_10162903 3300013306 Bacteria 2353
202 Ga0163162_10228716 3300013306 Bacteria 1990
203 Ga0157372_10020903 3300013307 Bacteria 7065
204 Ga0157372_10180258 3300013307 Bacteria 2445
205 Ga0157372_10519079 3300013307 Bacteria 1389
206 Ga0157372_10874791 3300013307 Bacteria 1043
207 Ga0157375_11070886 3300013308 Bacteria 943
208 Ga0157375_11507781 3300013308 Bacteria 794
209 Ga0163163_10100465 3300014325 Bacteria 2915
210 Ga0163163_10131526 3300014325 Bacteria 2543
211 Ga0163163_10492079 3300014325 Bacteria 1288
212 Ga0157380_10000083 3300014326 Bacteria 52136
213 Ga0157380_10002669 3300014326 Bacteria 12096
214 Ga0157380_10012259 3300014326 Bacteria 6211
215 Ga0157379_10037988 3300014968 Bacteria 4296
216 Ga0157379_10206444 3300014968 Bacteria 1777
217 Ga0157379_10324147 3300014968 Bacteria 1407
218 Ga0157376_11009401 3300014969 Bacteria 855
219 Ga0163161_10000202 3300017792 Bacteria 54518
220 Ga0163161_10098300 3300017792 Bacteria 2175
221 Ga0206353_10841921 3300020082 Bacteria 13432
222 Ga0213873_10000007 3300021358 Bacteria 309961
223 Ga0213876_10000005 3300021384 Bacteria 727326
224 Ga0207697_10216926 3300025315 Bacteria 844
225 Ga0207656_10044753 3300025321 Bacteria 1891
226 Ga0207696_1001700 3300025711 Bacteria 11426
227 Ga0207713_1003933 3300025735 Bacteria 9884
228 Ga0207713_1008709 3300025735 Bacteria 5796
229 Ga0207710_10013466 3300025900 Bacteria 3441
230 Ga0207710_10051025 3300025900 Bacteria 1857
231 Ga0207680_10000012 3300025903 Bacteria 293810
232 Ga0207680_10070478 3300025903 Bacteria 2164
233 Ga0207647_10002793 3300025904 Bacteria 13172
234 Ga0207645_10014814 3300025907 Bacteria 5204
235 Ga0207705_10067565 3300025909 Bacteria 2587
236 Ga0207705_10263451 3300025909 Bacteria 1316
237 Ga0207705_10487628 3300025909 Bacteria 957
238 Ga0207705_10530509 3300025909 Bacteria 915
239 Ga0207654_10000754 3300025911 Bacteria 17918
240 Ga0207654_10264263 3300025911 Bacteria 1158
241 Ga0207654_10574038 3300025911 Bacteria 803
242 Ga0207707_10471073 3300025912 Bacteria 1073
243 Ga0207707_10738906 3300025912 Bacteria 824
244 Ga0207695_10001501 3300025913 Bacteria 38827
245 Ga0207695_10044031 3300025913 Bacteria 4752
246 Ga0207671_10005938 3300025914 Bacteria 11067
247 Ga0207671_10040833 3300025914 Bacteria 3433
248 Ga0207660_10500189 3300025917 Bacteria 986
249 Ga0207657_10004557 3300025919 Bacteria 14649
250 Ga0207657_10060829 3300025919 Bacteria 3240
251 Ga0207657_10450936 3300025919 Bacteria 1009
252 Ga0207649_10058641 3300025920 Bacteria 2412
253 Ga0207649_10136234 3300025920 Bacteria 1674
254 Ga0207649_10578187 3300025920 Bacteria 862
255 Ga0207652_10001167 3300025921 Bacteria 23590
256 Ga0207652_10225391 3300025921 Bacteria 1689
257 Ga0207681_10000001 3300025923 Bacteria 1105841
258 Ga0207681_10000076 3300025923 Bacteria 89353
259 Ga0207681_10000203 3300025923 Bacteria 47389
260 Ga0207681_10013391 3300025923 Bacteria 5076
261 Ga0207681_10381225 3300025923 Bacteria 1135
262 Ga0207681_10656486 3300025923 Bacteria 870
263 Ga0207694_10036918 3300025924 Bacteria 3750
264 Ga0207650_10000018 3300025925 Bacteria 352120
265 Ga0207650_10000197 3300025925 Bacteria 69480
266 Ga0207650_10002683 3300025925 Bacteria 12303
267 Ga0207650_10027745 3300025925 Bacteria 4055
268 Ga0207659_10279836 3300025926 Bacteria 1363
269 Ga0207644_10000025 3300025931 Bacteria 152401
270 Ga0207644_10000050 3300025931 Bacteria 93772
271 Ga0207644_10000254 3300025931 Bacteria 36059
272 Ga0207644_10029218 3300025931 Bacteria 3823
273 Ga0207690_10106370 3300025932 Bacteria 2013
274 Ga0207690_10157379 3300025932 Bacteria 1690
275 Ga0207690_10447274 3300025932 Bacteria 1038
276 Ga0207706_10001603 3300025933 Bacteria 22433
277 Ga0207706_10017880 3300025933 Bacteria 6384
278 Ga0207706_10436942 3300025933 Bacteria 1133
279 Ga0207691_10326015 3300025940 Bacteria 1316
280 Ga0207691_10612186 3300025940 Bacteria 922
281 Ga0207711_10000022 3300025941 Bacteria 340441
282 Ga0207711_10001356 3300025941 Bacteria 23103
283 Ga0207711_10272269 3300025941 Bacteria 1558
284 Ga0207711_10275387 3300025941 Bacteria 1549
285 Ga0207689_10063889 3300025942 Bacteria 3028
286 Ga0207661_10118549 3300025944 Bacteria 2250
287 Ga0207679_10148547 3300025945 Bacteria 1904
288 Ga0207679_10491944 3300025945 Bacteria 1093
289 Ga0207679_10872696 3300025945 Bacteria 822
290 Ga0207667_10032623 3300025949 Bacteria 5609
291 Ga0207667_10063601 3300025949 Bacteria 3855
292 Ga0207667_10116733 3300025949 Bacteria 2750
293 Ga0207667_10737994 3300025949 Bacteria 985
294 Ga0207712_10000021 3300025961 Bacteria 292649
295 Ga0207712_10000035 3300025961 Bacteria 201152
296 Ga0207712_10000726 3300025961 Bacteria 25124
297 Ga0207668_10000048 3300025972 Bacteria 100390
298 Ga0207668_10000111 3300025972 Bacteria 58689
299 Ga0207668_10049598 3300025972 Bacteria 2887
300 Ga0207668_10074263 3300025972 Bacteria 2440
301 Ga0207640_10017102 3300025981 Bacteria 4235
302 Ga0207640_10112453 3300025981 Bacteria 1933
303 Ga0207640_10226968 3300025981 Bacteria 1434
304 Ga0207658_10000090 3300025986 Bacteria 100143
305 Ga0207658_10000134 3300025986 Bacteria 78342
306 Ga0207658_10000143 3300025986 Bacteria 74612
307 Ga0207658_10001629 3300025986 Bacteria 17221
308 Ga0207658_10003728 3300025986 Bacteria 10731
309 Ga0207658_10005982 3300025986 Bacteria 8317
310 Ga0207703_10000231 3300026035 Bacteria 63888
311 Ga0207703_10007079 3300026035 Bacteria 8924
312 Ga0207703_10760287 3300026035 Bacteria 924
313 Ga0207639_10036138 3300026041 Bacteria 3659
314 Ga0207639_10136686 3300026041 Bacteria 2037
315 Ga0207639_10177683 3300026041 Bacteria 1808
316 Ga0207678_10643815 3300026067 Bacteria 931
317 Ga0207702_10011360 3300026078 Bacteria 7425
318 Ga0207641_10000001 3300026088 Bacteria 1180841
319 Ga0207641_10000022 3300026088 Bacteria 279334
320 Ga0207641_10000589 3300026088 Bacteria 39950
321 Ga0207641_10001362 3300026088 Bacteria 24233
322 Ga0207641_10016881 3300026088 Bacteria 5978
323 Ga0207641_10267282 3300026088 Bacteria 1603
324 Ga0207648_11116444 3300026089 Bacteria 740
325 Ga0207676_10000004 3300026095 Bacteria 725417
326 Ga0207676_10000209 3300026095 Bacteria 50724
327 Ga0207676_10016182 3300026095 Bacteria 5398
328 Ga0207676_10031900 3300026095 Bacteria 3964
329 Ga0207676_10926907 3300026095 Bacteria 855
330 Ga0207674_10000814 3300026116 Bacteria 40536
331 Ga0207674_10020781 3300026116 Bacteria 7085
332 Ga0207674_10112966 3300026116 Bacteria 2690
333 Ga0207674_10120849 3300026116 Bacteria 2587
334 Ga0207675_100000227 3300026118 Bacteria 53090
335 Ga0207675_100002408 3300026118 Bacteria 18527
336 Ga0207675_100170468 3300026118 Bacteria 2080
337 Ga0207698_10058099 3300026142 Bacteria 2996
338 Ga0207698_10292856 3300026142 Bacteria 1511
339 Ga0207698_10424293 3300026142 Bacteria 1277
340 Ga0207698_10424790 3300026142 Bacteria 1276
