F465778
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 290 | 563 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_38443_c1|nmdc:mga0k408_38443_c1_930_1601 |
| Length | 205 |
| Sequence | MGPPYRVRRIDAKNTEPLAVRLRLTISARETKAGWDVEIPAAEELAPDGDSPFAKLESELEKLRNEVLYAQAETQNVRRRLEKEKTDASAYAATGFARDILSVADNLSRALAAIPAELRDDERLKPMLTGIEMTAKEVDSVFQRHGITKIESLGEKLDPNKHQAMIELPHADAEPGTVIQEMQTGYMIKDRLLRPALVGVAKAAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 4 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 5 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 6 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 7 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 8 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 9 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 10 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 11 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 12 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 13 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 14 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 15 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 16 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 17 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 23 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 24 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 25 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 26 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 36 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 72 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 73 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 160 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 161 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 167 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 168 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 170 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 171 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 179 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 180 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 181 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 182 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 183 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 184 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 185 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 186 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 187 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 188 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 189 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 218 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 219 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 220 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 221 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 222 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 223 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 224 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 225 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 226 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 227 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 228 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 229 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 230 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 231 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 232 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 233 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 234 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 235 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 236 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 237 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 238 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 248 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 249 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 250 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 256 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 257 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 258 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 259 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 260 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 261 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 262 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 263 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 267 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 272 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 273 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 274 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 275 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 276 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 277 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 278 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 279 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 280 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 281 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 282 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 283 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 285 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 287 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 288 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 289 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 290 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.89 |
| Metatranscriptomes | 0.52 |
| Isolates | 2.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.5 |
| Nodule | 0.35 |
| Rhizoplane | 3.46 |
| Rhizosphere | 85.29 |
| Stem | 0 |
| Stem Tuber | 0.17 |
| Unclassified | 6.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2913204 | 2162886006 | Bacteria | 1630 |
| 2 | SwRhRL2b_contig_825531 | 2162886007 | Bacteria | 5071 |
| 3 | JGI24736J21556_1002149 | 3300001904 | Bacteria | 3499 |
| 4 | JGI24752J21851_1001927 | 3300001976 | Bacteria | 2768 |
| 5 | JGI24740J21852_10051343 | 3300001979 | Bacteria | 1181 |
| 6 | JGI24739J22299_10006795 | 3300001989 | Bacteria | 4307 |
| 7 | JGI24739J22299_10014945 | 3300001989 | Bacteria | 2823 |
| 8 | JGI24750J21931_1000005 | 3300002070 | Bacteria | 25499 |
| 9 | JGI24748J21848_1000076 | 3300002074 | Bacteria | 33018 |
| 10 | JGI24748J21848_1007851 | 3300002074 | Bacteria | 1253 |
| 11 | JGI24738J21930_10007634 | 3300002075 | Bacteria | 2486 |
| 12 | JGI24738J21930_10028381 | 3300002075 | Bacteria | 1145 |
| 13 | JGI24749J21850_1000308 | 3300002076 | Bacteria | 7478 |
| 14 | JGI24749J21850_1000500 | 3300002076 | Bacteria | 5791 |
| 15 | JGI24034J26672_10000071 | 3300002239 | Bacteria | 27336 |
| 16 | JGI24751J29686_10000062 | 3300002459 | Bacteria | 61661 |
| 17 | JGI25405J52794_10003563 | 3300003911 | Bacteria | 2740 |
| 18 | Ga0065704_10072521 | 3300005289 | Bacteria | 8381 |
| 19 | Ga0065704_10074425 | 3300005289 | Bacteria | 6280 |
| 20 | Ga0065704_10337971 | 3300005289 | Bacteria | 828 |
| 21 | Ga0065707_10082140 | 3300005295 | Bacteria | 21029 |
| 22 | Ga0065707_10118337 | 3300005295 | Bacteria | 2188 |
| 23 | Ga0065707_10194496 | 3300005295 | Bacteria | 1343 |
| 24 | Ga0065707_10261697 | 3300005295 | Bacteria | 1095 |
| 25 | Ga0065707_10349174 | 3300005295 | Bacteria | 921 |
| 26 | Ga0070658_10052276 | 3300005327 | Bacteria | 3313 |
| 27 | Ga0070658_10058565 | 3300005327 | Bacteria | 3136 |
| 28 | Ga0070658_10384334 | 3300005327 | Bacteria | 1205 |
| 29 | Ga0070658_10486868 | 3300005327 | Bacteria | 1065 |
| 30 | Ga0070658_10545156 | 3300005327 | Bacteria | 1004 |
| 31 | Ga0070683_101180038 | 3300005329 | Bacteria | 736 |
| 32 | Ga0070690_100000110 | 3300005330 | Bacteria | 42574 |
| 33 | Ga0070670_100000005 | 3300005331 | Bacteria | 351569 |
| 34 | Ga0070670_100000125 | 3300005331 | Bacteria | 71778 |
| 35 | Ga0070670_100000485 | 3300005331 | Bacteria | 31957 |
| 36 | Ga0070670_100062683 | 3300005331 | Bacteria | 3192 |
| 37 | Ga0068869_100166460 | 3300005334 | Bacteria | 1719 |
| 38 | Ga0068869_100961131 | 3300005334 | Bacteria | 742 |
| 39 | Ga0070666_10000069 | 3300005335 | Bacteria | 75768 |
| 40 | Ga0070666_10074476 | 3300005335 | Bacteria | 2314 |
| 41 | Ga0070666_10090554 | 3300005335 | Bacteria | 2101 |
| 42 | Ga0070682_100517156 | 3300005337 | Bacteria | 928 |
| 43 | Ga0070660_100004439 | 3300005339 | Bacteria | 9693 |
| 44 | Ga0070689_100008265 | 3300005340 | Bacteria | 7324 |
| 45 | Ga0070661_100058315 | 3300005344 | Bacteria | 2829 |
| 46 | Ga0070692_10119308 | 3300005345 | Bacteria | 1469 |
| 47 | Ga0070668_100000020 | 3300005347 | Bacteria | 98203 |
| 48 | Ga0070668_100000123 | 3300005347 | Bacteria | 48192 |
| 49 | Ga0070668_100144786 | 3300005347 | Bacteria | 1917 |
| 50 | Ga0070669_100000060 | 3300005353 | Bacteria | 108287 |
| 51 | Ga0070669_100000167 | 3300005353 | Bacteria | 57589 |
| 52 | Ga0070669_100000446 | 3300005353 | Bacteria | 31546 |
| 53 | Ga0070669_100109448 | 3300005353 | Bacteria | 2095 |
| 54 | Ga0070669_100168762 | 3300005353 | Bacteria | 1705 |
| 55 | Ga0070669_100366093 | 3300005353 | Bacteria | 1173 |
| 56 | Ga0070669_100660560 | 3300005353 | Bacteria | 880 |
| 57 | Ga0070671_100000232 | 3300005355 | Bacteria | 37343 |
| 58 | Ga0070671_100000854 | 3300005355 | Bacteria | 22207 |
| 59 | Ga0070671_100013374 | 3300005355 | Bacteria | 6616 |
| 60 | Ga0070688_100033833 | 3300005365 | Bacteria | 3091 |
| 61 | Ga0070659_100010748 | 3300005366 | Bacteria | 6746 |
| 62 | Ga0070659_100181465 | 3300005366 | Bacteria | 1728 |
| 63 | Ga0070659_101128428 | 3300005366 | Bacteria | 692 |
| 64 | Ga0070667_100000016 | 3300005367 | Bacteria | 237028 |
| 65 | Ga0070667_100000055 | 3300005367 | Bacteria | 151072 |
| 66 | Ga0070667_100001008 | 3300005367 | Bacteria | 25807 |
| 67 | Ga0070667_100001092 | 3300005367 | Bacteria | 24859 |
| 68 | Ga0070667_100004644 | 3300005367 | Bacteria | 11532 |
| 69 | Ga0070667_100009037 | 3300005367 | Bacteria | 8248 |
| 70 | Ga0070663_100008392 | 3300005455 | Bacteria | 6350 |
| 71 | Ga0070663_100039658 | 3300005455 | Bacteria | 3293 |
| 72 | Ga0070662_100000817 | 3300005457 | Bacteria | 19185 |
| 73 | Ga0070662_100013295 | 3300005457 | Bacteria | 5476 |
| 74 | Ga0070662_100359362 | 3300005457 | Bacteria | 1195 |
| 75 | Ga0070662_100564757 | 3300005457 | Bacteria | 954 |
| 76 | Ga0070685_10000036 | 3300005466 | Bacteria | 80641 |
| 77 | Ga0070679_100024783 | 3300005530 | Bacteria | 5880 |
| 78 | Ga0070679_100044501 | 3300005530 | Bacteria | 4422 |
| 79 | Ga0070679_100302595 | 3300005530 | Bacteria | 1550 |
| 80 | Ga0070679_101056373 | 3300005530 | Bacteria | 756 |
| 81 | Ga0070684_100127559 | 3300005535 | Bacteria | 2293 |
| 82 | Ga0070684_100172175 | 3300005535 | Bacteria | 1966 |
| 83 | Ga0070684_100455453 | 3300005535 | Bacteria | 1183 |
| 84 | Ga0070697_100454502 | 3300005536 | Bacteria | 1116 |
| 85 | Ga0068853_100094743 | 3300005539 | Bacteria | 2631 |
| 86 | Ga0070672_100336696 | 3300005543 | Bacteria | 1284 |
| 87 | Ga0070686_100000045 | 3300005544 | Bacteria | 101988 |
| 88 | Ga0070696_100034529 | 3300005546 | Bacteria | 3479 |
| 89 | Ga0070693_100854388 | 3300005547 | Bacteria | 679 |
| 90 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 91 | Ga0070665_100032131 | 3300005548 | Bacteria | 5283 |
| 92 | Ga0070665_100143060 | 3300005548 | Bacteria | 2395 |
| 93 | Ga0070665_100633637 | 3300005548 | Bacteria | 1082 |
| 94 | Ga0068855_100040201 | 3300005563 | Bacteria | 5551 |
| 95 | Ga0068855_100220777 | 3300005563 | Bacteria | 2125 |
| 96 | Ga0068855_101045957 | 3300005563 | Bacteria | 856 |
| 97 | Ga0070664_100009011 | 3300005564 | Bacteria | 8095 |
| 98 | Ga0070664_100017908 | 3300005564 | Bacteria | 5816 |
| 99 | Ga0070664_100023442 | 3300005564 | Bacteria | 5099 |
| 100 | Ga0068857_100015922 | 3300005577 | Bacteria | 6583 |
| 101 | Ga0068857_100040794 | 3300005577 | Bacteria | 4115 |
| 102 | Ga0068857_100153186 | 3300005577 | Bacteria | 2089 |
| 103 | Ga0068857_100230774 | 3300005577 | Bacteria | 1693 |
| 104 | Ga0068857_100368729 | 3300005577 | Bacteria | 1332 |
| 105 | Ga0068857_100414504 | 3300005577 | Bacteria | 1255 |
| 106 | Ga0068854_100024805 | 3300005578 | Bacteria | 4110 |
| 107 | Ga0068854_100069986 | 3300005578 | Bacteria | 2563 |
| 108 | Ga0068854_101158285 | 3300005578 | Bacteria | 691 |
| 109 | Ga0068856_100028832 | 3300005614 | Bacteria | 5423 |
| 110 | Ga0068852_100214782 | 3300005616 | Bacteria | 1827 |
| 111 | Ga0068852_100563564 | 3300005616 | Bacteria | 1140 |
| 112 | Ga0068859_100006686 | 3300005617 | Bacteria | 11707 |
| 113 | Ga0068859_100008241 | 3300005617 | Bacteria | 10570 |
| 114 | Ga0068859_100011875 | 3300005617 | Bacteria | 8750 |
| 115 | Ga0068859_100020546 | 3300005617 | Bacteria | 6625 |
| 116 | Ga0068859_100049269 | 3300005617 | Bacteria | 4230 |
| 117 | Ga0068859_100174343 | 3300005617 | Bacteria | 2232 |
| 118 | Ga0068864_100000011 | 3300005618 | Bacteria | 350056 |
| 119 | Ga0068864_100000098 | 3300005618 | Bacteria | 85661 |
| 120 | Ga0068864_100144324 | 3300005618 | Bacteria | 2150 |
| 121 | Ga0068864_101275641 | 3300005618 | Bacteria | 734 |
| 122 | Ga0068861_100001207 | 3300005719 | Bacteria | 16096 |
| 123 | Ga0068861_100033153 | 3300005719 | Bacteria | 3808 |
| 124 | Ga0068851_10176315 | 3300005834 | Bacteria | 1182 |
| 125 | Ga0068863_100000020 | 3300005841 | Bacteria | 198519 |
| 126 | Ga0068863_100000127 | 3300005841 | Bacteria | 80572 |
| 127 | Ga0068863_100000239 | 3300005841 | Bacteria | 58509 |
| 128 | Ga0068863_100003798 | 3300005841 | Bacteria | 14933 |
| 129 | Ga0068863_100009580 | 3300005841 | Bacteria | 9448 |
| 130 | Ga0068863_100033855 | 3300005841 | Bacteria | 4868 |
| 131 | Ga0068863_100055314 | 3300005841 | Bacteria | 3758 |
| 132 | Ga0068863_100336600 | 3300005841 | Bacteria | 1468 |
| 133 | Ga0068863_101492118 | 3300005841 | Bacteria | 684 |
| 134 | Ga0068858_100000186 | 3300005842 | Bacteria | 65965 |
| 135 | Ga0068858_100002824 | 3300005842 | Bacteria | 17456 |
| 136 | Ga0068858_100584889 | 3300005842 | Bacteria | 1082 |
| 137 | Ga0068860_100000090 | 3300005843 | Bacteria | 151520 |
| 138 | Ga0068860_100000182 | 3300005843 | Bacteria | 100888 |
| 139 | Ga0068860_100000361 | 3300005843 | Bacteria | 60231 |
| 140 | Ga0068860_100008972 | 3300005843 | Bacteria | 9962 |
| 141 | Ga0068860_100846840 | 3300005843 | Bacteria | 929 |
| 142 | Ga0068860_100964053 | 3300005843 | Bacteria | 870 |
| 143 | Ga0068862_100000104 | 3300005844 | Bacteria | 100182 |
| 144 | Ga0068862_100000133 | 3300005844 | Bacteria | 86113 |
| 145 | Ga0068862_100000173 | 3300005844 | Bacteria | 71977 |
| 146 | Ga0068862_100000308 | 3300005844 | Bacteria | 53687 |
| 147 | Ga0068862_100001485 | 3300005844 | Bacteria | 21504 |
| 148 | Ga0068862_100017371 | 3300005844 | Bacteria | 5991 |
| 149 | Ga0068862_100464363 | 3300005844 | Bacteria | 1195 |
| 150 | Ga0068862_100804380 | 3300005844 | Bacteria | 918 |
| 151 | Ga0081455_10000215 | 3300005937 | Bacteria | 73808 |
| 152 | Ga0075366_10006964 | 3300006195 | Bacteria | 6224 |
| 153 | Ga0075366_10023197 | 3300006195 | Bacteria | 3614 |
| 154 | Ga0075366_10160977 | 3300006195 | Bacteria | 1360 |
| 155 | Ga0075430_100045853 | 3300006846 | Bacteria | 3692 |
| 156 | Ga0097620_100006686 | 3300006931 | Bacteria | 11707 |
| 157 | Ga0097620_100008240 | 3300006931 | Bacteria | 10570 |
| 158 | Ga0097620_100011875 | 3300006931 | Bacteria | 8750 |
| 159 | Ga0097620_100020546 | 3300006931 | Bacteria | 6625 |
| 160 | Ga0097620_100049271 | 3300006931 | Bacteria | 4230 |
| 161 | Ga0097620_100174356 | 3300006931 | Bacteria | 2232 |
| 162 | Ga0079104_1036089 | 3300006946 | Bacteria | 1189 |
| 163 | Ga0075435_100152084 | 3300007076 | Bacteria | 1946 |
| 164 | Ga0105251_10003406 | 3300009011 | Bacteria | 11537 |
| 165 | Ga0105240_10004567 | 3300009093 | Bacteria | 20996 |
| 166 | Ga0111539_10208209 | 3300009094 | Bacteria | 2279 |
| 167 | Ga0111539_10646309 | 3300009094 | Bacteria | 1232 |
| 168 | Ga0105247_10010996 | 3300009101 | Bacteria | 5462 |
| 169 | Ga0105247_10023891 | 3300009101 | Bacteria | 3683 |
| 170 | Ga0105247_10088598 | 3300009101 | Bacteria | 1961 |
| 171 | Ga0114129_10703605 | 3300009147 | Bacteria | 1298 |
| 172 | Ga0105241_10486379 | 3300009174 | Bacteria | 1098 |
| 173 | Ga0105248_10000229 | 3300009177 | Bacteria | 64280 |
| 174 | Ga0105248_10001403 | 3300009177 | Bacteria | 26914 |
| 175 | Ga0105248_10043322 | 3300009177 | Bacteria | 5046 |
| 176 | Ga0105248_10129926 | 3300009177 | Bacteria | 2842 |
| 177 | Ga0105248_10701699 | 3300009177 | Bacteria | 1142 |
| 178 | Ga0105237_10122940 | 3300009545 | Bacteria | 2589 |
| 179 | Ga0105238_10884917 | 3300009551 | Bacteria | 911 |
| 180 | Ga0105238_10939420 | 3300009551 | Bacteria | 884 |
| 181 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 182 | Ga0105249_10000037 | 3300009553 | Bacteria | 197428 |
| 183 | Ga0105249_10000116 | 3300009553 | Bacteria | 108394 |
| 184 | Ga0105239_10802317 | 3300010375 | Bacteria | 1078 |
| 185 | Ga0105246_10001236 | 3300011119 | Bacteria | 14986 |
| 186 | Ga0105246_10004297 | 3300011119 | Bacteria | 8665 |
| 187 | Ga0157326_1000645 | 3300012513 | Bacteria | 4090 |
| 188 | Ga0157373_10069845 | 3300013100 | Bacteria | 2483 |
| 189 | Ga0157373_10116382 | 3300013100 | Bacteria | 1879 |
| 190 | Ga0157373_10194420 | 3300013100 | Bacteria | 1430 |
| 191 | Ga0157371_10008038 | 3300013102 | Bacteria | 8442 |
| 192 | Ga0157371_10025049 | 3300013102 | Bacteria | 4353 |
| 193 | Ga0157371_10184628 | 3300013102 | Bacteria | 1492 |
| 194 | Ga0157371_10470661 | 3300013102 | Bacteria | 925 |
| 195 | Ga0157370_10008050 | 3300013104 | Bacteria | 11412 |
| 196 | Ga0157370_10573978 | 3300013104 | Bacteria | 1033 |
| 197 | Ga0157370_10785974 | 3300013104 | Bacteria | 866 |
| 198 | Ga0157369_10064214 | 3300013105 | Bacteria | 3954 |
| 199 | Ga0157369_10249505 | 3300013105 | Bacteria | 1852 |
| 200 | Ga0157378_10020993 | 3300013297 | Bacteria | 5746 |
| 201 | Ga0163162_10162903 | 3300013306 | Bacteria | 2353 |
| 202 | Ga0163162_10228716 | 3300013306 | Bacteria | 1990 |
| 203 | Ga0157372_10020903 | 3300013307 | Bacteria | 7065 |
| 204 | Ga0157372_10180258 | 3300013307 | Bacteria | 2445 |
| 205 | Ga0157372_10519079 | 3300013307 | Bacteria | 1389 |
| 206 | Ga0157372_10874791 | 3300013307 | Bacteria | 1043 |
| 207 | Ga0157375_11070886 | 3300013308 | Bacteria | 943 |
| 208 | Ga0157375_11507781 | 3300013308 | Bacteria | 794 |
| 209 | Ga0163163_10100465 | 3300014325 | Bacteria | 2915 |
| 210 | Ga0163163_10131526 | 3300014325 | Bacteria | 2543 |
| 211 | Ga0163163_10492079 | 3300014325 | Bacteria | 1288 |
| 212 | Ga0157380_10000083 | 3300014326 | Bacteria | 52136 |
| 213 | Ga0157380_10002669 | 3300014326 | Bacteria | 12096 |
| 214 | Ga0157380_10012259 | 3300014326 | Bacteria | 6211 |
| 215 | Ga0157379_10037988 | 3300014968 | Bacteria | 4296 |
| 216 | Ga0157379_10206444 | 3300014968 | Bacteria | 1777 |
| 217 | Ga0157379_10324147 | 3300014968 | Bacteria | 1407 |
| 218 | Ga0157376_11009401 | 3300014969 | Bacteria | 855 |
| 219 | Ga0163161_10000202 | 3300017792 | Bacteria | 54518 |
| 220 | Ga0163161_10098300 | 3300017792 | Bacteria | 2175 |
| 221 | Ga0206353_10841921 | 3300020082 | Bacteria | 13432 |
| 222 | Ga0213873_10000007 | 3300021358 | Bacteria | 309961 |
| 223 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 224 | Ga0207697_10216926 | 3300025315 | Bacteria | 844 |
| 225 | Ga0207656_10044753 | 3300025321 | Bacteria | 1891 |
| 226 | Ga0207696_1001700 | 3300025711 | Bacteria | 11426 |
| 227 | Ga0207713_1003933 | 3300025735 | Bacteria | 9884 |
| 228 | Ga0207713_1008709 | 3300025735 | Bacteria | 5796 |
| 229 | Ga0207710_10013466 | 3300025900 | Bacteria | 3441 |
| 230 | Ga0207710_10051025 | 3300025900 | Bacteria | 1857 |
| 231 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 232 | Ga0207680_10070478 | 3300025903 | Bacteria | 2164 |
| 233 | Ga0207647_10002793 | 3300025904 | Bacteria | 13172 |
| 234 | Ga0207645_10014814 | 3300025907 | Bacteria | 5204 |
| 235 | Ga0207705_10067565 | 3300025909 | Bacteria | 2587 |
| 236 | Ga0207705_10263451 | 3300025909 | Bacteria | 1316 |
| 237 | Ga0207705_10487628 | 3300025909 | Bacteria | 957 |
| 238 | Ga0207705_10530509 | 3300025909 | Bacteria | 915 |
| 239 | Ga0207654_10000754 | 3300025911 | Bacteria | 17918 |
| 240 | Ga0207654_10264263 | 3300025911 | Bacteria | 1158 |
| 241 | Ga0207654_10574038 | 3300025911 | Bacteria | 803 |
| 242 | Ga0207707_10471073 | 3300025912 | Bacteria | 1073 |
| 243 | Ga0207707_10738906 | 3300025912 | Bacteria | 824 |
| 244 | Ga0207695_10001501 | 3300025913 | Bacteria | 38827 |
| 245 | Ga0207695_10044031 | 3300025913 | Bacteria | 4752 |
| 246 | Ga0207671_10005938 | 3300025914 | Bacteria | 11067 |
| 247 | Ga0207671_10040833 | 3300025914 | Bacteria | 3433 |
| 248 | Ga0207660_10500189 | 3300025917 | Bacteria | 986 |
| 249 | Ga0207657_10004557 | 3300025919 | Bacteria | 14649 |