341 Ga0209281_1014027 3300027111 Bacteria 1709
342 Ga0209974_10012104 3300027876 Bacteria 2888
343 Ga0209974_10112566 3300027876 Bacteria 959
344 Ga0207428_10032857 3300027907 Bacteria 4266
345 Ga0268266_10000054 3300028379 Bacteria 292717
346 Ga0268266_10037417 3300028379 Bacteria 4134
347 Ga0268266_10533327 3300028379 Bacteria 1123
348 Ga0268265_10000002 3300028380 Bacteria 1035381
349 Ga0268265_10000090 3300028380 Bacteria 116514
350 Ga0268265_10001609 3300028380 Bacteria 18629
351 Ga0268265_10001818 3300028380 Bacteria 17052
352 Ga0268265_10004696 3300028380 Bacteria 9432
353 Ga0268265_10092441 3300028380 Bacteria 2421
354 Ga0268265_10331343 3300028380 Bacteria 1383
355 Ga0268264_10000074 3300028381 Bacteria 259555
356 Ga0268264_10000075 3300028381 Bacteria 256011
357 Ga0268264_10000087 3300028381 Bacteria 236696
358 Ga0268264_10016551 3300028381 Bacteria 6037
359 Ga0268264_10031336 3300028381 Bacteria 4360
360 Ga0268264_10152974 3300028381 Bacteria 2070
361 Ga0268264_10643202 3300028381 Bacteria 1049
362 Ga0316176_1090056 3300030732 Bacteria 1204
363 Ga0316183_1200454 3300030742 Bacteria 879
364 Ga0316182_1125745 3300030745 Bacteria 3190
365 Ga0316182_1389245 3300030745 Bacteria 721
366 Ga0307513_10027979 3300031456 Bacteria 6460
367 Ga0307408_100058865 3300031548 Bacteria 2794
368 Ga0307408_100087356 3300031548 Bacteria 2346
369 Ga0307408_100106029 3300031548 Bacteria 2150
370 Ga0307408_100782007 3300031548 Bacteria 865
371 Ga0307408_100835333 3300031548 Bacteria 839
372 Ga0307405_10000836 3300031731 Bacteria 12118
373 Ga0307405_10006159 3300031731 Bacteria 5876
374 Ga0307405_10055309 3300031731 Bacteria 2483
375 Ga0307405_10166316 3300031731 Bacteria 1568
376 Ga0307405_10305605 3300031731 Bacteria 1209
377 Ga0307405_11028171 3300031731 Bacteria 704
378 Ga0307413_10054139 3300031824 Bacteria 2433
379 Ga0307413_10064998 3300031824 Bacteria 2269
380 Ga0307413_10081048 3300031824 Bacteria 2080
381 Ga0307410_10055430 3300031852 Bacteria 2691
382 Ga0307410_10344099 3300031852 Bacteria 1189
383 Ga0307407_10036498 3300031903 Bacteria 2709
384 Ga0307407_10122197 3300031903 Bacteria 1653
385 Ga0307407_10289216 3300031903 Bacteria 1138
386 Ga0307407_10315983 3300031903 Bacteria 1094
387 Ga0307412_10008462 3300031911 Bacteria 5874
388 Ga0307412_10021958 3300031911 Bacteria 3905
389 Ga0307412_10024561 3300031911 Bacteria 3721
390 Ga0307412_10034814 3300031911 Bacteria 3212
391 Ga0307412_10081056 3300031911 Bacteria 2243
392 Ga0307412_10187860 3300031911 Bacteria 1560
393 Ga0307412_10205825 3300031911 Bacteria 1498
394 Ga0307412_10293554 3300031911 Bacteria 1282
395 Ga0307409_100023054 3300031995 Bacteria 4305
396 Ga0307409_100058219 3300031995 Bacteria 3000
397 Ga0307409_100087449 3300031995 Bacteria 2540
398 Ga0307409_100410262 3300031995 Bacteria 1296
399 Ga0307416_100006179 3300032002 Bacteria 7470
400 Ga0307416_100329211 3300032002 Bacteria 1534
401 Ga0307416_100432716 3300032002 Bacteria 1363
402 Ga0307416_100780041 3300032002 Bacteria 1050
403 Ga0307414_10014382 3300032004 Bacteria 4743
404 Ga0307414_10034003 3300032004 Bacteria 3375
405 Ga0307414_10104405 3300032004 Bacteria 2140
406 Ga0307414_10175330 3300032004 Bacteria 1719
407 Ga0307414_10199094 3300032004 Bacteria 1627
408 Ga0307414_10278918 3300032004 Bacteria 1403
409 Ga0307414_10466730 3300032004 Bacteria 1110
410 Ga0307411_10023453 3300032005 Bacteria 3656
411 Ga0307411_10091571 3300032005 Bacteria 2124
412 Ga0307411_10342037 3300032005 Bacteria 1216
413 Ga0307415_100002260 3300032126 Bacteria 9545
414 Ga0307415_100411082 3300032126 Bacteria 1158
415 Ga0307415_100611991 3300032126 Bacteria 971
416 Ga0373927_0012559 3300035695 Bacteria 5640
417 Ga0395905_0039185 3300037471 Bacteria 4446
418 Ga0395905_0325285 3300037471 Bacteria 1428
419 Ga0395901_0891151 3300038443 Bacteria 872
420 Ga0395901_0924944 3300038443 Bacteria 852
421 Ga0436365_0352550 3300039437 Bacteria 74350
422 Ga0436365_0455740 3300039437 Bacteria 1104
423 Ga0436365_0524113 3300039437 Bacteria 852
424 Ga0436362_0451893 3300039453 Bacteria 163419
425 Ga0451853_1008997 3300041512 Bacteria 716
426 Ga0439431_0037573 3300041997 Bacteria 1223
427 Ga0439445_0029994 3300042004 Bacteria 1407
428 Ga0439462_0007196 3300042015 Bacteria 2784
429 Ga0450917_001488 3300042120 Bacteria 1685
430 Ga0450905_000642 3300042142 Bacteria 4315
431 Ga0450889_000953 3300042144 Bacteria 3071
432 Ga0439434_0017189 3300042435 Bacteria 2164
433 Ga0450893_0020011 3300042532 Bacteria 1147
434 Ga0466973_0123262 3300044659 Bacteria 2127
435 Ga0495617_032784 3300046452 Bacteria 1744
436 Ga0495638_0000011 3300046460 Bacteria 442453
437 Ga0495596_0120578 3300046500 Bacteria 1018
438 Ga0495583_0000077 3300046506 Bacteria 171772
439 Ga0495632_0000834 3300046519 Bacteria 27160
440 Ga0495637_0015444 3300046520 Bacteria 3581
441 Ga0495643_0092534 3300046522 Bacteria 1558
442 Ga0495648_0000023 3300046524 Bacteria 240174
443 Ga0495648_0401582 3300046524 Bacteria 612
444 Ga0495663_0005516 3300046525 Bacteria 3510
445 Ga0495663_0024611 3300046525 Bacteria 1751
446 Ga0495654_0001135 3300046530 Bacteria 19108
447 Ga0495621_0001374 3300046539 Bacteria 6304
448 Ga0495597_0007292 3300046542 Bacteria 5635
449 Ga0495633_0010430 3300046558 Bacteria 5068
450 Ga0495633_0087328 3300046558 Bacteria 1450
451 Ga0495633_0126152 3300046558 Bacteria 1184
452 Ga0495668_0010459 3300046616 Bacteria 5613
453 Ga0495668_0015691 3300046616 Bacteria 4416
454 Ga0495669_0007253 3300046684 Bacteria 4645
455 Ga0495669_0024612 3300046684 Bacteria 2622
456 Ga0495670_0027384 3300046691 Bacteria 2823
457 Ga0495671_0000012 3300046692 Bacteria 358632
458 Ga0495677_0020681 3300047445 Bacteria 2385
459 Ga0495673_0000029 3300047469 Bacteria 471019
460 Ga0495615_0052945 3300048090 Bacteria 1050
461 Ga0496100_0116741 3300048903 Bacteria 1862
462 Ga0496100_0202683 3300048903 Bacteria 1447
463 Ga0496101_0002372 3300048904 Bacteria 11562
464 Ga0496101_0305534 3300048904 Bacteria 1246
465 Ga0496102_0000162 3300048905 Bacteria 89746
466 Ga0496102_0005342 3300048905 Bacteria 10903
467 Ga0496103_0000328 3300048906 Bacteria 43483
468 Ga0496103_0001069 3300048906 Bacteria 19126
469 Ga0496103_0046120 3300048906 Bacteria 2690
470 Ga0496104_0000083 3300048907 Bacteria 91698
471 Ga0496105_0000086 3300048908 Bacteria 66447
472 Ga0496105_0081442 3300048908 Bacteria 2674
473 Ga0496106_0231552 3300048909 Bacteria 1475
474 Ga0496107_0034169 3300048910 Bacteria 3641
475 Ga0496107_0174134 3300048910 Bacteria 1597
476 Ga0496111_0455104 3300048914 Bacteria 944
477 Ga0496112_0070706 3300048915 Bacteria 3449
478 Ga0496113_0000776 3300048916 Bacteria 16491
479 Ga0496114_0006267 3300048917 Bacteria 9365
480 Ga0496115_0163029 3300048918 Bacteria 1843
481 Ga0496116_0018743 3300048919 Bacteria 5320