| 250 | Ga0207657_10060829 | 3300025919 | Bacteria | 3240 |
| 251 | Ga0207657_10450936 | 3300025919 | Bacteria | 1009 |
| 252 | Ga0207649_10058641 | 3300025920 | Bacteria | 2412 |
| 253 | Ga0207649_10136234 | 3300025920 | Bacteria | 1674 |
| 254 | Ga0207649_10578187 | 3300025920 | Bacteria | 862 |
| 255 | Ga0207652_10001167 | 3300025921 | Bacteria | 23590 |
| 256 | Ga0207652_10225391 | 3300025921 | Bacteria | 1689 |
| 257 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 258 | Ga0207681_10000076 | 3300025923 | Bacteria | 89353 |
| 259 | Ga0207681_10000203 | 3300025923 | Bacteria | 47389 |
| 260 | Ga0207681_10013391 | 3300025923 | Bacteria | 5076 |
| 261 | Ga0207681_10381225 | 3300025923 | Bacteria | 1135 |
| 262 | Ga0207681_10656486 | 3300025923 | Bacteria | 870 |
| 263 | Ga0207694_10036918 | 3300025924 | Bacteria | 3750 |
| 264 | Ga0207650_10000018 | 3300025925 | Bacteria | 352120 |
| 265 | Ga0207650_10000197 | 3300025925 | Bacteria | 69480 |
| 266 | Ga0207650_10002683 | 3300025925 | Bacteria | 12303 |
| 267 | Ga0207650_10027745 | 3300025925 | Bacteria | 4055 |
| 268 | Ga0207659_10279836 | 3300025926 | Bacteria | 1363 |
| 269 | Ga0207644_10000025 | 3300025931 | Bacteria | 152401 |
| 270 | Ga0207644_10000050 | 3300025931 | Bacteria | 93772 |
| 271 | Ga0207644_10000254 | 3300025931 | Bacteria | 36059 |
| 272 | Ga0207644_10029218 | 3300025931 | Bacteria | 3823 |
| 273 | Ga0207690_10106370 | 3300025932 | Bacteria | 2013 |
| 274 | Ga0207690_10157379 | 3300025932 | Bacteria | 1690 |
| 275 | Ga0207690_10447274 | 3300025932 | Bacteria | 1038 |
| 276 | Ga0207706_10001603 | 3300025933 | Bacteria | 22433 |
| 277 | Ga0207706_10017880 | 3300025933 | Bacteria | 6384 |
| 278 | Ga0207706_10436942 | 3300025933 | Bacteria | 1133 |
| 279 | Ga0207691_10326015 | 3300025940 | Bacteria | 1316 |
| 280 | Ga0207691_10612186 | 3300025940 | Bacteria | 922 |
| 281 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 282 | Ga0207711_10001356 | 3300025941 | Bacteria | 23103 |
| 283 | Ga0207711_10272269 | 3300025941 | Bacteria | 1558 |
| 284 | Ga0207711_10275387 | 3300025941 | Bacteria | 1549 |
| 285 | Ga0207689_10063889 | 3300025942 | Bacteria | 3028 |
| 286 | Ga0207661_10118549 | 3300025944 | Bacteria | 2250 |
| 287 | Ga0207679_10148547 | 3300025945 | Bacteria | 1904 |
| 288 | Ga0207679_10491944 | 3300025945 | Bacteria | 1093 |
| 289 | Ga0207679_10872696 | 3300025945 | Bacteria | 822 |
| 290 | Ga0207667_10032623 | 3300025949 | Bacteria | 5609 |
| 291 | Ga0207667_10063601 | 3300025949 | Bacteria | 3855 |
| 292 | Ga0207667_10116733 | 3300025949 | Bacteria | 2750 |
| 293 | Ga0207667_10737994 | 3300025949 | Bacteria | 985 |
| 294 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 295 | Ga0207712_10000035 | 3300025961 | Bacteria | 201152 |
| 296 | Ga0207712_10000726 | 3300025961 | Bacteria | 25124 |
| 297 | Ga0207668_10000048 | 3300025972 | Bacteria | 100390 |
| 298 | Ga0207668_10000111 | 3300025972 | Bacteria | 58689 |
| 299 | Ga0207668_10049598 | 3300025972 | Bacteria | 2887 |
| 300 | Ga0207668_10074263 | 3300025972 | Bacteria | 2440 |
| 301 | Ga0207640_10017102 | 3300025981 | Bacteria | 4235 |
| 302 | Ga0207640_10112453 | 3300025981 | Bacteria | 1933 |
| 303 | Ga0207640_10226968 | 3300025981 | Bacteria | 1434 |
| 304 | Ga0207658_10000090 | 3300025986 | Bacteria | 100143 |
| 305 | Ga0207658_10000134 | 3300025986 | Bacteria | 78342 |
| 306 | Ga0207658_10000143 | 3300025986 | Bacteria | 74612 |
| 307 | Ga0207658_10001629 | 3300025986 | Bacteria | 17221 |
| 308 | Ga0207658_10003728 | 3300025986 | Bacteria | 10731 |
| 309 | Ga0207658_10005982 | 3300025986 | Bacteria | 8317 |
| 310 | Ga0207703_10000231 | 3300026035 | Bacteria | 63888 |
| 311 | Ga0207703_10007079 | 3300026035 | Bacteria | 8924 |
| 312 | Ga0207703_10760287 | 3300026035 | Bacteria | 924 |
| 313 | Ga0207639_10036138 | 3300026041 | Bacteria | 3659 |
| 314 | Ga0207639_10136686 | 3300026041 | Bacteria | 2037 |
| 315 | Ga0207639_10177683 | 3300026041 | Bacteria | 1808 |
| 316 | Ga0207678_10643815 | 3300026067 | Bacteria | 931 |
| 317 | Ga0207702_10011360 | 3300026078 | Bacteria | 7425 |
| 318 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 319 | Ga0207641_10000022 | 3300026088 | Bacteria | 279334 |
| 320 | Ga0207641_10000589 | 3300026088 | Bacteria | 39950 |
| 321 | Ga0207641_10001362 | 3300026088 | Bacteria | 24233 |
| 322 | Ga0207641_10016881 | 3300026088 | Bacteria | 5978 |
| 323 | Ga0207641_10267282 | 3300026088 | Bacteria | 1603 |
| 324 | Ga0207648_11116444 | 3300026089 | Bacteria | 740 |
| 325 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 326 | Ga0207676_10000209 | 3300026095 | Bacteria | 50724 |
| 327 | Ga0207676_10016182 | 3300026095 | Bacteria | 5398 |
| 328 | Ga0207676_10031900 | 3300026095 | Bacteria | 3964 |
| 329 | Ga0207676_10926907 | 3300026095 | Bacteria | 855 |
| 330 | Ga0207674_10000814 | 3300026116 | Bacteria | 40536 |
| 331 | Ga0207674_10020781 | 3300026116 | Bacteria | 7085 |
| 332 | Ga0207674_10112966 | 3300026116 | Bacteria | 2690 |
| 333 | Ga0207674_10120849 | 3300026116 | Bacteria | 2587 |
| 334 | Ga0207675_100000227 | 3300026118 | Bacteria | 53090 |
| 335 | Ga0207675_100002408 | 3300026118 | Bacteria | 18527 |
| 336 | Ga0207675_100170468 | 3300026118 | Bacteria | 2080 |
| 337 | Ga0207698_10058099 | 3300026142 | Bacteria | 2996 |
| 338 | Ga0207698_10292856 | 3300026142 | Bacteria | 1511 |
| 339 | Ga0207698_10424293 | 3300026142 | Bacteria | 1277 |
| 340 | Ga0207698_10424790 | 3300026142 | Bacteria | 1276 |
| 341 | Ga0209281_1014027 | 3300027111 | Bacteria | 1709 |
| 342 | Ga0209974_10012104 | 3300027876 | Bacteria | 2888 |
| 343 | Ga0209974_10112566 | 3300027876 | Bacteria | 959 |
| 344 | Ga0207428_10032857 | 3300027907 | Bacteria | 4266 |
| 345 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 346 | Ga0268266_10037417 | 3300028379 | Bacteria | 4134 |
| 347 | Ga0268266_10533327 | 3300028379 | Bacteria | 1123 |
| 348 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 349 | Ga0268265_10000090 | 3300028380 | Bacteria | 116514 |
| 350 | Ga0268265_10001609 | 3300028380 | Bacteria | 18629 |
| 351 | Ga0268265_10001818 | 3300028380 | Bacteria | 17052 |
| 352 | Ga0268265_10004696 | 3300028380 | Bacteria | 9432 |
| 353 | Ga0268265_10092441 | 3300028380 | Bacteria | 2421 |
| 354 | Ga0268265_10331343 | 3300028380 | Bacteria | 1383 |
| 355 | Ga0268264_10000074 | 3300028381 | Bacteria | 259555 |
| 356 | Ga0268264_10000075 | 3300028381 | Bacteria | 256011 |
| 357 | Ga0268264_10000087 | 3300028381 | Bacteria | 236696 |
| 358 | Ga0268264_10016551 | 3300028381 | Bacteria | 6037 |
| 359 | Ga0268264_10031336 | 3300028381 | Bacteria | 4360 |
| 360 | Ga0268264_10152974 | 3300028381 | Bacteria | 2070 |
| 361 | Ga0268264_10643202 | 3300028381 | Bacteria | 1049 |
| 362 | Ga0316176_1090056 | 3300030732 | Bacteria | 1204 |
| 363 | Ga0316183_1200454 | 3300030742 | Bacteria | 879 |
| 364 | Ga0316182_1125745 | 3300030745 | Bacteria | 3190 |
| 365 | Ga0316182_1389245 | 3300030745 | Bacteria | 721 |
| 366 | Ga0307513_10027979 | 3300031456 | Bacteria | 6460 |
| 367 | Ga0307408_100058865 | 3300031548 | Bacteria | 2794 |
| 368 | Ga0307408_100087356 | 3300031548 | Bacteria | 2346 |
| 369 | Ga0307408_100106029 | 3300031548 | Bacteria | 2150 |
| 370 | Ga0307408_100782007 | 3300031548 | Bacteria | 865 |
| 371 | Ga0307408_100835333 | 3300031548 | Bacteria | 839 |
| 372 | Ga0307405_10000836 | 3300031731 | Bacteria | 12118 |
| 373 | Ga0307405_10006159 | 3300031731 | Bacteria | 5876 |
| 374 | Ga0307405_10055309 | 3300031731 | Bacteria | 2483 |
| 375 | Ga0307405_10166316 | 3300031731 | Bacteria | 1568 |
| 376 | Ga0307405_10305605 | 3300031731 | Bacteria | 1209 |
| 377 | Ga0307405_11028171 | 3300031731 | Bacteria | 704 |
| 378 | Ga0307413_10054139 | 3300031824 | Bacteria | 2433 |
| 379 | Ga0307413_10064998 | 3300031824 | Bacteria | 2269 |
| 380 | Ga0307413_10081048 | 3300031824 | Bacteria | 2080 |
| 381 | Ga0307410_10055430 | 3300031852 | Bacteria | 2691 |
| 382 | Ga0307410_10344099 | 3300031852 | Bacteria | 1189 |
| 383 | Ga0307407_10036498 | 3300031903 | Bacteria | 2709 |
| 384 | Ga0307407_10122197 | 3300031903 | Bacteria | 1653 |
| 385 | Ga0307407_10289216 | 3300031903 | Bacteria | 1138 |
| 386 | Ga0307407_10315983 | 3300031903 | Bacteria | 1094 |
| 387 | Ga0307412_10008462 | 3300031911 | Bacteria | 5874 |
| 388 | Ga0307412_10021958 | 3300031911 | Bacteria | 3905 |
| 389 | Ga0307412_10024561 | 3300031911 | Bacteria | 3721 |
| 390 | Ga0307412_10034814 | 3300031911 | Bacteria | 3212 |
| 391 | Ga0307412_10081056 | 3300031911 | Bacteria | 2243 |
| 392 | Ga0307412_10187860 | 3300031911 | Bacteria | 1560 |
| 393 | Ga0307412_10205825 | 3300031911 | Bacteria | 1498 |
| 394 | Ga0307412_10293554 | 3300031911 | Bacteria | 1282 |
| 395 | Ga0307409_100023054 | 3300031995 | Bacteria | 4305 |
| 396 | Ga0307409_100058219 | 3300031995 | Bacteria | 3000 |
| 397 | Ga0307409_100087449 | 3300031995 | Bacteria | 2540 |
| 398 | Ga0307409_100410262 | 3300031995 | Bacteria | 1296 |
| 399 | Ga0307416_100006179 | 3300032002 | Bacteria | 7470 |
| 400 | Ga0307416_100329211 | 3300032002 | Bacteria | 1534 |
| 401 | Ga0307416_100432716 | 3300032002 | Bacteria | 1363 |
| 402 | Ga0307416_100780041 | 3300032002 | Bacteria | 1050 |
| 403 | Ga0307414_10014382 | 3300032004 | Bacteria | 4743 |
| 404 | Ga0307414_10034003 | 3300032004 | Bacteria | 3375 |
| 405 | Ga0307414_10104405 | 3300032004 | Bacteria | 2140 |
| 406 | Ga0307414_10175330 | 3300032004 | Bacteria | 1719 |
| 407 | Ga0307414_10199094 | 3300032004 | Bacteria | 1627 |
| 408 | Ga0307414_10278918 | 3300032004 | Bacteria | 1403 |
| 409 | Ga0307414_10466730 | 3300032004 | Bacteria | 1110 |
| 410 | Ga0307411_10023453 | 3300032005 | Bacteria | 3656 |
| 411 | Ga0307411_10091571 | 3300032005 | Bacteria | 2124 |
| 412 | Ga0307411_10342037 | 3300032005 | Bacteria | 1216 |
| 413 | Ga0307415_100002260 | 3300032126 | Bacteria | 9545 |
| 414 | Ga0307415_100411082 | 3300032126 | Bacteria | 1158 |
| 415 | Ga0307415_100611991 | 3300032126 | Bacteria | 971 |
| 416 | Ga0373927_0012559 | 3300035695 | Bacteria | 5640 |
| 417 | Ga0395905_0039185 | 3300037471 | Bacteria | 4446 |
| 418 | Ga0395905_0325285 | 3300037471 | Bacteria | 1428 |
| 419 | Ga0395901_0891151 | 3300038443 | Bacteria | 872 |
| 420 | Ga0395901_0924944 | 3300038443 | Bacteria | 852 |
| 421 | Ga0436365_0352550 | 3300039437 | Bacteria | 74350 |
| 422 | Ga0436365_0455740 | 3300039437 | Bacteria | 1104 |