482 Ga0496117_0000323 3300048920 Bacteria 83916
483 Ga0496117_0007388 3300048920 Bacteria 10754
484 Ga0496117_0038417 3300048920 Bacteria 3549
485 Ga0496118_0004928 3300048921 Bacteria 15493
486 Ga0496118_0012140 3300048921 Bacteria 8311
487 Ga0496118_0014592 3300048921 Bacteria 7344
488 Ga0496119_0000180 3300048922 Bacteria 88339
489 Ga0496120_0000342 3300048923 Bacteria 77136
490 Ga0496121_0002474 3300048924 Bacteria 28166
491 Ga0496122_0000918 3300048925 Bacteria 53963
492 Ga0496123_0001257 3300048926 Bacteria 36453
493 Ga0496124_0059542 3300048927 Bacteria 3207
494 Ga0496124_0372003 3300048927 Bacteria 1003
495 Ga0496125_0004290 3300048928 Bacteria 16559
496 Ga0496125_0047287 3300048928 Bacteria 3600
497 Ga0496126_0000044 3300048929 Bacteria 335904
498 Ga0496126_0283870 3300048929 Bacteria 1370
499 Ga0501290_000074 3300049513 Bacteria 14077
500 Ga0501292_000027 3300049515 Bacteria 41628
501 Ga0501294_000682 3300049517 Bacteria 3816
502 Ga0501300_001473 3300049523 Bacteria 3533
503 Ga0501301_007746 3300049524 Bacteria 834
504 Ga0501315_043021 3300049531 Bacteria 689
505 Ga0501033_0079207 3300049570 Bacteria 2411
506 Ga0501034_0305097 3300049571 Bacteria 1528
507 Ga0501036_0303023 3300049572 Bacteria 1336
508 Ga0501038_0153945 3300049574 Bacteria 1873
509 Ga0501038_0887470 3300049574 Bacteria 659
510 Ga0501039_1044371 3300049575 Bacteria 634
511 Ga0501042_0738266 3300049578 Bacteria 716
512 Ga0501043_0090388 3300049579 Bacteria 2407
513 Ga0501047_0012927 3300049581 Bacteria 7906
514 Ga0501047_0381249 3300049581 Bacteria 1244
515 Ga0501206_001212 3300049653 Bacteria 3226
516 Ga0501222_000773 3300049662 Bacteria 4609
517 Ga0501223_001826 3300049663 Bacteria 4812
518 Ga0501224_000579 3300049664 Bacteria 4503
519 Ga0501227_037034 3300049665 Bacteria 1192
520 Ga0501233_001196 3300049668 Bacteria 4415
521 Ga0501235_001128 3300049669 Bacteria 5596
522 Ga0501259_001587 3300049688 Bacteria 3785
523 Ga0501261_000011 3300049690 Bacteria 48296
524 Ga0501225_0001543 3300049705 Bacteria 7232
525 Ga0501245_001509 3300049708 Bacteria 3025
526 Ga0501264_005243 3300049761 Bacteria 1180
527 Ga0501279_000010 3300049775 Bacteria 103375
528 Ga0501280_000099 3300049776 Bacteria 22972
529 Ga0501281_00077 3300049777 Bacteria 11306
530 Ga0501282_002009 3300049778 Bacteria 2238
531 Ga0501283_021758 3300049779 Bacteria 1030
532 Ga0501035_0368683 3300049822 Bacteria 1199
533 Ga0501044_0087610 3300049823 Bacteria 3145
534 Ga0501044_0106673 3300049823 Bacteria 2813
535 Ga0501044_0204246 3300049823 Bacteria 1933
536 nmdc:mga0k408_38443_c1 3300050493 Bacteria 2746
537 nmdc:mga07m45_233774_c1 3300050496 Bacteria 1069
538 nmdc:mga0qj67_86302_c1 3300050509 Bacteria 2518
539 nmdc:mga08y16_161266_c1 3300050511 Bacteria 2330
540 nmdc:mga0n895_415571_c1 3300050512 Bacteria 1360
541 Ga0500643_002551 3300053087 Bacteria 9293
542 Ga0500643_005656 3300053087 Bacteria 5346
543 Ga0500647_0011154 3300053091 Bacteria 4001
544 Ga0500651_0003100 3300053093 Bacteria 9004
545 Ga0500607_000082 3300053121 Bacteria 70790
546 Ga0500618_004495 3300053125 Bacteria 4430
547 Ga0500642_0001312 3300053130 Bacteria 7111
548 Ga0500652_033723 3300053131 Bacteria 2025
549 Ga0500655_000307 3300053133 Bacteria 11138
550 Ga0500559_0000199 3300053136 Bacteria 47863
551 Ga0500573_0065188 3300053140 Bacteria 2083
552 Ga0500590_000114 3300053148 Bacteria 21825
553 Ga0500590_111102 3300053148 Bacteria 1300
554 Ga0500622_0104988 3300053156 Bacteria 1386
555 Ga0500627_0002353 3300053158 Bacteria 5588
556 Ga0500639_026663 3300053163 Bacteria 3054
557 Ga0500636_0196899 3300053177 Bacteria 1069
558 Ga0500637_0036449 3300053178 Bacteria 2761
559 Ga0500637_0344240 3300053178 Bacteria 796
560 Ga0500570_000053 3300053724 Bacteria 28643
561 Ga0500645_028994 3300053730 Bacteria 1672
562 Ga0590071_023651 3300059421 Bacteria 1454
563 Ga0587082_064726 3300059504 Bacteria 729

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014969 Ga0157376_11009401 Ga0157376_110094012 154
2 3300005577 Ga0068857_100230774 Ga0068857_1002307742 156
3 3300009551 Ga0105238_10884917 Ga0105238_108849172 156
4 3300026116 Ga0207674_10120849 Ga0207674_101208492 156
5 3300005327 Ga0070658_10384334 Ga0070658_103843341 164
6 3300025909 Ga0207705_10263451 Ga0207705_102634512 164
7 3300032002 Ga0307416_100329211 Ga0307416_1003292112 164
8 3300005295 Ga0065707_10261697 Ga0065707_102616972 166
9 3300014968 Ga0157379_10206444 Ga0157379_102064441 166
10 3300046452 Ga0495617_032784 Ga0495617_032784_279_848 166
11 3300046460 Ga0495638_0000011 Ga0495638_0000011_231638_232207 166
12 3300046506 Ga0495583_0000077 Ga0495583_0000077_14026_14595 166
13 3300046519 Ga0495632_0000834 Ga0495632_0000834_22485_23054 166
14 3300046524 Ga0495648_0000023 Ga0495648_0000023_29358_29927 166
15 3300046558 Ga0495633_0010430 Ga0495633_0010430_46_615 166
16 3300046692 Ga0495671_0000012 Ga0495671_0000012_200877_201446 166
17 3300047469 Ga0495673_0000029 Ga0495673_0000029_157187_157756 166
18 3300037471 Ga0395905_0325285 Ga0395905_0325285_346_897 167
19 3300044659 Ga0466973_0123262 Ga0466973_0123262_474_1019 167
20 3300049579 Ga0501043_0090388 Ga0501043_0090388_1789_2334 167
21 3300049581 Ga0501047_0012927 Ga0501047_0012927_1799_2344 167
22 3300049823 Ga0501044_0204246 Ga0501044_0204246_1294_1839 167
23 3300005353 Ga0070669_100660560 Ga0070669_1006605601 168
24 3300025923 Ga0207681_10656486 Ga0207681_106564862 168
25 3300005841 Ga0068863_100033855 Ga0068863_1000338553 170
26 3300026088 Ga0207641_10016881 Ga0207641_100168815 170
27 3300050512 nmdc:mga0n895_415571_c1 nmdc:mga0n895_415571_c1_97_624 170
28 3300053140 Ga0500573_0065188 Ga0500573_0065188_63_599 170
29 3300013100 Ga0157373_10194420 Ga0157373_101944201 171
30 3300031548 Ga0307408_100106029 Ga0307408_1001060293 171
31 3300031903 Ga0307407_10122197 Ga0307407_101221972 171
32 3300031911 Ga0307412_10187860 Ga0307412_101878602 171
33 3300032004 Ga0307414_10466730 Ga0307414_104667302 171
34 iso_pu_bacteria 2882806704 2882807783 171
35 3300005331 Ga0070670_100062683 Ga0070670_1000626832 172
36 3300005347 Ga0070668_100000123 Ga0070668_10000012346 172
37 3300005355 Ga0070671_100000232 Ga0070671_10000023221 172
38 3300005366 Ga0070659_101128428 Ga0070659_1011284281 172
39 3300005535 Ga0070684_100127559 Ga0070684_1001275592 172
40 3300005548 Ga0070665_100143060 Ga0070665_1001430602 172
41 3300005617 Ga0068859_100011875 Ga0068859_1000118754 172
42 3300005841 Ga0068863_100000020 Ga0068863_1000000206 172
43 3300006931 Ga0097620_100011875 Ga0097620_1000118754 172
44 3300013104 Ga0157370_10573978 Ga0157370_105739781 172
45 3300025931 Ga0207644_10000025 Ga0207644_1000002528 172
46 3300025972 Ga0207668_10000111 Ga0207668_100001112 172
47 3300026088 Ga0207641_10000001 Ga0207641_10000001957 172
48 3300028381 Ga0268264_10016551 Ga0268264_100165514 172
49 3300030732 Ga0316176_1090056 Ga0316176_10900562 173
50 3300030745 Ga0316182_1125745 Ga0316182_11257452 173
51 3300005536 Ga0070697_100454502 Ga0070697_1004545021 174
52 3300007076 Ga0075435_100152084 Ga0075435_1001520842 174
53 3300009177 Ga0105248_10000229 Ga0105248_100002295 174
54 3300014325 Ga0163163_10100465 Ga0163163_101004652 174
55 3300014326 Ga0157380_10000083 Ga0157380_100000833 174
56 3300020082 Ga0206353_10841921 Ga0206353_1084192113 174
57 3300021358 Ga0213873_10000007 Ga0213873_10000007160 174
58 3300021384 Ga0213876_10000005 Ga0213876_10000005196 174
59 3300031548 Ga0307408_100835333 Ga0307408_1008353332 174
60 3300039437 Ga0436365_0352550 Ga0436365_0352550_21793_22329 174
61 3300039437 Ga0436365_0455740 Ga0436365_0455740_459_1007 174
62 3300039437 Ga0436365_0524113 Ga0436365_0524113_78_614 174
63 3300039453 Ga0436362_0451893 Ga0436362_0451893_151776_152312 174
64 3300049823 Ga0501044_0087610 Ga0501044_0087610_464_1036 174
65 iso_pu_bacteria 2643221588 2643949234 174
66 iso_pu_bacteria 2738541275 2738711853 174
67 iso_pu_bacteria 2738541301 2738850278 174
68 iso_pu_bacteria 2738541304 2738866007 174
69 iso_pu_bacteria 2738543022 2739298525 174
70 iso_pu_bacteria 2738543033 2739360203 174
71 iso_pu_bacteria 2928100450 2928103021 174
72 iso_pu_bacteria 2928959182 2928959585 174
73 3300027876 Ga0209974_10112566 Ga0209974_101125662 175
74 3300031548 Ga0307408_100782007 Ga0307408_1007820071 175
75 3300031731 Ga0307405_10006159 Ga0307405_100061596 175
76 3300032002 Ga0307416_100780041 Ga0307416_1007800411 175
77 3300005327 Ga0070658_10058565 Ga0070658_100585653 176
78 3300005327 Ga0070658_10486868 Ga0070658_104868681 176
79 3300005327 Ga0070658_10545156 Ga0070658_105451562 176
80 3300005329 Ga0070683_101180038 Ga0070683_1011800381 176
81 3300005337 Ga0070682_100517156 Ga0070682_1005171561 176
82 3300005339 Ga0070660_100004439 Ga0070660_1000044392 176
83 3300005345 Ga0070692_10119308 Ga0070692_101193082 176
84 3300005366 Ga0070659_100181465 Ga0070659_1001814653 176
85 3300005455 Ga0070663_100039658 Ga0070663_1000396581 176
86 3300005457 Ga0070662_100000817 Ga0070662_1000008172 176
87 3300005457 Ga0070662_100013295 Ga0070662_1000132954 176
88 3300005530 Ga0070679_100024783 Ga0070679_1000247833 176
89 3300005530 Ga0070679_100044501 Ga0070679_1000445013 176
90 3300005530 Ga0070679_100302595 Ga0070679_1003025951 176
91 3300005530 Ga0070679_101056373 Ga0070679_1010563731 176
92 3300005535 Ga0070684_100455453 Ga0070684_1004554532 176
93 3300005539 Ga0068853_100094743 Ga0068853_1000947432 176
94 3300005563 Ga0068855_100040201 Ga0068855_1000402017 176
95 3300005563 Ga0068855_100220777 Ga0068855_1002207772 176
96 3300005564 Ga0070664_100009011 Ga0070664_1000090115 176
97 3300005564 Ga0070664_100023442 Ga0070664_1000234426 176
98 3300005577 Ga0068857_100040794 Ga0068857_1000407942 176
99 3300005577 Ga0068857_100368729 Ga0068857_1003687292 176
100 3300005578 Ga0068854_101158285 Ga0068854_1011582851 176
101 3300005614 Ga0068856_100028832 Ga0068856_1000288325 176
102 3300005616 Ga0068852_100563564 Ga0068852_1005635642 176
103 3300005834 Ga0068851_10176315 Ga0068851_101763152 176
104 3300006846 Ga0075430_100045853 Ga0075430_1000458533 176
105 3300009174 Ga0105241_10486379 Ga0105241_104863792 176
106 3300010375 Ga0105239_10802317 Ga0105239_108023171 176
107 3300011119 Ga0105246_10001236 Ga0105246_100012364 176
108 3300013100 Ga0157373_10069845 Ga0157373_100698452 176
109 3300013102 Ga0157371_10008038 Ga0157371_100080382 176
110 3300013102 Ga0157371_10025049 Ga0157371_100250496 176
111 3300013102 Ga0157371_10470661 Ga0157371_104706612 176
112 3300013104 Ga0157370_10008050 Ga0157370_100080507 176
113 3300013104 Ga0157370_10785974 Ga0157370_107859742 176
114 3300013105 Ga0157369_10064214 Ga0157369_100642143 176
115 3300013105 Ga0157369_10249505 Ga0157369_102495052 176
116 3300013307 Ga0157372_10020903 Ga0157372_100209036 176
117 3300013307 Ga0157372_10519079 Ga0157372_105190792 176
118 3300025909 Ga0207705_10067565 Ga0207705_100675652 176
119 3300025909 Ga0207705_10487628 Ga0207705_104876282 176
120 3300025909 Ga0207705_10530509 Ga0207705_105305091 176
121 3300025911 Ga0207654_10264263 Ga0207654_102642632 176
122 3300025912 Ga0207707_10738906 Ga0207707_107389062 176
123 3300025919 Ga0207657_10004557 Ga0207657_100045573 176
124 3300025919 Ga0207657_10450936 Ga0207657_104509362 176
125 3300025920 Ga0207649_10136234 Ga0207649_101362342 176
126 3300025920 Ga0207649_10578187 Ga0207649_105781872 176
127 3300025921 Ga0207652_10001167 Ga0207652_100011677 176
128 3300025921 Ga0207652_10225391 Ga0207652_102253912 176
129 3300025926 Ga0207659_10279836 Ga0207659_102798362 176
130 3300025932 Ga0207690_10106370 Ga0207690_101063703 176
131 3300025932 Ga0207690_10157379 Ga0207690_101573792 176
132 3300025933 Ga0207706_10001603 Ga0207706_1000160320 176
133 3300025933 Ga0207706_10017880 Ga0207706_100178805 176
134 3300025940 Ga0207691_10612186 Ga0207691_106121861 176
135 3300025944 Ga0207661_10118549 Ga0207661_101185493 176
136 3300025949 Ga0207667_10032623 Ga0207667_100326237 176
137 3300025949 Ga0207667_10116733 Ga0207667_101167332 176
138 3300026041 Ga0207639_10177683 Ga0207639_101776832 176
139 3300026067 Ga0207678_10643815 Ga0207678_106438152 176
140 3300026116 Ga0207674_10112966 Ga0207674_101129662 176
141 3300026142 Ga0207698_10292856 Ga0207698_102928562 176
142 3300026142 Ga0207698_10424293 Ga0207698_104242931 176
143 3300027876 Ga0209974_10012104 Ga0209974_100121043 176
144 3300041997 Ga0439431_0037573 Ga0439431_0037573_365_958 176
145 3300048908 Ga0496105_0081442 Ga0496105_0081442_1569_2159 176
146 3300048917 Ga0496114_0006267 Ga0496114_0006267_4621_5211 176
147 3300048929 Ga0496126_0283870 Ga0496126_0283870_43_609 176
148 3300049570 Ga0501033_0079207 Ga0501033_0079207_46_627 176
149 3300050509 nmdc:mga0qj67_86302_c1 nmdc:mga0qj67_86302_c1_1793_2350 176
150 iso_pu_bacteria 2643221605 2644038165 176
151 iso_pu_bacteria 2885427238 2885427896 176
152 3300005334 Ga0068869_100961131 Ga0068869_1009611311 177
153 3300005547 Ga0070693_100854388 Ga0070693_1008543881 177
154 3300005577 Ga0068857_100414504 Ga0068857_1004145041 177
155 3300006195 Ga0075366_10023197 Ga0075366_100231972 177
156 3300009093 Ga0105240_10004567 Ga0105240_1000456721 177
157 3300009551 Ga0105238_10939420 Ga0105238_109394202 177
158 3300011119 Ga0105246_10004297 Ga0105246_100042975 177
159 3300025913 Ga0207695_10001501 Ga0207695_1000150111 177
160 3300025945 Ga0207679_10491944 Ga0207679_104919442 177
161 3300031824 Ga0307413_10081048 Ga0307413_100810483 177
162 3300031911 Ga0307412_10024561 Ga0307412_100245612 177
163 3300031911 Ga0307412_10034814 Ga0307412_100348144 177
164 3300031911 Ga0307412_10205825 Ga0307412_102058252 177
165 3300031995 Ga0307409_100058219 Ga0307409_1000582194 177