| 423 | Ga0436365_0524113 | 3300039437 | Bacteria | 852 |
| 424 | Ga0436362_0451893 | 3300039453 | Bacteria | 163419 |
| 425 | Ga0451853_1008997 | 3300041512 | Bacteria | 716 |
| 426 | Ga0439431_0037573 | 3300041997 | Bacteria | 1223 |
| 427 | Ga0439445_0029994 | 3300042004 | Bacteria | 1407 |
| 428 | Ga0439462_0007196 | 3300042015 | Bacteria | 2784 |
| 429 | Ga0450917_001488 | 3300042120 | Bacteria | 1685 |
| 430 | Ga0450905_000642 | 3300042142 | Bacteria | 4315 |
| 431 | Ga0450889_000953 | 3300042144 | Bacteria | 3071 |
| 432 | Ga0439434_0017189 | 3300042435 | Bacteria | 2164 |
| 433 | Ga0450893_0020011 | 3300042532 | Bacteria | 1147 |
| 434 | Ga0466973_0123262 | 3300044659 | Bacteria | 2127 |
| 435 | Ga0495617_032784 | 3300046452 | Bacteria | 1744 |
| 436 | Ga0495638_0000011 | 3300046460 | Bacteria | 442453 |
| 437 | Ga0495596_0120578 | 3300046500 | Bacteria | 1018 |
| 438 | Ga0495583_0000077 | 3300046506 | Bacteria | 171772 |
| 439 | Ga0495632_0000834 | 3300046519 | Bacteria | 27160 |
| 440 | Ga0495637_0015444 | 3300046520 | Bacteria | 3581 |
| 441 | Ga0495643_0092534 | 3300046522 | Bacteria | 1558 |
| 442 | Ga0495648_0000023 | 3300046524 | Bacteria | 240174 |
| 443 | Ga0495648_0401582 | 3300046524 | Bacteria | 612 |
| 444 | Ga0495663_0005516 | 3300046525 | Bacteria | 3510 |
| 445 | Ga0495663_0024611 | 3300046525 | Bacteria | 1751 |
| 446 | Ga0495654_0001135 | 3300046530 | Bacteria | 19108 |
| 447 | Ga0495621_0001374 | 3300046539 | Bacteria | 6304 |
| 448 | Ga0495597_0007292 | 3300046542 | Bacteria | 5635 |
| 449 | Ga0495633_0010430 | 3300046558 | Bacteria | 5068 |
| 450 | Ga0495633_0087328 | 3300046558 | Bacteria | 1450 |
| 451 | Ga0495633_0126152 | 3300046558 | Bacteria | 1184 |
| 452 | Ga0495668_0010459 | 3300046616 | Bacteria | 5613 |
| 453 | Ga0495668_0015691 | 3300046616 | Bacteria | 4416 |
| 454 | Ga0495669_0007253 | 3300046684 | Bacteria | 4645 |
| 455 | Ga0495669_0024612 | 3300046684 | Bacteria | 2622 |
| 456 | Ga0495670_0027384 | 3300046691 | Bacteria | 2823 |
| 457 | Ga0495671_0000012 | 3300046692 | Bacteria | 358632 |
| 458 | Ga0495677_0020681 | 3300047445 | Bacteria | 2385 |
| 459 | Ga0495673_0000029 | 3300047469 | Bacteria | 471019 |
| 460 | Ga0495615_0052945 | 3300048090 | Bacteria | 1050 |
| 461 | Ga0496100_0116741 | 3300048903 | Bacteria | 1862 |
| 462 | Ga0496100_0202683 | 3300048903 | Bacteria | 1447 |
| 463 | Ga0496101_0002372 | 3300048904 | Bacteria | 11562 |
| 464 | Ga0496101_0305534 | 3300048904 | Bacteria | 1246 |
| 465 | Ga0496102_0000162 | 3300048905 | Bacteria | 89746 |
| 466 | Ga0496102_0005342 | 3300048905 | Bacteria | 10903 |
| 467 | Ga0496103_0000328 | 3300048906 | Bacteria | 43483 |
| 468 | Ga0496103_0001069 | 3300048906 | Bacteria | 19126 |
| 469 | Ga0496103_0046120 | 3300048906 | Bacteria | 2690 |
| 470 | Ga0496104_0000083 | 3300048907 | Bacteria | 91698 |
| 471 | Ga0496105_0000086 | 3300048908 | Bacteria | 66447 |
| 472 | Ga0496105_0081442 | 3300048908 | Bacteria | 2674 |
| 473 | Ga0496106_0231552 | 3300048909 | Bacteria | 1475 |
| 474 | Ga0496107_0034169 | 3300048910 | Bacteria | 3641 |
| 475 | Ga0496107_0174134 | 3300048910 | Bacteria | 1597 |
| 476 | Ga0496111_0455104 | 3300048914 | Bacteria | 944 |
| 477 | Ga0496112_0070706 | 3300048915 | Bacteria | 3449 |
| 478 | Ga0496113_0000776 | 3300048916 | Bacteria | 16491 |
| 479 | Ga0496114_0006267 | 3300048917 | Bacteria | 9365 |
| 480 | Ga0496115_0163029 | 3300048918 | Bacteria | 1843 |
| 481 | Ga0496116_0018743 | 3300048919 | Bacteria | 5320 |
| 482 | Ga0496117_0000323 | 3300048920 | Bacteria | 83916 |
| 483 | Ga0496117_0007388 | 3300048920 | Bacteria | 10754 |
| 484 | Ga0496117_0038417 | 3300048920 | Bacteria | 3549 |
| 485 | Ga0496118_0004928 | 3300048921 | Bacteria | 15493 |
| 486 | Ga0496118_0012140 | 3300048921 | Bacteria | 8311 |
| 487 | Ga0496118_0014592 | 3300048921 | Bacteria | 7344 |
| 488 | Ga0496119_0000180 | 3300048922 | Bacteria | 88339 |
| 489 | Ga0496120_0000342 | 3300048923 | Bacteria | 77136 |
| 490 | Ga0496121_0002474 | 3300048924 | Bacteria | 28166 |
| 491 | Ga0496122_0000918 | 3300048925 | Bacteria | 53963 |
| 492 | Ga0496123_0001257 | 3300048926 | Bacteria | 36453 |
| 493 | Ga0496124_0059542 | 3300048927 | Bacteria | 3207 |
| 494 | Ga0496124_0372003 | 3300048927 | Bacteria | 1003 |
| 495 | Ga0496125_0004290 | 3300048928 | Bacteria | 16559 |
| 496 | Ga0496125_0047287 | 3300048928 | Bacteria | 3600 |
| 497 | Ga0496126_0000044 | 3300048929 | Bacteria | 335904 |
| 498 | Ga0496126_0283870 | 3300048929 | Bacteria | 1370 |
| 499 | Ga0501290_000074 | 3300049513 | Bacteria | 14077 |
| 500 | Ga0501292_000027 | 3300049515 | Bacteria | 41628 |
| 501 | Ga0501294_000682 | 3300049517 | Bacteria | 3816 |
| 502 | Ga0501300_001473 | 3300049523 | Bacteria | 3533 |
| 503 | Ga0501301_007746 | 3300049524 | Bacteria | 834 |
| 504 | Ga0501315_043021 | 3300049531 | Bacteria | 689 |
| 505 | Ga0501033_0079207 | 3300049570 | Bacteria | 2411 |
| 506 | Ga0501034_0305097 | 3300049571 | Bacteria | 1528 |
| 507 | Ga0501036_0303023 | 3300049572 | Bacteria | 1336 |
| 508 | Ga0501038_0153945 | 3300049574 | Bacteria | 1873 |
| 509 | Ga0501038_0887470 | 3300049574 | Bacteria | 659 |
| 510 | Ga0501039_1044371 | 3300049575 | Bacteria | 634 |
| 511 | Ga0501042_0738266 | 3300049578 | Bacteria | 716 |
| 512 | Ga0501043_0090388 | 3300049579 | Bacteria | 2407 |
| 513 | Ga0501047_0012927 | 3300049581 | Bacteria | 7906 |
| 514 | Ga0501047_0381249 | 3300049581 | Bacteria | 1244 |
| 515 | Ga0501206_001212 | 3300049653 | Bacteria | 3226 |
| 516 | Ga0501222_000773 | 3300049662 | Bacteria | 4609 |
| 517 | Ga0501223_001826 | 3300049663 | Bacteria | 4812 |
| 518 | Ga0501224_000579 | 3300049664 | Bacteria | 4503 |
| 519 | Ga0501227_037034 | 3300049665 | Bacteria | 1192 |
| 520 | Ga0501233_001196 | 3300049668 | Bacteria | 4415 |
| 521 | Ga0501235_001128 | 3300049669 | Bacteria | 5596 |
| 522 | Ga0501259_001587 | 3300049688 | Bacteria | 3785 |
| 523 | Ga0501261_000011 | 3300049690 | Bacteria | 48296 |
| 524 | Ga0501225_0001543 | 3300049705 | Bacteria | 7232 |
| 525 | Ga0501245_001509 | 3300049708 | Bacteria | 3025 |
| 526 | Ga0501264_005243 | 3300049761 | Bacteria | 1180 |
| 527 | Ga0501279_000010 | 3300049775 | Bacteria | 103375 |
| 528 | Ga0501280_000099 | 3300049776 | Bacteria | 22972 |
| 529 | Ga0501281_00077 | 3300049777 | Bacteria | 11306 |
| 530 | Ga0501282_002009 | 3300049778 | Bacteria | 2238 |
| 531 | Ga0501283_021758 | 3300049779 | Bacteria | 1030 |
| 532 | Ga0501035_0368683 | 3300049822 | Bacteria | 1199 |
| 533 | Ga0501044_0087610 | 3300049823 | Bacteria | 3145 |
| 534 | Ga0501044_0106673 | 3300049823 | Bacteria | 2813 |
| 535 | Ga0501044_0204246 | 3300049823 | Bacteria | 1933 |
| 536 | nmdc:mga0k408_38443_c1 | 3300050493 | Bacteria | 2746 |
| 537 | nmdc:mga07m45_233774_c1 | 3300050496 | Bacteria | 1069 |
| 538 | nmdc:mga0qj67_86302_c1 | 3300050509 | Bacteria | 2518 |
| 539 | nmdc:mga08y16_161266_c1 | 3300050511 | Bacteria | 2330 |
| 540 | nmdc:mga0n895_415571_c1 | 3300050512 | Bacteria | 1360 |
| 541 | Ga0500643_002551 | 3300053087 | Bacteria | 9293 |
| 542 | Ga0500643_005656 | 3300053087 | Bacteria | 5346 |
| 543 | Ga0500647_0011154 | 3300053091 | Bacteria | 4001 |
| 544 | Ga0500651_0003100 | 3300053093 | Bacteria | 9004 |
| 545 | Ga0500607_000082 | 3300053121 | Bacteria | 70790 |
| 546 | Ga0500618_004495 | 3300053125 | Bacteria | 4430 |
| 547 | Ga0500642_0001312 | 3300053130 | Bacteria | 7111 |
| 548 | Ga0500652_033723 | 3300053131 | Bacteria | 2025 |
| 549 | Ga0500655_000307 | 3300053133 | Bacteria | 11138 |
| 550 | Ga0500559_0000199 | 3300053136 | Bacteria | 47863 |
| 551 | Ga0500573_0065188 | 3300053140 | Bacteria | 2083 |
| 552 | Ga0500590_000114 | 3300053148 | Bacteria | 21825 |
| 553 | Ga0500590_111102 | 3300053148 | Bacteria | 1300 |
| 554 | Ga0500622_0104988 | 3300053156 | Bacteria | 1386 |
| 555 | Ga0500627_0002353 | 3300053158 | Bacteria | 5588 |
| 556 | Ga0500639_026663 | 3300053163 | Bacteria | 3054 |
| 557 | Ga0500636_0196899 | 3300053177 | Bacteria | 1069 |
| 558 | Ga0500637_0036449 | 3300053178 | Bacteria | 2761 |
| 559 | Ga0500637_0344240 | 3300053178 | Bacteria | 796 |
| 560 | Ga0500570_000053 | 3300053724 | Bacteria | 28643 |
| 561 | Ga0500645_028994 | 3300053730 | Bacteria | 1672 |
| 562 | Ga0590071_023651 | 3300059421 | Bacteria | 1454 |
| 563 | Ga0587082_064726 | 3300059504 | Bacteria | 729 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014969 | Ga0157376_11009401 | Ga0157376_110094012 | 154 |
| 2 | 3300005577 | Ga0068857_100230774 | Ga0068857_1002307742 | 156 |
| 3 | 3300009551 | Ga0105238_10884917 | Ga0105238_108849172 | 156 |
| 4 | 3300026116 | Ga0207674_10120849 | Ga0207674_101208492 | 156 |
| 5 | 3300005327 | Ga0070658_10384334 | Ga0070658_103843341 | 164 |
| 6 | 3300025909 | Ga0207705_10263451 | Ga0207705_102634512 | 164 |
| 7 | 3300032002 | Ga0307416_100329211 | Ga0307416_1003292112 | 164 |
| 8 | 3300005295 | Ga0065707_10261697 | Ga0065707_102616972 | 166 |
| 9 | 3300014968 | Ga0157379_10206444 | Ga0157379_102064441 | 166 |
| 10 | 3300046452 | Ga0495617_032784 | Ga0495617_032784_279_848 | 166 |
| 11 | 3300046460 | Ga0495638_0000011 | Ga0495638_0000011_231638_232207 | 166 |
| 12 | 3300046506 | Ga0495583_0000077 | Ga0495583_0000077_14026_14595 | 166 |
| 13 | 3300046519 | Ga0495632_0000834 | Ga0495632_0000834_22485_23054 | 166 |
| 14 | 3300046524 | Ga0495648_0000023 | Ga0495648_0000023_29358_29927 | 166 |
| 15 | 3300046558 | Ga0495633_0010430 | Ga0495633_0010430_46_615 | 166 |
| 16 | 3300046692 | Ga0495671_0000012 | Ga0495671_0000012_200877_201446 | 166 |
| 17 | 3300047469 | Ga0495673_0000029 | Ga0495673_0000029_157187_157756 | 166 |
| 18 | 3300037471 | Ga0395905_0325285 | Ga0395905_0325285_346_897 | 167 |
| 19 | 3300044659 | Ga0466973_0123262 | Ga0466973_0123262_474_1019 | 167 |
| 20 | 3300049579 | Ga0501043_0090388 | Ga0501043_0090388_1789_2334 | 167 |
| 21 | 3300049581 | Ga0501047_0012927 | Ga0501047_0012927_1799_2344 | 167 |
| 22 | 3300049823 | Ga0501044_0204246 | Ga0501044_0204246_1294_1839 | 167 |
| 23 | 3300005353 | Ga0070669_100660560 | Ga0070669_1006605601 | 168 |
| 24 | 3300025923 | Ga0207681_10656486 | Ga0207681_106564862 | 168 |
| 25 | 3300005841 | Ga0068863_100033855 | Ga0068863_1000338553 | 170 |
| 26 | 3300026088 | Ga0207641_10016881 | Ga0207641_100168815 | 170 |
| 27 | 3300050512 | nmdc:mga0n895_415571_c1 | nmdc:mga0n895_415571_c1_97_624 | 170 |
| 28 | 3300053140 | Ga0500573_0065188 | Ga0500573_0065188_63_599 | 170 |
| 29 | 3300013100 | Ga0157373_10194420 | Ga0157373_101944201 | 171 |
| 30 | 3300031548 | Ga0307408_100106029 | Ga0307408_1001060293 | 171 |
| 31 | 3300031903 | Ga0307407_10122197 | Ga0307407_101221972 | 171 |
| 32 | 3300031911 | Ga0307412_10187860 | Ga0307412_101878602 | 171 |
| 33 | 3300032004 | Ga0307414_10466730 | Ga0307414_104667302 | 171 |
| 34 | iso_pu_bacteria | 2882806704 | 2882807783 | 171 |
| 35 | 3300005331 | Ga0070670_100062683 | Ga0070670_1000626832 | 172 |
| 36 | 3300005347 | Ga0070668_100000123 | Ga0070668_10000012346 | 172 |
| 37 | 3300005355 | Ga0070671_100000232 | Ga0070671_10000023221 | 172 |
| 38 | 3300005366 | Ga0070659_101128428 | Ga0070659_1011284281 | 172 |
| 39 | 3300005535 | Ga0070684_100127559 | Ga0070684_1001275592 | 172 |
| 40 | 3300005548 | Ga0070665_100143060 | Ga0070665_1001430602 | 172 |
| 41 | 3300005617 | Ga0068859_100011875 | Ga0068859_1000118754 | 172 |
| 42 | 3300005841 | Ga0068863_100000020 | Ga0068863_1000000206 | 172 |
| 43 | 3300006931 | Ga0097620_100011875 | Ga0097620_1000118754 | 172 |
| 44 | 3300013104 | Ga0157370_10573978 | Ga0157370_105739781 | 172 |
| 45 | 3300025931 | Ga0207644_10000025 | Ga0207644_1000002528 | 172 |
| 46 | 3300025972 | Ga0207668_10000111 | Ga0207668_100001112 | 172 |
| 47 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001957 | 172 |
| 48 | 3300028381 | Ga0268264_10016551 | Ga0268264_100165514 | 172 |
| 49 | 3300030732 | Ga0316176_1090056 | Ga0316176_10900562 | 173 |
| 50 | 3300030745 | Ga0316182_1125745 | Ga0316182_11257452 | 173 |
| 51 | 3300005536 | Ga0070697_100454502 | Ga0070697_1004545021 | 174 |
| 52 | 3300007076 | Ga0075435_100152084 | Ga0075435_1001520842 | 174 |
| 53 | 3300009177 | Ga0105248_10000229 | Ga0105248_100002295 | 174 |
| 54 | 3300014325 | Ga0163163_10100465 | Ga0163163_101004652 | 174 |
| 55 | 3300014326 | Ga0157380_10000083 | Ga0157380_100000833 | 174 |
| 56 | 3300020082 | Ga0206353_10841921 | Ga0206353_1084192113 | 174 |
| 57 | 3300021358 | Ga0213873_10000007 | Ga0213873_10000007160 | 174 |
| 58 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005196 | 174 |
| 59 | 3300031548 | Ga0307408_100835333 | Ga0307408_1008353332 | 174 |
| 60 | 3300039437 | Ga0436365_0352550 | Ga0436365_0352550_21793_22329 | 174 |
| 61 | 3300039437 | Ga0436365_0455740 | Ga0436365_0455740_459_1007 | 174 |
| 62 | 3300039437 | Ga0436365_0524113 | Ga0436365_0524113_78_614 | 174 |
| 63 | 3300039453 | Ga0436362_0451893 | Ga0436362_0451893_151776_152312 | 174 |
| 64 | 3300049823 | Ga0501044_0087610 | Ga0501044_0087610_464_1036 | 174 |
| 65 | iso_pu_bacteria | 2643221588 | 2643949234 | 174 |
| 66 | iso_pu_bacteria | 2738541275 | 2738711853 | 174 |
| 67 | iso_pu_bacteria | 2738541301 | 2738850278 | 174 |
| 68 | iso_pu_bacteria | 2738541304 | 2738866007 | 174 |
| 69 | iso_pu_bacteria | 2738543022 | 2739298525 | 174 |
| 70 | iso_pu_bacteria | 2738543033 | 2739360203 | 174 |
| 71 | iso_pu_bacteria | 2928100450 | 2928103021 | 174 |
| 72 | iso_pu_bacteria | 2928959182 | 2928959585 | 174 |
| 73 | 3300027876 | Ga0209974_10112566 | Ga0209974_101125662 | 175 |
| 74 | 3300031548 | Ga0307408_100782007 | Ga0307408_1007820071 | 175 |
| 75 | 3300031731 | Ga0307405_10006159 | Ga0307405_100061596 | 175 |
| 76 | 3300032002 | Ga0307416_100780041 | Ga0307416_1007800411 | 175 |
| 77 | 3300005327 | Ga0070658_10058565 | Ga0070658_100585653 | 176 |
| 78 | 3300005327 | Ga0070658_10486868 | Ga0070658_104868681 | 176 |
| 79 | 3300005327 | Ga0070658_10545156 | Ga0070658_105451562 | 176 |
| 80 | 3300005329 | Ga0070683_101180038 | Ga0070683_1011800381 | 176 |
| 81 | 3300005337 | Ga0070682_100517156 | Ga0070682_1005171561 | 176 |
| 82 | 3300005339 | Ga0070660_100004439 | Ga0070660_1000044392 | 176 |
| 83 | 3300005345 | Ga0070692_10119308 | Ga0070692_101193082 | 176 |
| 84 | 3300005366 | Ga0070659_100181465 | Ga0070659_1001814653 | 176 |
| 85 | 3300005455 | Ga0070663_100039658 | Ga0070663_1000396581 | 176 |
| 86 | 3300005457 | Ga0070662_100000817 | Ga0070662_1000008172 | 176 |
| 87 | 3300005457 | Ga0070662_100013295 | Ga0070662_1000132954 | 176 |
| 88 | 3300005530 | Ga0070679_100024783 | Ga0070679_1000247833 | 176 |
| 89 | 3300005530 | Ga0070679_100044501 | Ga0070679_1000445013 | 176 |
| 90 | 3300005530 | Ga0070679_100302595 | Ga0070679_1003025951 | 176 |
| 91 | 3300005530 | Ga0070679_101056373 | Ga0070679_1010563731 | 176 |
| 92 | 3300005535 | Ga0070684_100455453 | Ga0070684_1004554532 | 176 |
| 93 | 3300005539 | Ga0068853_100094743 | Ga0068853_1000947432 | 176 |
| 94 | 3300005563 | Ga0068855_100040201 | Ga0068855_1000402017 | 176 |
| 95 | 3300005563 | Ga0068855_100220777 | Ga0068855_1002207772 | 176 |
| 96 | 3300005564 | Ga0070664_100009011 | Ga0070664_1000090115 | 176 |
| 97 | 3300005564 | Ga0070664_100023442 | Ga0070664_1000234426 | 176 |
| 98 | 3300005577 | Ga0068857_100040794 | Ga0068857_1000407942 | 176 |
| 99 | 3300005577 | Ga0068857_100368729 | Ga0068857_1003687292 | 176 |
| 100 | 3300005578 | Ga0068854_101158285 | Ga0068854_1011582851 | 176 |
| 101 | 3300005614 | Ga0068856_100028832 | Ga0068856_1000288325 | 176 |
| 102 | 3300005616 | Ga0068852_100563564 | Ga0068852_1005635642 | 176 |
| 103 | 3300005834 | Ga0068851_10176315 | Ga0068851_101763152 | 176 |
| 104 | 3300006846 | Ga0075430_100045853 | Ga0075430_1000458533 | 176 |
| 105 | 3300009174 | Ga0105241_10486379 | Ga0105241_104863792 | 176 |
| 106 | 3300010375 | Ga0105239_10802317 | Ga0105239_108023171 | 176 |
| 107 | 3300011119 | Ga0105246_10001236 | Ga0105246_100012364 | 176 |
| 108 | 3300013100 | Ga0157373_10069845 | Ga0157373_100698452 | 176 |
| 109 | 3300013102 | Ga0157371_10008038 | Ga0157371_100080382 | 176 |
| 110 | 3300013102 | Ga0157371_10025049 | Ga0157371_100250496 | 176 |
| 111 | 3300013102 | Ga0157371_10470661 | Ga0157371_104706612 | 176 |
| 112 | 3300013104 | Ga0157370_10008050 | Ga0157370_100080507 | 176 |
| 113 | 3300013104 | Ga0157370_10785974 | Ga0157370_107859742 | 176 |
| 114 | 3300013105 | Ga0157369_10064214 | Ga0157369_100642143 | 176 |
| 115 | 3300013105 | Ga0157369_10249505 | Ga0157369_102495052 | 176 |
| 116 | 3300013307 | Ga0157372_10020903 | Ga0157372_100209036 | 176 |
| 117 | 3300013307 | Ga0157372_10519079 | Ga0157372_105190792 | 176 |
| 118 | 3300025909 | Ga0207705_10067565 | Ga0207705_100675652 | 176 |
| 119 | 3300025909 | Ga0207705_10487628 | Ga0207705_104876282 | 176 |
| 120 | 3300025909 | Ga0207705_10530509 | Ga0207705_105305091 | 176 |
| 121 | 3300025911 | Ga0207654_10264263 | Ga0207654_102642632 | 176 |
| 122 | 3300025912 | Ga0207707_10738906 | Ga0207707_107389062 | 176 |
| 123 | 3300025919 | Ga0207657_10004557 | Ga0207657_100045573 | 176 |
| 124 | 3300025919 | Ga0207657_10450936 | Ga0207657_104509362 | 176 |
| 125 | 3300025920 | Ga0207649_10136234 | Ga0207649_101362342 | 176 |
| 126 | 3300025920 | Ga0207649_10578187 | Ga0207649_105781872 | 176 |
| 127 | 3300025921 | Ga0207652_10001167 | Ga0207652_100011677 | 176 |
| 128 | 3300025921 | Ga0207652_10225391 | Ga0207652_102253912 | 176 |
| 129 | 3300025926 | Ga0207659_10279836 | Ga0207659_102798362 | 176 |
| 130 | 3300025932 | Ga0207690_10106370 | Ga0207690_101063703 | 176 |
| 131 | 3300025932 | Ga0207690_10157379 | Ga0207690_101573792 | 176 |
| 132 | 3300025933 | Ga0207706_10001603 | Ga0207706_1000160320 | 176 |
| 133 | 3300025933 | Ga0207706_10017880 | Ga0207706_100178805 | 176 |
| 134 | 3300025940 | Ga0207691_10612186 | Ga0207691_106121861 | 176 |
| 135 | 3300025944 | Ga0207661_10118549 | Ga0207661_101185493 | 176 |
| 136 | 3300025949 | Ga0207667_10032623 | Ga0207667_100326237 | 176 |
| 137 | 3300025949 | Ga0207667_10116733 | Ga0207667_101167332 | 176 |
| 138 | 3300026041 | Ga0207639_10177683 | Ga0207639_101776832 | 176 |
| 139 | 3300026067 | Ga0207678_10643815 | Ga0207678_106438152 | 176 |
| 140 | 3300026116 | Ga0207674_10112966 | Ga0207674_101129662 | 176 |
| 141 | 3300026142 | Ga0207698_10292856 | Ga0207698_102928562 | 176 |
| 142 | 3300026142 | Ga0207698_10424293 | Ga0207698_104242931 | 176 |
| 143 | 3300027876 | Ga0209974_10012104 | Ga0209974_100121043 | 176 |
| 144 | 3300041997 | Ga0439431_0037573 | Ga0439431_0037573_365_958 | 176 |
| 145 | 3300048908 | Ga0496105_0081442 | Ga0496105_0081442_1569_2159 | 176 |
| 146 | 3300048917 | Ga0496114_0006267 | Ga0496114_0006267_4621_5211 | 176 |
| 147 | 3300048929 | Ga0496126_0283870 | Ga0496126_0283870_43_609 | 176 |
| 148 | 3300049570 | Ga0501033_0079207 | Ga0501033_0079207_46_627 | 176 |
| 149 | 3300050509 | nmdc:mga0qj67_86302_c1 | nmdc:mga0qj67_86302_c1_1793_2350 | 176 |
| 150 | iso_pu_bacteria | 2643221605 | 2644038165 | 176 |
| 151 | iso_pu_bacteria | 2885427238 | 2885427896 | 176 |
| 152 | 3300005334 | Ga0068869_100961131 | Ga0068869_1009611311 | 177 |
| 153 | 3300005547 | Ga0070693_100854388 | Ga0070693_1008543881 | 177 |
| 154 | 3300005577 | Ga0068857_100414504 | Ga0068857_1004145041 | 177 |
| 155 | 3300006195 | Ga0075366_10023197 | Ga0075366_100231972 | 177 |
| 156 | 3300009093 | Ga0105240_10004567 | Ga0105240_1000456721 | 177 |
| 157 | 3300009551 | Ga0105238_10939420 | Ga0105238_109394202 | 177 |
| 158 | 3300011119 | Ga0105246_10004297 | Ga0105246_100042975 | 177 |
| 159 | 3300025913 | Ga0207695_10001501 | Ga0207695_1000150111 | 177 |
| 160 | 3300025945 | Ga0207679_10491944 | Ga0207679_104919442 | 177 |
| 161 | 3300031824 | Ga0307413_10081048 | Ga0307413_100810483 | 177 |
| 162 | 3300031911 | Ga0307412_10024561 | Ga0307412_100245612 | 177 |
| 163 | 3300031911 | Ga0307412_10034814 | Ga0307412_100348144 | 177 |
| 164 | 3300031911 | Ga0307412_10205825 | Ga0307412_102058252 | 177 |
| 165 | 3300031995 | Ga0307409_100058219 | Ga0307409_1000582194 | 177 |
| 166 | 3300032002 | Ga0307416_100432716 | Ga0307416_1004327162 | 177 |
| 167 | 3300032004 | Ga0307414_10014382 | Ga0307414_100143822 | 177 |
| 168 | 3300032004 | Ga0307414_10199094 | Ga0307414_101990942 | 177 |
| 169 | 3300032126 | Ga0307415_100411082 | Ga0307415_1004110821 | 177 |
| 170 | 3300041512 | Ga0451853_1008997 | Ga0451853_1008997_79_648 | 177 |
| 171 | 3300042015 | Ga0439462_0007196 | Ga0439462_0007196_854_1429 | 177 |
| 172 | 3300042532 | Ga0450893_0020011 | Ga0450893_0020011_88_672 | 177 |
| 173 | 3300049571 | Ga0501034_0305097 | Ga0501034_0305097_779_1363 | 177 |
| 174 | 3300049572 | Ga0501036_0303023 | Ga0501036_0303023_153_737 | 177 |
| 175 | 3300049574 | Ga0501038_0887470 | Ga0501038_0887470_17_601 | 177 |
| 176 | 3300049575 | Ga0501039_1044371 | Ga0501039_1044371_34_618 | 177 |
| 177 | 3300049578 | Ga0501042_0738266 | Ga0501042_0738266_80_664 | 177 |