166 3300032002 Ga0307416_100432716 Ga0307416_1004327162 177
167 3300032004 Ga0307414_10014382 Ga0307414_100143822 177
168 3300032004 Ga0307414_10199094 Ga0307414_101990942 177
169 3300032126 Ga0307415_100411082 Ga0307415_1004110821 177
170 3300041512 Ga0451853_1008997 Ga0451853_1008997_79_648 177
171 3300042015 Ga0439462_0007196 Ga0439462_0007196_854_1429 177
172 3300042532 Ga0450893_0020011 Ga0450893_0020011_88_672 177
173 3300049571 Ga0501034_0305097 Ga0501034_0305097_779_1363 177
174 3300049572 Ga0501036_0303023 Ga0501036_0303023_153_737 177
175 3300049574 Ga0501038_0887470 Ga0501038_0887470_17_601 177
176 3300049575 Ga0501039_1044371 Ga0501039_1044371_34_618 177
177 3300049578 Ga0501042_0738266 Ga0501042_0738266_80_664 177
178 3300049581 Ga0501047_0381249 Ga0501047_0381249_33_617 177
179 3300049822 Ga0501035_0368683 Ga0501035_0368683_119_703 177
180 3300049823 Ga0501044_0106673 Ga0501044_0106673_1634_2218 177
181 iso_pu_bacteria 2643221541 2643728910 177
182 iso_pu_bacteria 2643221606 2644044925 177
183 iso_pu_bacteria 2643221671 2644391098 177
184 2162886007 SwRhRL2b_contig_825531 SwRhRL2b_0722.00008890 178
185 3300002074 JGI24748J21848_1007851 JGI24748J21848_10078511 178
186 3300002076 JGI24749J21850_1000308 JGI24749J21850_10003087 178
187 3300002459 JGI24751J29686_10000062 JGI24751J29686_1000006239 178
188 3300005289 Ga0065704_10072521 Ga0065704_100725217 178
189 3300005295 Ga0065707_10194496 Ga0065707_101944962 178
190 3300005331 Ga0070670_100000005 Ga0070670_100000005274 178
191 3300005353 Ga0070669_100000060 Ga0070669_10000006013 178
192 3300005353 Ga0070669_100000446 Ga0070669_10000044627 178
193 3300005353 Ga0070669_100366093 Ga0070669_1003660931 178
194 3300005355 Ga0070671_100013374 Ga0070671_1000133744 178
195 3300005367 Ga0070667_100001092 Ga0070667_10000109230 178
196 3300005367 Ga0070667_100009037 Ga0070667_1000090373 178
197 3300005548 Ga0070665_100032131 Ga0070665_1000321316 178
198 3300005578 Ga0068854_100024805 Ga0068854_1000248054 178
199 3300005617 Ga0068859_100174343 Ga0068859_1001743433 178
200 3300005618 Ga0068864_100000011 Ga0068864_100000011271 178
201 3300005844 Ga0068862_100000104 Ga0068862_10000010466 178
202 3300005844 Ga0068862_100017371 Ga0068862_1000173715 178
203 3300005844 Ga0068862_100804380 Ga0068862_1008043802 178
204 3300006931 Ga0097620_100174356 Ga0097620_1001743563 178
205 3300006946 Ga0079104_1036089 Ga0079104_10360892 178
206 3300013306 Ga0163162_10162903 Ga0163162_101629033 178
207 3300017792 Ga0163161_10098300 Ga0163161_100983003 178
208 3300025315 Ga0207697_10216926 Ga0207697_102169261 178
209 3300025711 Ga0207696_1001700 Ga0207696_10017005 178
210 3300025735 Ga0207713_1003933 Ga0207713_10039337 178
211 3300025923 Ga0207681_10000001 Ga0207681_10000001386 178
212 3300025923 Ga0207681_10000203 Ga0207681_100002034 178
213 3300025923 Ga0207681_10381225 Ga0207681_103812252 178
214 3300025925 Ga0207650_10000018 Ga0207650_10000018271 178
215 3300025931 Ga0207644_10029218 Ga0207644_100292185 178
216 3300025941 Ga0207711_10001356 Ga0207711_100013566 178
217 3300025972 Ga0207668_10074263 Ga0207668_100742634 178
218 3300025981 Ga0207640_10112453 Ga0207640_101124532 178
219 3300025986 Ga0207658_10003728 Ga0207658_1000372812 178
220 3300025986 Ga0207658_10005982 Ga0207658_100059823 178
221 3300026035 Ga0207703_10760287 Ga0207703_107602871 178
222 3300026041 Ga0207639_10136686 Ga0207639_101366862 178
223 3300026095 Ga0207676_10000004 Ga0207676_10000004664 178
224 3300026118 Ga0207675_100002408 Ga0207675_10000240817 178
225 3300026142 Ga0207698_10058099 Ga0207698_100580993 178
226 3300027111 Ga0209281_1014027 Ga0209281_10140272 178
227 3300028379 Ga0268266_10037417 Ga0268266_100374172 178
228 3300028380 Ga0268265_10000002 Ga0268265_10000002392 178
229 3300028380 Ga0268265_10092441 Ga0268265_100924412 178
230 3300028380 Ga0268265_10331343 Ga0268265_103313432 178
231 3300032004 Ga0307414_10278918 Ga0307414_102789182 178
232 3300042004 Ga0439445_0029994 Ga0439445_0029994_569_1150 178
233 3300042435 Ga0439434_0017189 Ga0439434_0017189_1199_1780 178
234 3300048903 Ga0496100_0116741 Ga0496100_0116741_1184_1744 178
235 3300048904 Ga0496101_0002372 Ga0496101_0002372_9726_10286 178
236 3300048905 Ga0496102_0000162 Ga0496102_0000162_18485_19045 178
237 3300048906 Ga0496103_0000328 Ga0496103_0000328_26733_27293 178
238 3300048907 Ga0496104_0000083 Ga0496104_0000083_54635_55195 178
239 3300048908 Ga0496105_0000086 Ga0496105_0000086_64794_65354 178
240 3300048910 Ga0496107_0034169 Ga0496107_0034169_1227_1787 178
241 3300048915 Ga0496112_0070706 Ga0496112_0070706_297_857 178
242 3300048916 Ga0496113_0000776 Ga0496113_0000776_11586_12146 178
243 3300048918 Ga0496115_0163029 Ga0496115_0163029_166_726 178
244 3300048920 Ga0496117_0000323 Ga0496117_0000323_11711_12271 178
245 3300048921 Ga0496118_0012140 Ga0496118_0012140_298_858 178
246 3300048922 Ga0496119_0000180 Ga0496119_0000180_36376_36936 178
247 3300048923 Ga0496120_0000342 Ga0496120_0000342_49816_50376 178
248 3300048924 Ga0496121_0002474 Ga0496121_0002474_16454_17014 178
249 3300048925 Ga0496122_0000918 Ga0496122_0000918_45133_45693 178
250 3300048926 Ga0496123_0001257 Ga0496123_0001257_9114_9674 178
251 3300048927 Ga0496124_0059542 Ga0496124_0059542_2180_2740 178
252 3300048928 Ga0496125_0004290 Ga0496125_0004290_7925_8485 178
253 3300048929 Ga0496126_0000044 Ga0496126_0000044_49489_50049 178
254 3300050493 nmdc:mga0k408_38443_c1 nmdc:mga0k408_38443_c1_930_1601 178
255 3300050496 nmdc:mga07m45_233774_c1 nmdc:mga07m45_233774_c1_22_624 178
256 3300053121 Ga0500607_000082 Ga0500607_000082_44937_45503 178
257 3300053136 Ga0500559_0000199 Ga0500559_0000199_1952_2518 178
258 3300053148 Ga0500590_111102 Ga0500590_111102_462_1028 178
259 3300053178 Ga0500637_0036449 Ga0500637_0036449_363_929 178
260 3300053730 Ga0500645_028994 Ga0500645_028994_532_1098 178
261 3300005331 Ga0070670_100000485 Ga0070670_10000048535 179
262 3300005334 Ga0068869_100166460 Ga0068869_1001664601 179
263 3300005335 Ga0070666_10090554 Ga0070666_100905542 179
264 3300005347 Ga0070668_100000020 Ga0070668_10000002086 179
265 3300005353 Ga0070669_100109448 Ga0070669_1001094481 179
266 3300005353 Ga0070669_100168762 Ga0070669_1001687622 179
267 3300005355 Ga0070671_100000854 Ga0070671_10000085417 179
268 3300005367 Ga0070667_100000055 Ga0070667_10000005560 179
269 3300005564 Ga0070664_100017908 Ga0070664_1000179085 179
270 3300005577 Ga0068857_100015922 Ga0068857_1000159226 179
271 3300005617 Ga0068859_100006686 Ga0068859_1000066869 179
272 3300005617 Ga0068859_100049269 Ga0068859_1000492694 179
273 3300005618 Ga0068864_101275641 Ga0068864_1012756412 179
274 3300005719 Ga0068861_100033153 Ga0068861_1000331532 179
275 3300005841 Ga0068863_100336600 Ga0068863_1003366002 179
276 3300005841 Ga0068863_101492118 Ga0068863_1014921181 179
277 3300005842 Ga0068858_100000186 Ga0068858_10000018666 179
278 3300005843 Ga0068860_100000090 Ga0068860_10000009061 179
279 3300005844 Ga0068862_100001485 Ga0068862_1000014857 179
280 3300005844 Ga0068862_100464363 Ga0068862_1004643632 179
281 3300006195 Ga0075366_10006964 Ga0075366_100069646 179
282 3300006195 Ga0075366_10160977 Ga0075366_101609772 179
283 3300006931 Ga0097620_100006686 Ga0097620_1000066869 179
284 3300006931 Ga0097620_100049271 Ga0097620_1000492714 179
285 3300009094 Ga0111539_10646309 Ga0111539_106463092 179
286 3300009177 Ga0105248_10701699 Ga0105248_107016991 179
287 3300013308 Ga0157375_11507781 Ga0157375_115077811 179
288 3300014325 Ga0163163_10492079 Ga0163163_104920791 179
289 3300025903 Ga0207680_10070478 Ga0207680_100704782 179
290 3300025923 Ga0207681_10013391 Ga0207681_100133916 179
291 3300025925 Ga0207650_10002683 Ga0207650_100026832 179
292 3300025931 Ga0207644_10000050 Ga0207644_1000005075 179
293 3300025941 Ga0207711_10272269 Ga0207711_102722692 179
294 3300025942 Ga0207689_10063889 Ga0207689_100638894 179
295 3300025945 Ga0207679_10872696 Ga0207679_108726961 179
296 3300025972 Ga0207668_10000048 Ga0207668_100000487 179
297 3300025986 Ga0207658_10000090 Ga0207658_10000090101 179
298 3300026035 Ga0207703_10000231 Ga0207703_100002318 179
299 3300026088 Ga0207641_10267282 Ga0207641_102672822 179
300 3300026095 Ga0207676_10031900 Ga0207676_100319001 179
301 3300026116 Ga0207674_10000814 Ga0207674_1000081442 179
302 3300026118 Ga0207675_100170468 Ga0207675_1001704681 179
303 3300028380 Ga0268265_10001609 Ga0268265_100016097 179
304 3300028381 Ga0268264_10000075 Ga0268264_10000075101 179
305 3300028381 Ga0268264_10152974 Ga0268264_101529742 179
306 3300030745 Ga0316182_1389245 Ga0316182_13892452 179
307 3300031548 Ga0307408_100058865 Ga0307408_1000588654 179
308 3300031731 Ga0307405_10000836 Ga0307405_100008362 179
309 3300031731 Ga0307405_10166316 Ga0307405_101663162 179
310 3300031731 Ga0307405_11028171 Ga0307405_110281712 179
311 3300031824 Ga0307413_10054139 Ga0307413_100541393 179
312 3300031824 Ga0307413_10064998 Ga0307413_100649982 179
313 3300031852 Ga0307410_10055430 Ga0307410_100554302 179
314 3300031852 Ga0307410_10344099 Ga0307410_103440992 179
315 3300031903 Ga0307407_10036498 Ga0307407_100364982 179
316 3300031903 Ga0307407_10289216 Ga0307407_102892162 179
317 3300031903 Ga0307407_10315983 Ga0307407_103159832 179
318 3300031911 Ga0307412_10008462 Ga0307412_100084623 179
319 3300031911 Ga0307412_10081056 Ga0307412_100810561 179
320 3300031995 Ga0307409_100023054 Ga0307409_1000230544 179
321 3300031995 Ga0307409_100410262 Ga0307409_1004102622 179
322 3300032002 Ga0307416_100006179 Ga0307416_1000061797 179
323 3300032004 Ga0307414_10034003 Ga0307414_100340033 179
324 3300032004 Ga0307414_10104405 Ga0307414_101044052 179
325 3300032005 Ga0307411_10023453 Ga0307411_100234531 179
326 3300032005 Ga0307411_10091571 Ga0307411_100915712 179
327 3300032005 Ga0307411_10342037 Ga0307411_103420372 179
328 3300032126 Ga0307415_100002260 Ga0307415_1000022609 179
329 3300032126 Ga0307415_100611991 Ga0307415_1006119912 179
330 3300037471 Ga0395905_0039185 Ga0395905_0039185_1223_1771 179
331 3300046500 Ga0495596_0120578 Ga0495596_0120578_401_949 179
332 3300046525 Ga0495663_0005516 Ga0495663_0005516_1276_1824 179
333 3300046539 Ga0495621_0001374 Ga0495621_0001374_4313_4861 179
334 3300046558 Ga0495633_0087328 Ga0495633_0087328_745_1293 179
335 3300046691 Ga0495670_0027384 Ga0495670_0027384_1640_2188 179
336 3300047445 Ga0495677_0020681 Ga0495677_0020681_1457_2005 179
337 3300048090 Ga0495615_0052945 Ga0495615_0052945_449_997 179
338 iso_pu_bacteria 2582581305 2585260948 179
339 3300005335 Ga0070666_10074476 Ga0070666_100744762 180
340 3300005367 Ga0070667_100000016 Ga0070667_1000000168 180
341 3300005546 Ga0070696_100034529 Ga0070696_1000345292 180
342 3300005563 Ga0068855_101045957 Ga0068855_1010459572 180
343 3300005841 Ga0068863_100009580 Ga0068863_10000958010 180
344 3300005841 Ga0068863_100055314 Ga0068863_1000553143 180
345 3300005843 Ga0068860_100000361 Ga0068860_1000003618 180
346 3300005843 Ga0068860_100964053 Ga0068860_1009640531 180
347 3300009094 Ga0111539_10208209 Ga0111539_102082092 180
348 3300009147 Ga0114129_10703605 Ga0114129_107036052 180
349 3300012513 Ga0157326_1000645 Ga0157326_10006452 180
350 3300013307 Ga0157372_10874791 Ga0157372_108747911 180
351 3300025907 Ga0207645_10014814 Ga0207645_100148146 180
352 3300025911 Ga0207654_10574038 Ga0207654_105740381 180
353 3300025912 Ga0207707_10471073 Ga0207707_104710732 180
354 3300025917 Ga0207660_10500189 Ga0207660_105001892 180
355 3300025932 Ga0207690_10447274 Ga0207690_104472742 180
356 3300025949 Ga0207667_10737994 Ga0207667_107379942 180
357 3300025981 Ga0207640_10226968 Ga0207640_102269682 180
358 3300025986 Ga0207658_10000134 Ga0207658_100001347 180
359 3300026088 Ga0207641_10001362 Ga0207641_100013624 180
360 3300027907 Ga0207428_10032857 Ga0207428_100328574 180
361 3300028381 Ga0268264_10000087 Ga0268264_100000877 180
362 3300030742 Ga0316183_1200454 Ga0316183_12004541 180
363 3300031548 Ga0307408_100087356 Ga0307408_1000873562 180
364 3300032004 Ga0307414_10175330 Ga0307414_101753302 180
365 3300038443 Ga0395901_0891151 Ga0395901_0891151_172_717 180
366 3300038443 Ga0395901_0924944 Ga0395901_0924944_174_719 180
367 3300042120 Ga0450917_001488 Ga0450917_001488_175_735 180
368 3300042142 Ga0450905_000642 Ga0450905_000642_2406_2966 180
369 3300042144 Ga0450889_000953 Ga0450889_000953_1027_1587 180
370 3300046684 Ga0495669_0024612 Ga0495669_0024612_2031_2582 180
371 3300050511 nmdc:mga08y16_161266_c1 nmdc:mga08y16_161266_c1_97_657 180
372 3300053091 Ga0500647_0011154 Ga0500647_0011154_1412_1954 180
373 3300053125 Ga0500618_004495 Ga0500618_004495_1654_2196 180
374 3300053177 Ga0500636_0196899 Ga0500636_0196899_491_1033 180
375 3300059421 Ga0590071_023651 Ga0590071_023651_310_864 180
376 3300005617 Ga0068859_100020546 Ga0068859_1000205467 181
377 3300005841 Ga0068863_100003798 Ga0068863_1000037989 181
378 3300005843 Ga0068860_100008972 Ga0068860_1000089726 181
379 3300005844 Ga0068862_100000173 Ga0068862_10000017356 181
380 3300006931 Ga0097620_100020546 Ga0097620_1000205467 181
381 3300009101 Ga0105247_10023891 Ga0105247_100238912 181
382 3300009553 Ga0105249_10000037 Ga0105249_1000003784 181
383 3300025900 Ga0207710_10013466 Ga0207710_100134665 181
384 3300025961 Ga0207712_10000035 Ga0207712_1000003585 181
385 3300028380 Ga0268265_10001818 Ga0268265_1000181812 181
386 3300028381 Ga0268264_10031336 Ga0268264_100313361 181
387 3300031456 Ga0307513_10027979 Ga0307513_100279793 181
388 3300005295 Ga0065707_10349174 Ga0065707_103491741 182