| 178 | 3300049581 | Ga0501047_0381249 | Ga0501047_0381249_33_617 | 177 |
| 179 | 3300049822 | Ga0501035_0368683 | Ga0501035_0368683_119_703 | 177 |
| 180 | 3300049823 | Ga0501044_0106673 | Ga0501044_0106673_1634_2218 | 177 |
| 181 | iso_pu_bacteria | 2643221541 | 2643728910 | 177 |
| 182 | iso_pu_bacteria | 2643221606 | 2644044925 | 177 |
| 183 | iso_pu_bacteria | 2643221671 | 2644391098 | 177 |
| 184 | 2162886007 | SwRhRL2b_contig_825531 | SwRhRL2b_0722.00008890 | 178 |
| 185 | 3300002074 | JGI24748J21848_1007851 | JGI24748J21848_10078511 | 178 |
| 186 | 3300002076 | JGI24749J21850_1000308 | JGI24749J21850_10003087 | 178 |
| 187 | 3300002459 | JGI24751J29686_10000062 | JGI24751J29686_1000006239 | 178 |
| 188 | 3300005289 | Ga0065704_10072521 | Ga0065704_100725217 | 178 |
| 189 | 3300005295 | Ga0065707_10194496 | Ga0065707_101944962 | 178 |
| 190 | 3300005331 | Ga0070670_100000005 | Ga0070670_100000005274 | 178 |
| 191 | 3300005353 | Ga0070669_100000060 | Ga0070669_10000006013 | 178 |
| 192 | 3300005353 | Ga0070669_100000446 | Ga0070669_10000044627 | 178 |
| 193 | 3300005353 | Ga0070669_100366093 | Ga0070669_1003660931 | 178 |
| 194 | 3300005355 | Ga0070671_100013374 | Ga0070671_1000133744 | 178 |
| 195 | 3300005367 | Ga0070667_100001092 | Ga0070667_10000109230 | 178 |
| 196 | 3300005367 | Ga0070667_100009037 | Ga0070667_1000090373 | 178 |
| 197 | 3300005548 | Ga0070665_100032131 | Ga0070665_1000321316 | 178 |
| 198 | 3300005578 | Ga0068854_100024805 | Ga0068854_1000248054 | 178 |
| 199 | 3300005617 | Ga0068859_100174343 | Ga0068859_1001743433 | 178 |
| 200 | 3300005618 | Ga0068864_100000011 | Ga0068864_100000011271 | 178 |
| 201 | 3300005844 | Ga0068862_100000104 | Ga0068862_10000010466 | 178 |
| 202 | 3300005844 | Ga0068862_100017371 | Ga0068862_1000173715 | 178 |
| 203 | 3300005844 | Ga0068862_100804380 | Ga0068862_1008043802 | 178 |
| 204 | 3300006931 | Ga0097620_100174356 | Ga0097620_1001743563 | 178 |
| 205 | 3300006946 | Ga0079104_1036089 | Ga0079104_10360892 | 178 |
| 206 | 3300013306 | Ga0163162_10162903 | Ga0163162_101629033 | 178 |
| 207 | 3300017792 | Ga0163161_10098300 | Ga0163161_100983003 | 178 |
| 208 | 3300025315 | Ga0207697_10216926 | Ga0207697_102169261 | 178 |
| 209 | 3300025711 | Ga0207696_1001700 | Ga0207696_10017005 | 178 |
| 210 | 3300025735 | Ga0207713_1003933 | Ga0207713_10039337 | 178 |
| 211 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001386 | 178 |
| 212 | 3300025923 | Ga0207681_10000203 | Ga0207681_100002034 | 178 |
| 213 | 3300025923 | Ga0207681_10381225 | Ga0207681_103812252 | 178 |
| 214 | 3300025925 | Ga0207650_10000018 | Ga0207650_10000018271 | 178 |
| 215 | 3300025931 | Ga0207644_10029218 | Ga0207644_100292185 | 178 |
| 216 | 3300025941 | Ga0207711_10001356 | Ga0207711_100013566 | 178 |
| 217 | 3300025972 | Ga0207668_10074263 | Ga0207668_100742634 | 178 |
| 218 | 3300025981 | Ga0207640_10112453 | Ga0207640_101124532 | 178 |
| 219 | 3300025986 | Ga0207658_10003728 | Ga0207658_1000372812 | 178 |
| 220 | 3300025986 | Ga0207658_10005982 | Ga0207658_100059823 | 178 |
| 221 | 3300026035 | Ga0207703_10760287 | Ga0207703_107602871 | 178 |
| 222 | 3300026041 | Ga0207639_10136686 | Ga0207639_101366862 | 178 |
| 223 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004664 | 178 |
| 224 | 3300026118 | Ga0207675_100002408 | Ga0207675_10000240817 | 178 |
| 225 | 3300026142 | Ga0207698_10058099 | Ga0207698_100580993 | 178 |
| 226 | 3300027111 | Ga0209281_1014027 | Ga0209281_10140272 | 178 |
| 227 | 3300028379 | Ga0268266_10037417 | Ga0268266_100374172 | 178 |
| 228 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002392 | 178 |
| 229 | 3300028380 | Ga0268265_10092441 | Ga0268265_100924412 | 178 |
| 230 | 3300028380 | Ga0268265_10331343 | Ga0268265_103313432 | 178 |
| 231 | 3300032004 | Ga0307414_10278918 | Ga0307414_102789182 | 178 |
| 232 | 3300042004 | Ga0439445_0029994 | Ga0439445_0029994_569_1150 | 178 |
| 233 | 3300042435 | Ga0439434_0017189 | Ga0439434_0017189_1199_1780 | 178 |
| 234 | 3300048903 | Ga0496100_0116741 | Ga0496100_0116741_1184_1744 | 178 |
| 235 | 3300048904 | Ga0496101_0002372 | Ga0496101_0002372_9726_10286 | 178 |
| 236 | 3300048905 | Ga0496102_0000162 | Ga0496102_0000162_18485_19045 | 178 |
| 237 | 3300048906 | Ga0496103_0000328 | Ga0496103_0000328_26733_27293 | 178 |
| 238 | 3300048907 | Ga0496104_0000083 | Ga0496104_0000083_54635_55195 | 178 |
| 239 | 3300048908 | Ga0496105_0000086 | Ga0496105_0000086_64794_65354 | 178 |
| 240 | 3300048910 | Ga0496107_0034169 | Ga0496107_0034169_1227_1787 | 178 |
| 241 | 3300048915 | Ga0496112_0070706 | Ga0496112_0070706_297_857 | 178 |
| 242 | 3300048916 | Ga0496113_0000776 | Ga0496113_0000776_11586_12146 | 178 |
| 243 | 3300048918 | Ga0496115_0163029 | Ga0496115_0163029_166_726 | 178 |
| 244 | 3300048920 | Ga0496117_0000323 | Ga0496117_0000323_11711_12271 | 178 |
| 245 | 3300048921 | Ga0496118_0012140 | Ga0496118_0012140_298_858 | 178 |
| 246 | 3300048922 | Ga0496119_0000180 | Ga0496119_0000180_36376_36936 | 178 |
| 247 | 3300048923 | Ga0496120_0000342 | Ga0496120_0000342_49816_50376 | 178 |
| 248 | 3300048924 | Ga0496121_0002474 | Ga0496121_0002474_16454_17014 | 178 |
| 249 | 3300048925 | Ga0496122_0000918 | Ga0496122_0000918_45133_45693 | 178 |
| 250 | 3300048926 | Ga0496123_0001257 | Ga0496123_0001257_9114_9674 | 178 |
| 251 | 3300048927 | Ga0496124_0059542 | Ga0496124_0059542_2180_2740 | 178 |
| 252 | 3300048928 | Ga0496125_0004290 | Ga0496125_0004290_7925_8485 | 178 |
| 253 | 3300048929 | Ga0496126_0000044 | Ga0496126_0000044_49489_50049 | 178 |
| 254 | 3300050493 | nmdc:mga0k408_38443_c1 | nmdc:mga0k408_38443_c1_930_1601 | 178 |
| 255 | 3300050496 | nmdc:mga07m45_233774_c1 | nmdc:mga07m45_233774_c1_22_624 | 178 |
| 256 | 3300053121 | Ga0500607_000082 | Ga0500607_000082_44937_45503 | 178 |
| 257 | 3300053136 | Ga0500559_0000199 | Ga0500559_0000199_1952_2518 | 178 |
| 258 | 3300053148 | Ga0500590_111102 | Ga0500590_111102_462_1028 | 178 |
| 259 | 3300053178 | Ga0500637_0036449 | Ga0500637_0036449_363_929 | 178 |
| 260 | 3300053730 | Ga0500645_028994 | Ga0500645_028994_532_1098 | 178 |
| 261 | 3300005331 | Ga0070670_100000485 | Ga0070670_10000048535 | 179 |
| 262 | 3300005334 | Ga0068869_100166460 | Ga0068869_1001664601 | 179 |
| 263 | 3300005335 | Ga0070666_10090554 | Ga0070666_100905542 | 179 |
| 264 | 3300005347 | Ga0070668_100000020 | Ga0070668_10000002086 | 179 |
| 265 | 3300005353 | Ga0070669_100109448 | Ga0070669_1001094481 | 179 |
| 266 | 3300005353 | Ga0070669_100168762 | Ga0070669_1001687622 | 179 |
| 267 | 3300005355 | Ga0070671_100000854 | Ga0070671_10000085417 | 179 |
| 268 | 3300005367 | Ga0070667_100000055 | Ga0070667_10000005560 | 179 |
| 269 | 3300005564 | Ga0070664_100017908 | Ga0070664_1000179085 | 179 |
| 270 | 3300005577 | Ga0068857_100015922 | Ga0068857_1000159226 | 179 |
| 271 | 3300005617 | Ga0068859_100006686 | Ga0068859_1000066869 | 179 |
| 272 | 3300005617 | Ga0068859_100049269 | Ga0068859_1000492694 | 179 |
| 273 | 3300005618 | Ga0068864_101275641 | Ga0068864_1012756412 | 179 |
| 274 | 3300005719 | Ga0068861_100033153 | Ga0068861_1000331532 | 179 |
| 275 | 3300005841 | Ga0068863_100336600 | Ga0068863_1003366002 | 179 |
| 276 | 3300005841 | Ga0068863_101492118 | Ga0068863_1014921181 | 179 |
| 277 | 3300005842 | Ga0068858_100000186 | Ga0068858_10000018666 | 179 |
| 278 | 3300005843 | Ga0068860_100000090 | Ga0068860_10000009061 | 179 |
| 279 | 3300005844 | Ga0068862_100001485 | Ga0068862_1000014857 | 179 |
| 280 | 3300005844 | Ga0068862_100464363 | Ga0068862_1004643632 | 179 |
| 281 | 3300006195 | Ga0075366_10006964 | Ga0075366_100069646 | 179 |
| 282 | 3300006195 | Ga0075366_10160977 | Ga0075366_101609772 | 179 |
| 283 | 3300006931 | Ga0097620_100006686 | Ga0097620_1000066869 | 179 |
| 284 | 3300006931 | Ga0097620_100049271 | Ga0097620_1000492714 | 179 |
| 285 | 3300009094 | Ga0111539_10646309 | Ga0111539_106463092 | 179 |
| 286 | 3300009177 | Ga0105248_10701699 | Ga0105248_107016991 | 179 |
| 287 | 3300013308 | Ga0157375_11507781 | Ga0157375_115077811 | 179 |
| 288 | 3300014325 | Ga0163163_10492079 | Ga0163163_104920791 | 179 |
| 289 | 3300025903 | Ga0207680_10070478 | Ga0207680_100704782 | 179 |
| 290 | 3300025923 | Ga0207681_10013391 | Ga0207681_100133916 | 179 |
| 291 | 3300025925 | Ga0207650_10002683 | Ga0207650_100026832 | 179 |
| 292 | 3300025931 | Ga0207644_10000050 | Ga0207644_1000005075 | 179 |
| 293 | 3300025941 | Ga0207711_10272269 | Ga0207711_102722692 | 179 |
| 294 | 3300025942 | Ga0207689_10063889 | Ga0207689_100638894 | 179 |
| 295 | 3300025945 | Ga0207679_10872696 | Ga0207679_108726961 | 179 |
| 296 | 3300025972 | Ga0207668_10000048 | Ga0207668_100000487 | 179 |
| 297 | 3300025986 | Ga0207658_10000090 | Ga0207658_10000090101 | 179 |
| 298 | 3300026035 | Ga0207703_10000231 | Ga0207703_100002318 | 179 |
| 299 | 3300026088 | Ga0207641_10267282 | Ga0207641_102672822 | 179 |
| 300 | 3300026095 | Ga0207676_10031900 | Ga0207676_100319001 | 179 |
| 301 | 3300026116 | Ga0207674_10000814 | Ga0207674_1000081442 | 179 |
| 302 | 3300026118 | Ga0207675_100170468 | Ga0207675_1001704681 | 179 |
| 303 | 3300028380 | Ga0268265_10001609 | Ga0268265_100016097 | 179 |
| 304 | 3300028381 | Ga0268264_10000075 | Ga0268264_10000075101 | 179 |
| 305 | 3300028381 | Ga0268264_10152974 | Ga0268264_101529742 | 179 |
| 306 | 3300030745 | Ga0316182_1389245 | Ga0316182_13892452 | 179 |
| 307 | 3300031548 | Ga0307408_100058865 | Ga0307408_1000588654 | 179 |
| 308 | 3300031731 | Ga0307405_10000836 | Ga0307405_100008362 | 179 |
| 309 | 3300031731 | Ga0307405_10166316 | Ga0307405_101663162 | 179 |
| 310 | 3300031731 | Ga0307405_11028171 | Ga0307405_110281712 | 179 |
| 311 | 3300031824 | Ga0307413_10054139 | Ga0307413_100541393 | 179 |
| 312 | 3300031824 | Ga0307413_10064998 | Ga0307413_100649982 | 179 |
| 313 | 3300031852 | Ga0307410_10055430 | Ga0307410_100554302 | 179 |
| 314 | 3300031852 | Ga0307410_10344099 | Ga0307410_103440992 | 179 |
| 315 | 3300031903 | Ga0307407_10036498 | Ga0307407_100364982 | 179 |
| 316 | 3300031903 | Ga0307407_10289216 | Ga0307407_102892162 | 179 |
| 317 | 3300031903 | Ga0307407_10315983 | Ga0307407_103159832 | 179 |
| 318 | 3300031911 | Ga0307412_10008462 | Ga0307412_100084623 | 179 |
| 319 | 3300031911 | Ga0307412_10081056 | Ga0307412_100810561 | 179 |
| 320 | 3300031995 | Ga0307409_100023054 | Ga0307409_1000230544 | 179 |