389 3300005548 Ga0070665_100633637 Ga0070665_1006336372 182
390 3300009177 Ga0105248_10043322 Ga0105248_100433222 182
391 3300025941 Ga0207711_10275387 Ga0207711_102753871 182
392 3300028379 Ga0268266_10533327 Ga0268266_105333271 182
393 3300031911 Ga0307412_10293554 Ga0307412_102935542 182
394 3300048928 Ga0496125_0047287 Ga0496125_0047287_200_748 182
395 3300049574 Ga0501038_0153945 Ga0501038_0153945_858_1430 182
396 3300035695 Ga0373927_0012559 Ga0373927_0012559_4619_5170 183
397 3300046520 Ga0495637_0015444 Ga0495637_0015444_1244_1795 183
398 3300046522 Ga0495643_0092534 Ga0495643_0092534_737_1288 183
399 3300046524 Ga0495648_0401582 Ga0495648_0401582_44_595 183
400 3300046542 Ga0495597_0007292 Ga0495597_0007292_852_1403 183
401 3300046558 Ga0495633_0126152 Ga0495633_0126152_125_676 183
402 3300046616 Ga0495668_0015691 Ga0495668_0015691_3163_3714 183
403 3300046684 Ga0495669_0007253 Ga0495669_0007253_2129_2680 183
404 3300053087 Ga0500643_002551 Ga0500643_002551_4737_5303 183
405 3300053093 Ga0500651_0003100 Ga0500651_0003100_6825_7376 183
406 3300053130 Ga0500642_0001312 Ga0500642_0001312_1265_1816 183
407 3300053131 Ga0500652_033723 Ga0500652_033723_403_954 183
408 3300053133 Ga0500655_000307 Ga0500655_000307_620_1171 183
409 3300053148 Ga0500590_000114 Ga0500590_000114_12316_12867 183
410 3300053156 Ga0500622_0104988 Ga0500622_0104988_261_812 183
411 3300053163 Ga0500639_026663 Ga0500639_026663_839_1390 183
412 3300053178 Ga0500637_0344240 Ga0500637_0344240_127_678 183
413 3300053724 Ga0500570_000053 Ga0500570_000053_15942_16493 183
414 3300005295 Ga0065707_10118337 Ga0065707_101183372 184
415 3300005843 Ga0068860_100846840 Ga0068860_1008468402 184
416 3300028381 Ga0268264_10643202 Ga0268264_106432022 184
417 3300053087 Ga0500643_005656 Ga0500643_005656_1383_1937 184
418 3300005289 Ga0065704_10074425 Ga0065704_100744252 186
419 3300005331 Ga0070670_100000125 Ga0070670_10000012515 186
420 3300005367 Ga0070667_100001008 Ga0070667_10000100815 186
421 3300005618 Ga0068864_100000098 Ga0068864_10000009868 186
422 3300005841 Ga0068863_100000127 Ga0068863_10000012715 186
423 3300005842 Ga0068858_100584889 Ga0068858_1005848892 186
424 3300005844 Ga0068862_100000133 Ga0068862_10000013368 186
425 3300009011 Ga0105251_10003406 Ga0105251_100034067 186
426 3300009101 Ga0105247_10088598 Ga0105247_100885982 186
427 3300009177 Ga0105248_10001403 Ga0105248_1000140316 186
428 3300009553 Ga0105249_10000116 Ga0105249_1000011693 186
429 3300014325 Ga0163163_10131526 Ga0163163_101315262 186
430 3300014968 Ga0157379_10324147 Ga0157379_103241472 186
431 3300025735 Ga0207713_1008709 Ga0207713_10087093 186
432 3300025900 Ga0207710_10051025 Ga0207710_100510252 186
433 3300025914 Ga0207671_10040833 Ga0207671_100408334 186
434 3300025925 Ga0207650_10000197 Ga0207650_1000019757 186
435 3300025941 Ga0207711_10000022 Ga0207711_10000022348 186
436 3300025961 Ga0207712_10000726 Ga0207712_1000072617 186
437 3300025986 Ga0207658_10000143 Ga0207658_100001439 186
438 3300026088 Ga0207641_10000022 Ga0207641_10000022245 186
439 3300026095 Ga0207676_10000209 Ga0207676_1000020937 186
440 3300028380 Ga0268265_10000090 Ga0268265_1000009015 186
441 3300048904 Ga0496101_0305534 Ga0496101_0305534_73_633 186
442 3300048906 Ga0496103_0046120 Ga0496103_0046120_1674_2234 186
443 3300048920 Ga0496117_0038417 Ga0496117_0038417_1435_1995 186
444 3300048921 Ga0496118_0004928 Ga0496118_0004928_199_759 186
445 3300049513 Ga0501290_000074 Ga0501290_000074_9865_10431 186
446 3300049515 Ga0501292_000027 Ga0501292_000027_37393_37959 186
447 3300049517 Ga0501294_000682 Ga0501294_000682_2030_2596 186
448 3300049523 Ga0501300_001473 Ga0501300_001473_201_767 186
449 3300049524 Ga0501301_007746 Ga0501301_007746_41_607 186
450 3300049531 Ga0501315_043021 Ga0501315_043021_79_645 186
451 3300049653 Ga0501206_001212 Ga0501206_001212_1885_2451 186
452 3300049662 Ga0501222_000773 Ga0501222_000773_2594_3160 186
453 3300049663 Ga0501223_001826 Ga0501223_001826_2587_3153 186
454 3300049664 Ga0501224_000579 Ga0501224_000579_2988_3554 186
455 3300049665 Ga0501227_037034 Ga0501227_037034_586_1152 186
456 3300049668 Ga0501233_001196 Ga0501233_001196_1366_1932 186
457 3300049669 Ga0501235_001128 Ga0501235_001128_2386_2952 186
458 3300049688 Ga0501259_001587 Ga0501259_001587_3107_3673 186
459 3300049690 Ga0501261_000011 Ga0501261_000011_37410_37976 186
460 3300049705 Ga0501225_0001543 Ga0501225_0001543_3887_4453 186
461 3300049708 Ga0501245_001509 Ga0501245_001509_1474_2040 186
462 3300049761 Ga0501264_005243 Ga0501264_005243_410_976 186
463 3300049775 Ga0501279_000010 Ga0501279_000010_48500_49066 186
464 3300049776 Ga0501280_000099 Ga0501280_000099_12138_12704 186
465 3300049777 Ga0501281_00077 Ga0501281_00077_7390_7956 186
466 3300049778 Ga0501282_002009 Ga0501282_002009_647_1213 186
467 3300049779 Ga0501283_021758 Ga0501283_021758_200_766 186
468 3300059504 Ga0587082_064726 Ga0587082_064726_37_603 186
469 3300031731 Ga0307405_10305605 Ga0307405_103056052 187
470 3300031911 Ga0307412_10021958 Ga0307412_100219582 187
471 3300001979 JGI24740J21852_10051343 JGI24740J21852_100513431 189
472 3300001989 JGI24739J22299_10006795 JGI24739J22299_100067952 189
473 3300002075 JGI24738J21930_10028381 JGI24738J21930_100283812 189
474 3300005457 Ga0070662_100359362 Ga0070662_1003593621 189
475 3300005577 Ga0068857_100153186 Ga0068857_1001531862 189
476 3300005578 Ga0068854_100069986 Ga0068854_1000699861 189
477 3300005616 Ga0068852_100214782 Ga0068852_1002147822 189
478 3300025933 Ga0207706_10436942 Ga0207706_104369421 189
479 3300026116 Ga0207674_10020781 Ga0207674_100207819 189
480 3300031731 Ga0307405_10055309 Ga0307405_100553092 189
481 3300031995 Ga0307409_100087449 Ga0307409_1000874492 189
482 2162886006 SwRhRL3b_contig_2913204 SwRhRL3b_0599.00001580 191
483 3300001904 JGI24736J21556_1002149 JGI24736J21556_10021492 191
484 3300001976 JGI24752J21851_1001927 JGI24752J21851_10019272 191
485 3300001989 JGI24739J22299_10014945 JGI24739J22299_100149451 191
486 3300002070 JGI24750J21931_1000005 JGI24750J21931_10000054 191
487 3300002074 JGI24748J21848_1000076 JGI24748J21848_100007611 191
488 3300002075 JGI24738J21930_10007634 JGI24738J21930_100076343 191
489 3300002076 JGI24749J21850_1000500 JGI24749J21850_10005003 191
490 3300002239 JGI24034J26672_10000071 JGI24034J26672_100000716 191
491 3300003911 JGI25405J52794_10003563 JGI25405J52794_100035632 191
492 3300005289 Ga0065704_10337971 Ga0065704_103379712 191
493 3300005295 Ga0065707_10082140 Ga0065707_100821406 191
494 3300005327 Ga0070658_10052276 Ga0070658_100522763 191
495 3300005330 Ga0070690_100000110 Ga0070690_1000001103 191
496 3300005335 Ga0070666_10000069 Ga0070666_1000006913 191
497 3300005340 Ga0070689_100008265 Ga0070689_1000082651 191
498 3300005344 Ga0070661_100058315 Ga0070661_1000583152 191
499 3300005347 Ga0070668_100144786 Ga0070668_1001447861 191
500 3300005353 Ga0070669_100000167 Ga0070669_10000016758 191
501 3300005365 Ga0070688_100033833 Ga0070688_1000338332 191
502 3300005366 Ga0070659_100010748 Ga0070659_1000107483 191
503 3300005367 Ga0070667_100004644 Ga0070667_10000464412 191
504 3300005455 Ga0070663_100008392 Ga0070663_1000083922 191
505 3300005457 Ga0070662_100564757 Ga0070662_1005647572 191
506 3300005466 Ga0070685_10000036 Ga0070685_1000003662 191
507 3300005535 Ga0070684_100172175 Ga0070684_1001721752 191
508 3300005543 Ga0070672_100336696 Ga0070672_1003366962 191
509 3300005544 Ga0070686_100000045 Ga0070686_10000004565 191
510 3300005548 Ga0070665_100000042 Ga0070665_100000042224 191
511 3300005617 Ga0068859_100008241 Ga0068859_1000082412 191
512 3300005618 Ga0068864_100144324 Ga0068864_1001443241 191
513 3300005719 Ga0068861_100001207 Ga0068861_1000012073 191
514 3300005841 Ga0068863_100000239 Ga0068863_10000023957 191
515 3300005842 Ga0068858_100002824 Ga0068858_10000282415 191
516 3300005843 Ga0068860_100000182 Ga0068860_10000018266 191
517 3300005844 Ga0068862_100000308 Ga0068862_1000003084 191
518 3300005937 Ga0081455_10000215 Ga0081455_1000021542 191
519 3300006931 Ga0097620_100008240 Ga0097620_1000082402 191
520 3300009101 Ga0105247_10010996 Ga0105247_100109965 191
521 3300009177 Ga0105248_10129926 Ga0105248_101299261 191
522 3300009545 Ga0105237_10122940 Ga0105237_101229402 191
523 3300009553 Ga0105249_10000012 Ga0105249_1000001264 191
524 3300013100 Ga0157373_10116382 Ga0157373_101163822 191
525 3300013102 Ga0157371_10184628 Ga0157371_101846282 191
526 3300013297 Ga0157378_10020993 Ga0157378_100209936 191
527 3300013306 Ga0163162_10228716 Ga0163162_102287162 191
528 3300013307 Ga0157372_10180258 Ga0157372_101802582 191
529 3300013308 Ga0157375_11070886 Ga0157375_110708861 191
530 3300014326 Ga0157380_10002669 Ga0157380_100026697 191
531 3300014326 Ga0157380_10012259 Ga0157380_100122593 191
532 3300014968 Ga0157379_10037988 Ga0157379_100379885 191
533 3300017792 Ga0163161_10000202 Ga0163161_1000020231 191
534 3300025321 Ga0207656_10044753 Ga0207656_100447533 191
535 3300025903 Ga0207680_10000012 Ga0207680_10000012222 191
536 3300025904 Ga0207647_10002793 Ga0207647_100027932 191
537 3300025911 Ga0207654_10000754 Ga0207654_1000075412 191
538 3300025913 Ga0207695_10044031 Ga0207695_100440316 191
539 3300025914 Ga0207671_10005938 Ga0207671_100059382 191
540 3300025919 Ga0207657_10060829 Ga0207657_100608294 191
541 3300025920 Ga0207649_10058641 Ga0207649_100586413 191
542 3300025923 Ga0207681_10000076 Ga0207681_1000007658 191
543 3300025924 Ga0207694_10036918 Ga0207694_100369182 191
544 3300025925 Ga0207650_10027745 Ga0207650_100277452 191
545 3300025931 Ga0207644_10000254 Ga0207644_1000025426 191
546 3300025940 Ga0207691_10326015 Ga0207691_103260152 191
547 3300025945 Ga0207679_10148547 Ga0207679_101485472 191
548 3300025949 Ga0207667_10063601 Ga0207667_100636015 191
549 3300025961 Ga0207712_10000021 Ga0207712_10000021222 191
550 3300025972 Ga0207668_10049598 Ga0207668_100495982 191
551 3300025981 Ga0207640_10017102 Ga0207640_100171022 191
552 3300025986 Ga0207658_10001629 Ga0207658_100016292 191
553 3300026035 Ga0207703_10007079 Ga0207703_100070792 191
554 3300026041 Ga0207639_10036138 Ga0207639_100361385 191
555 3300026078 Ga0207702_10011360 Ga0207702_100113608 191
556 3300026088 Ga0207641_10000589 Ga0207641_1000058929 191
557 3300026089 Ga0207648_11116444 Ga0207648_111164441 191
558 3300026095 Ga0207676_10016182 Ga0207676_100161822 191
559 3300026095 Ga0207676_10926907 Ga0207676_109269071 191
560 3300026118 Ga0207675_100000227 Ga0207675_10000022719 191
561 3300026142 Ga0207698_10424790 Ga0207698_104247902 191
562 3300028379 Ga0268266_10000054 Ga0268266_10000054221 191
563 3300028380 Ga0268265_10004696 Ga0268265_1000469610 191
564 3300028381 Ga0268264_10000074 Ga0268264_10000074222 191
565 3300046525 Ga0495663_0024611 Ga0495663_0024611_506_1084 191
566 3300046530 Ga0495654_0001135 Ga0495654_0001135_3804_4382 191
567 3300046616 Ga0495668_0010459 Ga0495668_0010459_139_717 191
568 3300048903 Ga0496100_0202683 Ga0496100_0202683_375_956 191
569 3300048905 Ga0496102_0005342 Ga0496102_0005342_6395_6976 191
570 3300048906 Ga0496103_0001069 Ga0496103_0001069_15516_16097 191
571 3300048909 Ga0496106_0231552 Ga0496106_0231552_503_1084 191
572 3300048910 Ga0496107_0174134 Ga0496107_0174134_184_765 191
573 3300048914 Ga0496111_0455104 Ga0496111_0455104_229_810 191
574 3300048919 Ga0496116_0018743 Ga0496116_0018743_1531_2112 191
575 3300048920 Ga0496117_0007388 Ga0496117_0007388_5735_6316 191
576 3300048921 Ga0496118_0014592 Ga0496118_0014592_2234_2815 191
577 3300048927 Ga0496124_0372003 Ga0496124_0372003_71_652 191
578 3300053158 Ga0500627_0002353 Ga0500627_0002353_140_718 191

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01025

GrpE

GrpE

36

202

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h7d-assembly1.cif.gz_B crystal structure of a de novo enzyme, ferric enterobactin esterase syn-f4 (k4t) 0.8617 62 123
8h7e-assembly1.cif.gz_A crystal structure of a de novo enzyme, ferric enterobactin esterase syn-f4 (k4t) at 2.0 angstrom resolution 0.8262 62 123
8glv-assembly1.cif.gz_5V 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.8062 62 123
6u42-assembly1.cif.gz_5V natively decorated ciliary doublet microtubule 0.805 62 123
8h7e-assembly1.cif.gz_B crystal structure of a de novo enzyme, ferric enterobactin esterase syn-f4 (k4t) at 2.0 angstrom resolution 0.7465 72 123
ID Description Score Start End Superfamily
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 1 125 179 2.30.22.10
af_A0A0P0VLJ4_201_256_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9985 125 179 2.30.22.10
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.982 125 181 2.30.22.10
af_Q99LP6_159_215_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9654 125 181 2.30.22.10
af_Q2FXZ1_152_207_2.30.22.10 Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE 0.9651 125 179 2.30.22.10
ID Description Score Start End GO Terms
AF-A0A402FET6-F1-model_v4 deleted 0.9326 73 183
AF-A0A7C6QX86-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9194 22 191 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-E0U9J0-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9131 23 191 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-B7KLH9-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9056 23 191 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087
AF-B3EPC6-F1-model_v4 Protein GrpE (HSP-70 cofactor) 0.9029 22 181 GO:0000774
GO:0005737
GO:0006457
GO:0042803
GO:0051082
GO:0051087

Feature Viewer

pLDDT pTM Quality
86.44 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map