| 321 | 3300031995 | Ga0307409_100410262 | Ga0307409_1004102622 | 179 |
| 322 | 3300032002 | Ga0307416_100006179 | Ga0307416_1000061797 | 179 |
| 323 | 3300032004 | Ga0307414_10034003 | Ga0307414_100340033 | 179 |
| 324 | 3300032004 | Ga0307414_10104405 | Ga0307414_101044052 | 179 |
| 325 | 3300032005 | Ga0307411_10023453 | Ga0307411_100234531 | 179 |
| 326 | 3300032005 | Ga0307411_10091571 | Ga0307411_100915712 | 179 |
| 327 | 3300032005 | Ga0307411_10342037 | Ga0307411_103420372 | 179 |
| 328 | 3300032126 | Ga0307415_100002260 | Ga0307415_1000022609 | 179 |
| 329 | 3300032126 | Ga0307415_100611991 | Ga0307415_1006119912 | 179 |
| 330 | 3300037471 | Ga0395905_0039185 | Ga0395905_0039185_1223_1771 | 179 |
| 331 | 3300046500 | Ga0495596_0120578 | Ga0495596_0120578_401_949 | 179 |
| 332 | 3300046525 | Ga0495663_0005516 | Ga0495663_0005516_1276_1824 | 179 |
| 333 | 3300046539 | Ga0495621_0001374 | Ga0495621_0001374_4313_4861 | 179 |
| 334 | 3300046558 | Ga0495633_0087328 | Ga0495633_0087328_745_1293 | 179 |
| 335 | 3300046691 | Ga0495670_0027384 | Ga0495670_0027384_1640_2188 | 179 |
| 336 | 3300047445 | Ga0495677_0020681 | Ga0495677_0020681_1457_2005 | 179 |
| 337 | 3300048090 | Ga0495615_0052945 | Ga0495615_0052945_449_997 | 179 |
| 338 | iso_pu_bacteria | 2582581305 | 2585260948 | 179 |
| 339 | 3300005335 | Ga0070666_10074476 | Ga0070666_100744762 | 180 |
| 340 | 3300005367 | Ga0070667_100000016 | Ga0070667_1000000168 | 180 |
| 341 | 3300005546 | Ga0070696_100034529 | Ga0070696_1000345292 | 180 |
| 342 | 3300005563 | Ga0068855_101045957 | Ga0068855_1010459572 | 180 |
| 343 | 3300005841 | Ga0068863_100009580 | Ga0068863_10000958010 | 180 |
| 344 | 3300005841 | Ga0068863_100055314 | Ga0068863_1000553143 | 180 |
| 345 | 3300005843 | Ga0068860_100000361 | Ga0068860_1000003618 | 180 |
| 346 | 3300005843 | Ga0068860_100964053 | Ga0068860_1009640531 | 180 |
| 347 | 3300009094 | Ga0111539_10208209 | Ga0111539_102082092 | 180 |
| 348 | 3300009147 | Ga0114129_10703605 | Ga0114129_107036052 | 180 |
| 349 | 3300012513 | Ga0157326_1000645 | Ga0157326_10006452 | 180 |
| 350 | 3300013307 | Ga0157372_10874791 | Ga0157372_108747911 | 180 |
| 351 | 3300025907 | Ga0207645_10014814 | Ga0207645_100148146 | 180 |
| 352 | 3300025911 | Ga0207654_10574038 | Ga0207654_105740381 | 180 |
| 353 | 3300025912 | Ga0207707_10471073 | Ga0207707_104710732 | 180 |
| 354 | 3300025917 | Ga0207660_10500189 | Ga0207660_105001892 | 180 |
| 355 | 3300025932 | Ga0207690_10447274 | Ga0207690_104472742 | 180 |
| 356 | 3300025949 | Ga0207667_10737994 | Ga0207667_107379942 | 180 |
| 357 | 3300025981 | Ga0207640_10226968 | Ga0207640_102269682 | 180 |
| 358 | 3300025986 | Ga0207658_10000134 | Ga0207658_100001347 | 180 |
| 359 | 3300026088 | Ga0207641_10001362 | Ga0207641_100013624 | 180 |
| 360 | 3300027907 | Ga0207428_10032857 | Ga0207428_100328574 | 180 |
| 361 | 3300028381 | Ga0268264_10000087 | Ga0268264_100000877 | 180 |
| 362 | 3300030742 | Ga0316183_1200454 | Ga0316183_12004541 | 180 |
| 363 | 3300031548 | Ga0307408_100087356 | Ga0307408_1000873562 | 180 |
| 364 | 3300032004 | Ga0307414_10175330 | Ga0307414_101753302 | 180 |
| 365 | 3300038443 | Ga0395901_0891151 | Ga0395901_0891151_172_717 | 180 |
| 366 | 3300038443 | Ga0395901_0924944 | Ga0395901_0924944_174_719 | 180 |
| 367 | 3300042120 | Ga0450917_001488 | Ga0450917_001488_175_735 | 180 |
| 368 | 3300042142 | Ga0450905_000642 | Ga0450905_000642_2406_2966 | 180 |
| 369 | 3300042144 | Ga0450889_000953 | Ga0450889_000953_1027_1587 | 180 |
| 370 | 3300046684 | Ga0495669_0024612 | Ga0495669_0024612_2031_2582 | 180 |
| 371 | 3300050511 | nmdc:mga08y16_161266_c1 | nmdc:mga08y16_161266_c1_97_657 | 180 |
| 372 | 3300053091 | Ga0500647_0011154 | Ga0500647_0011154_1412_1954 | 180 |
| 373 | 3300053125 | Ga0500618_004495 | Ga0500618_004495_1654_2196 | 180 |
| 374 | 3300053177 | Ga0500636_0196899 | Ga0500636_0196899_491_1033 | 180 |
| 375 | 3300059421 | Ga0590071_023651 | Ga0590071_023651_310_864 | 180 |
| 376 | 3300005617 | Ga0068859_100020546 | Ga0068859_1000205467 | 181 |
| 377 | 3300005841 | Ga0068863_100003798 | Ga0068863_1000037989 | 181 |
| 378 | 3300005843 | Ga0068860_100008972 | Ga0068860_1000089726 | 181 |
| 379 | 3300005844 | Ga0068862_100000173 | Ga0068862_10000017356 | 181 |
| 380 | 3300006931 | Ga0097620_100020546 | Ga0097620_1000205467 | 181 |
| 381 | 3300009101 | Ga0105247_10023891 | Ga0105247_100238912 | 181 |
| 382 | 3300009553 | Ga0105249_10000037 | Ga0105249_1000003784 | 181 |
| 383 | 3300025900 | Ga0207710_10013466 | Ga0207710_100134665 | 181 |
| 384 | 3300025961 | Ga0207712_10000035 | Ga0207712_1000003585 | 181 |
| 385 | 3300028380 | Ga0268265_10001818 | Ga0268265_1000181812 | 181 |
| 386 | 3300028381 | Ga0268264_10031336 | Ga0268264_100313361 | 181 |
| 387 | 3300031456 | Ga0307513_10027979 | Ga0307513_100279793 | 181 |
| 388 | 3300005295 | Ga0065707_10349174 | Ga0065707_103491741 | 182 |
| 389 | 3300005548 | Ga0070665_100633637 | Ga0070665_1006336372 | 182 |
| 390 | 3300009177 | Ga0105248_10043322 | Ga0105248_100433222 | 182 |
| 391 | 3300025941 | Ga0207711_10275387 | Ga0207711_102753871 | 182 |
| 392 | 3300028379 | Ga0268266_10533327 | Ga0268266_105333271 | 182 |
| 393 | 3300031911 | Ga0307412_10293554 | Ga0307412_102935542 | 182 |
| 394 | 3300048928 | Ga0496125_0047287 | Ga0496125_0047287_200_748 | 182 |
| 395 | 3300049574 | Ga0501038_0153945 | Ga0501038_0153945_858_1430 | 182 |
| 396 | 3300035695 | Ga0373927_0012559 | Ga0373927_0012559_4619_5170 | 183 |
| 397 | 3300046520 | Ga0495637_0015444 | Ga0495637_0015444_1244_1795 | 183 |
| 398 | 3300046522 | Ga0495643_0092534 | Ga0495643_0092534_737_1288 | 183 |
| 399 | 3300046524 | Ga0495648_0401582 | Ga0495648_0401582_44_595 | 183 |
| 400 | 3300046542 | Ga0495597_0007292 | Ga0495597_0007292_852_1403 | 183 |
| 401 | 3300046558 | Ga0495633_0126152 | Ga0495633_0126152_125_676 | 183 |
| 402 | 3300046616 | Ga0495668_0015691 | Ga0495668_0015691_3163_3714 | 183 |
| 403 | 3300046684 | Ga0495669_0007253 | Ga0495669_0007253_2129_2680 | 183 |
| 404 | 3300053087 | Ga0500643_002551 | Ga0500643_002551_4737_5303 | 183 |
| 405 | 3300053093 | Ga0500651_0003100 | Ga0500651_0003100_6825_7376 | 183 |
| 406 | 3300053130 | Ga0500642_0001312 | Ga0500642_0001312_1265_1816 | 183 |
| 407 | 3300053131 | Ga0500652_033723 | Ga0500652_033723_403_954 | 183 |
| 408 | 3300053133 | Ga0500655_000307 | Ga0500655_000307_620_1171 | 183 |
| 409 | 3300053148 | Ga0500590_000114 | Ga0500590_000114_12316_12867 | 183 |
| 410 | 3300053156 | Ga0500622_0104988 | Ga0500622_0104988_261_812 | 183 |
| 411 | 3300053163 | Ga0500639_026663 | Ga0500639_026663_839_1390 | 183 |
| 412 | 3300053178 | Ga0500637_0344240 | Ga0500637_0344240_127_678 | 183 |
| 413 | 3300053724 | Ga0500570_000053 | Ga0500570_000053_15942_16493 | 183 |
| 414 | 3300005295 | Ga0065707_10118337 | Ga0065707_101183372 | 184 |
| 415 | 3300005843 | Ga0068860_100846840 | Ga0068860_1008468402 | 184 |
| 416 | 3300028381 | Ga0268264_10643202 | Ga0268264_106432022 | 184 |
| 417 | 3300053087 | Ga0500643_005656 | Ga0500643_005656_1383_1937 | 184 |
| 418 | 3300005289 | Ga0065704_10074425 | Ga0065704_100744252 | 186 |
| 419 | 3300005331 | Ga0070670_100000125 | Ga0070670_10000012515 | 186 |
| 420 | 3300005367 | Ga0070667_100001008 | Ga0070667_10000100815 | 186 |
| 421 | 3300005618 | Ga0068864_100000098 | Ga0068864_10000009868 | 186 |
| 422 | 3300005841 | Ga0068863_100000127 | Ga0068863_10000012715 | 186 |
| 423 | 3300005842 | Ga0068858_100584889 | Ga0068858_1005848892 | 186 |
| 424 | 3300005844 | Ga0068862_100000133 | Ga0068862_10000013368 | 186 |
| 425 | 3300009011 | Ga0105251_10003406 | Ga0105251_100034067 | 186 |
| 426 | 3300009101 | Ga0105247_10088598 | Ga0105247_100885982 | 186 |
| 427 | 3300009177 | Ga0105248_10001403 | Ga0105248_1000140316 | 186 |
| 428 | 3300009553 | Ga0105249_10000116 | Ga0105249_1000011693 | 186 |
| 429 | 3300014325 | Ga0163163_10131526 | Ga0163163_101315262 | 186 |
| 430 | 3300014968 | Ga0157379_10324147 | Ga0157379_103241472 | 186 |
| 431 | 3300025735 | Ga0207713_1008709 | Ga0207713_10087093 | 186 |
| 432 | 3300025900 | Ga0207710_10051025 | Ga0207710_100510252 | 186 |
| 433 | 3300025914 | Ga0207671_10040833 | Ga0207671_100408334 | 186 |
| 434 | 3300025925 | Ga0207650_10000197 | Ga0207650_1000019757 | 186 |
| 435 | 3300025941 | Ga0207711_10000022 | Ga0207711_10000022348 | 186 |
| 436 | 3300025961 | Ga0207712_10000726 | Ga0207712_1000072617 | 186 |
| 437 | 3300025986 | Ga0207658_10000143 | Ga0207658_100001439 | 186 |
| 438 | 3300026088 | Ga0207641_10000022 | Ga0207641_10000022245 | 186 |
| 439 | 3300026095 | Ga0207676_10000209 | Ga0207676_1000020937 | 186 |
| 440 | 3300028380 | Ga0268265_10000090 | Ga0268265_1000009015 | 186 |
| 441 | 3300048904 | Ga0496101_0305534 | Ga0496101_0305534_73_633 | 186 |
| 442 | 3300048906 | Ga0496103_0046120 | Ga0496103_0046120_1674_2234 | 186 |
| 443 | 3300048920 | Ga0496117_0038417 | Ga0496117_0038417_1435_1995 | 186 |
| 444 | 3300048921 | Ga0496118_0004928 | Ga0496118_0004928_199_759 | 186 |
| 445 | 3300049513 | Ga0501290_000074 | Ga0501290_000074_9865_10431 | 186 |
| 446 | 3300049515 | Ga0501292_000027 | Ga0501292_000027_37393_37959 | 186 |
| 447 | 3300049517 | Ga0501294_000682 | Ga0501294_000682_2030_2596 | 186 |
| 448 | 3300049523 | Ga0501300_001473 | Ga0501300_001473_201_767 | 186 |
| 449 | 3300049524 | Ga0501301_007746 | Ga0501301_007746_41_607 | 186 |
| 450 | 3300049531 | Ga0501315_043021 | Ga0501315_043021_79_645 | 186 |
| 451 | 3300049653 | Ga0501206_001212 | Ga0501206_001212_1885_2451 | 186 |
| 452 | 3300049662 | Ga0501222_000773 | Ga0501222_000773_2594_3160 | 186 |
| 453 | 3300049663 | Ga0501223_001826 | Ga0501223_001826_2587_3153 | 186 |
| 454 | 3300049664 | Ga0501224_000579 | Ga0501224_000579_2988_3554 | 186 |
| 455 | 3300049665 | Ga0501227_037034 | Ga0501227_037034_586_1152 | 186 |
| 456 | 3300049668 | Ga0501233_001196 | Ga0501233_001196_1366_1932 | 186 |
| 457 | 3300049669 | Ga0501235_001128 | Ga0501235_001128_2386_2952 | 186 |
| 458 | 3300049688 | Ga0501259_001587 | Ga0501259_001587_3107_3673 | 186 |
| 459 | 3300049690 | Ga0501261_000011 | Ga0501261_000011_37410_37976 | 186 |
| 460 | 3300049705 | Ga0501225_0001543 | Ga0501225_0001543_3887_4453 | 186 |
| 461 | 3300049708 | Ga0501245_001509 | Ga0501245_001509_1474_2040 | 186 |
| 462 | 3300049761 | Ga0501264_005243 | Ga0501264_005243_410_976 | 186 |
| 463 | 3300049775 | Ga0501279_000010 | Ga0501279_000010_48500_49066 | 186 |
| 464 | 3300049776 | Ga0501280_000099 | Ga0501280_000099_12138_12704 | 186 |
| 465 | 3300049777 | Ga0501281_00077 | Ga0501281_00077_7390_7956 | 186 |
| 466 | 3300049778 | Ga0501282_002009 | Ga0501282_002009_647_1213 | 186 |
| 467 | 3300049779 | Ga0501283_021758 | Ga0501283_021758_200_766 | 186 |
| 468 | 3300059504 | Ga0587082_064726 | Ga0587082_064726_37_603 | 186 |
| 469 | 3300031731 | Ga0307405_10305605 | Ga0307405_103056052 | 187 |
| 470 | 3300031911 | Ga0307412_10021958 | Ga0307412_100219582 | 187 |
| 471 | 3300001979 | JGI24740J21852_10051343 | JGI24740J21852_100513431 | 189 |
| 472 | 3300001989 | JGI24739J22299_10006795 | JGI24739J22299_100067952 | 189 |
| 473 | 3300002075 | JGI24738J21930_10028381 | JGI24738J21930_100283812 | 189 |
| 474 | 3300005457 | Ga0070662_100359362 | Ga0070662_1003593621 | 189 |
| 475 | 3300005577 | Ga0068857_100153186 | Ga0068857_1001531862 | 189 |
| 476 | 3300005578 | Ga0068854_100069986 | Ga0068854_1000699861 | 189 |
| 477 | 3300005616 | Ga0068852_100214782 | Ga0068852_1002147822 | 189 |
| 478 | 3300025933 | Ga0207706_10436942 | Ga0207706_104369421 | 189 |
| 479 | 3300026116 | Ga0207674_10020781 | Ga0207674_100207819 | 189 |
| 480 | 3300031731 | Ga0307405_10055309 | Ga0307405_100553092 | 189 |
| 481 | 3300031995 | Ga0307409_100087449 | Ga0307409_1000874492 | 189 |
| 482 | 2162886006 | SwRhRL3b_contig_2913204 | SwRhRL3b_0599.00001580 | 191 |
| 483 | 3300001904 | JGI24736J21556_1002149 | JGI24736J21556_10021492 | 191 |
| 484 | 3300001976 | JGI24752J21851_1001927 | JGI24752J21851_10019272 | 191 |
| 485 | 3300001989 | JGI24739J22299_10014945 | JGI24739J22299_100149451 | 191 |
| 486 | 3300002070 | JGI24750J21931_1000005 | JGI24750J21931_10000054 | 191 |
| 487 | 3300002074 | JGI24748J21848_1000076 | JGI24748J21848_100007611 | 191 |
| 488 | 3300002075 | JGI24738J21930_10007634 | JGI24738J21930_100076343 | 191 |
| 489 | 3300002076 | JGI24749J21850_1000500 | JGI24749J21850_10005003 | 191 |
| 490 | 3300002239 | JGI24034J26672_10000071 | JGI24034J26672_100000716 | 191 |
| 491 | 3300003911 | JGI25405J52794_10003563 | JGI25405J52794_100035632 | 191 |
| 492 | 3300005289 | Ga0065704_10337971 | Ga0065704_103379712 | 191 |
| 493 | 3300005295 | Ga0065707_10082140 | Ga0065707_100821406 | 191 |
| 494 | 3300005327 | Ga0070658_10052276 | Ga0070658_100522763 | 191 |
| 495 | 3300005330 | Ga0070690_100000110 | Ga0070690_1000001103 | 191 |
| 496 | 3300005335 | Ga0070666_10000069 | Ga0070666_1000006913 | 191 |
| 497 | 3300005340 | Ga0070689_100008265 | Ga0070689_1000082651 | 191 |
| 498 | 3300005344 | Ga0070661_100058315 | Ga0070661_1000583152 | 191 |
| 499 | 3300005347 | Ga0070668_100144786 | Ga0070668_1001447861 | 191 |
| 500 | 3300005353 | Ga0070669_100000167 | Ga0070669_10000016758 | 191 |
| 501 | 3300005365 | Ga0070688_100033833 | Ga0070688_1000338332 | 191 |
| 502 | 3300005366 | Ga0070659_100010748 | Ga0070659_1000107483 | 191 |
| 503 | 3300005367 | Ga0070667_100004644 | Ga0070667_10000464412 | 191 |
| 504 | 3300005455 | Ga0070663_100008392 | Ga0070663_1000083922 | 191 |
| 505 | 3300005457 | Ga0070662_100564757 | Ga0070662_1005647572 | 191 |
| 506 | 3300005466 | Ga0070685_10000036 | Ga0070685_1000003662 | 191 |
| 507 | 3300005535 | Ga0070684_100172175 | Ga0070684_1001721752 | 191 |
| 508 | 3300005543 | Ga0070672_100336696 | Ga0070672_1003366962 | 191 |
| 509 | 3300005544 | Ga0070686_100000045 | Ga0070686_10000004565 | 191 |
| 510 | 3300005548 | Ga0070665_100000042 | Ga0070665_100000042224 | 191 |
| 511 | 3300005617 | Ga0068859_100008241 | Ga0068859_1000082412 | 191 |
| 512 | 3300005618 | Ga0068864_100144324 | Ga0068864_1001443241 | 191 |
| 513 | 3300005719 | Ga0068861_100001207 | Ga0068861_1000012073 | 191 |
| 514 | 3300005841 | Ga0068863_100000239 | Ga0068863_10000023957 | 191 |
| 515 | 3300005842 | Ga0068858_100002824 | Ga0068858_10000282415 | 191 |
| 516 | 3300005843 | Ga0068860_100000182 | Ga0068860_10000018266 | 191 |
| 517 | 3300005844 | Ga0068862_100000308 | Ga0068862_1000003084 | 191 |
| 518 | 3300005937 | Ga0081455_10000215 | Ga0081455_1000021542 | 191 |
| 519 | 3300006931 | Ga0097620_100008240 | Ga0097620_1000082402 | 191 |
| 520 | 3300009101 | Ga0105247_10010996 | Ga0105247_100109965 | 191 |
| 521 | 3300009177 | Ga0105248_10129926 | Ga0105248_101299261 | 191 |
| 522 | 3300009545 | Ga0105237_10122940 | Ga0105237_101229402 | 191 |
| 523 | 3300009553 | Ga0105249_10000012 | Ga0105249_1000001264 | 191 |
| 524 | 3300013100 | Ga0157373_10116382 | Ga0157373_101163822 | 191 |
| 525 | 3300013102 | Ga0157371_10184628 | Ga0157371_101846282 | 191 |
| 526 | 3300013297 | Ga0157378_10020993 | Ga0157378_100209936 | 191 |
| 527 | 3300013306 | Ga0163162_10228716 | Ga0163162_102287162 | 191 |
| 528 | 3300013307 | Ga0157372_10180258 | Ga0157372_101802582 | 191 |
| 529 | 3300013308 | Ga0157375_11070886 | Ga0157375_110708861 | 191 |
| 530 | 3300014326 | Ga0157380_10002669 | Ga0157380_100026697 | 191 |
| 531 | 3300014326 | Ga0157380_10012259 | Ga0157380_100122593 | 191 |
| 532 | 3300014968 | Ga0157379_10037988 | Ga0157379_100379885 | 191 |
| 533 | 3300017792 | Ga0163161_10000202 | Ga0163161_1000020231 | 191 |
| 534 | 3300025321 | Ga0207656_10044753 | Ga0207656_100447533 | 191 |
| 535 | 3300025903 | Ga0207680_10000012 | Ga0207680_10000012222 | 191 |
| 536 | 3300025904 | Ga0207647_10002793 | Ga0207647_100027932 | 191 |
| 537 | 3300025911 | Ga0207654_10000754 | Ga0207654_1000075412 | 191 |
| 538 | 3300025913 | Ga0207695_10044031 | Ga0207695_100440316 | 191 |
| 539 | 3300025914 | Ga0207671_10005938 | Ga0207671_100059382 | 191 |
| 540 | 3300025919 | Ga0207657_10060829 | Ga0207657_100608294 | 191 |
| 541 | 3300025920 | Ga0207649_10058641 | Ga0207649_100586413 | 191 |
| 542 | 3300025923 | Ga0207681_10000076 | Ga0207681_1000007658 | 191 |
| 543 | 3300025924 | Ga0207694_10036918 | Ga0207694_100369182 | 191 |
| 544 | 3300025925 | Ga0207650_10027745 | Ga0207650_100277452 | 191 |
| 545 | 3300025931 | Ga0207644_10000254 | Ga0207644_1000025426 | 191 |
| 546 | 3300025940 | Ga0207691_10326015 | Ga0207691_103260152 | 191 |
| 547 | 3300025945 | Ga0207679_10148547 | Ga0207679_101485472 | 191 |
| 548 | 3300025949 | Ga0207667_10063601 | Ga0207667_100636015 | 191 |
| 549 | 3300025961 | Ga0207712_10000021 | Ga0207712_10000021222 | 191 |
| 550 | 3300025972 | Ga0207668_10049598 | Ga0207668_100495982 | 191 |
| 551 | 3300025981 | Ga0207640_10017102 | Ga0207640_100171022 | 191 |
| 552 | 3300025986 | Ga0207658_10001629 | Ga0207658_100016292 | 191 |
| 553 | 3300026035 | Ga0207703_10007079 | Ga0207703_100070792 | 191 |
| 554 | 3300026041 | Ga0207639_10036138 | Ga0207639_100361385 | 191 |
| 555 | 3300026078 | Ga0207702_10011360 | Ga0207702_100113608 | 191 |
| 556 | 3300026088 | Ga0207641_10000589 | Ga0207641_1000058929 | 191 |
| 557 | 3300026089 | Ga0207648_11116444 | Ga0207648_111164441 | 191 |
| 558 | 3300026095 | Ga0207676_10016182 | Ga0207676_100161822 | 191 |
| 559 | 3300026095 | Ga0207676_10926907 | Ga0207676_109269071 | 191 |
| 560 | 3300026118 | Ga0207675_100000227 | Ga0207675_10000022719 | 191 |
| 561 | 3300026142 | Ga0207698_10424790 | Ga0207698_104247902 | 191 |
| 562 | 3300028379 | Ga0268266_10000054 | Ga0268266_10000054221 | 191 |
| 563 | 3300028380 | Ga0268265_10004696 | Ga0268265_1000469610 | 191 |
| 564 | 3300028381 | Ga0268264_10000074 | Ga0268264_10000074222 | 191 |
| 565 | 3300046525 | Ga0495663_0024611 | Ga0495663_0024611_506_1084 | 191 |
| 566 | 3300046530 | Ga0495654_0001135 | Ga0495654_0001135_3804_4382 | 191 |
| 567 | 3300046616 | Ga0495668_0010459 | Ga0495668_0010459_139_717 | 191 |
| 568 | 3300048903 | Ga0496100_0202683 | Ga0496100_0202683_375_956 | 191 |
| 569 | 3300048905 | Ga0496102_0005342 | Ga0496102_0005342_6395_6976 | 191 |
| 570 | 3300048906 | Ga0496103_0001069 | Ga0496103_0001069_15516_16097 | 191 |
| 571 | 3300048909 | Ga0496106_0231552 | Ga0496106_0231552_503_1084 | 191 |
| 572 | 3300048910 | Ga0496107_0174134 | Ga0496107_0174134_184_765 | 191 |
| 573 | 3300048914 | Ga0496111_0455104 | Ga0496111_0455104_229_810 | 191 |
| 574 | 3300048919 | Ga0496116_0018743 | Ga0496116_0018743_1531_2112 | 191 |
| 575 | 3300048920 | Ga0496117_0007388 | Ga0496117_0007388_5735_6316 | 191 |
| 576 | 3300048921 | Ga0496118_0014592 | Ga0496118_0014592_2234_2815 | 191 |
| 577 | 3300048927 | Ga0496124_0372003 | Ga0496124_0372003_71_652 | 191 |
| 578 | 3300053158 | Ga0500627_0002353 | Ga0500627_0002353_140_718 | 191 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8h7d-assembly1.cif.gz_B | crystal structure of a de novo enzyme, ferric enterobactin esterase syn-f4 (k4t) | 0.8617 | 62 | 123 |
| 8h7e-assembly1.cif.gz_A | crystal structure of a de novo enzyme, ferric enterobactin esterase syn-f4 (k4t) at 2.0 angstrom resolution | 0.8262 | 62 | 123 |
| 8glv-assembly1.cif.gz_5V | 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella | 0.8062 | 62 | 123 |
| 6u42-assembly1.cif.gz_5V | natively decorated ciliary doublet microtubule | 0.805 | 62 | 123 |
| 8h7e-assembly1.cif.gz_B | crystal structure of a de novo enzyme, ferric enterobactin esterase syn-f4 (k4t) at 2.0 angstrom resolution | 0.7465 | 72 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXZ1_152_207_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 1 | 125 | 179 | 2.30.22.10 |
| af_A0A0P0VLJ4_201_256_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9985 | 125 | 179 | 2.30.22.10 |
| af_Q99LP6_159_215_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.982 | 125 | 181 | 2.30.22.10 |
| af_Q99LP6_159_215_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9654 | 125 | 181 | 2.30.22.10 |
| af_Q2FXZ1_152_207_2.30.22.10 | Mainly Beta;Roll;Nucleotide Exchange Factor Grpe; Chain A, domain 2;Head domain of nucleotide exchange factor GrpE | 0.9651 | 125 | 179 | 2.30.22.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A402FET6-F1-model_v4 | deleted | 0.9326 | 73 | 183 |
|
| AF-A0A7C6QX86-F1-model_v4 | Protein GrpE (HSP-70 cofactor) | 0.9194 | 22 | 191 |
GO:0000774
GO:0005737 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-E0U9J0-F1-model_v4 | Protein GrpE (HSP-70 cofactor) | 0.9131 | 23 | 191 |
GO:0000774
GO:0005737 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-B7KLH9-F1-model_v4 | Protein GrpE (HSP-70 cofactor) | 0.9056 | 23 | 191 |
GO:0000774
GO:0005737 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
| AF-B3EPC6-F1-model_v4 | Protein GrpE (HSP-70 cofactor) | 0.9029 | 22 | 181 |
GO:0000774
GO:0005737 GO:0006457 GO:0042803 GO:0051082 GO:0051087 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar